F457041

General Info

Members Datasets Scaffolds Average Seq Length
509 274 509 224

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0309465|Ga0495676_0309465_120_794
Length 212
Sequence VVLAAACVLLGLTAALWPGGADGAKPKAVVLGVTSTTPAPACPGSPCEAVGSVSGFQTVAGTTKKPFEAPFDGRVVAWSLTMSSPDSPPEARVGIVKQTNVGKSPPRYKLLRESPVVVLTPFLGTTVTFTLDSPLTVRQGNEIILTIPTWAPAFSVGLSDQSSWRASRQTGKCTSTNDIKASHPQQKVGSEKQYGCFYKTARLLYTATLIKG

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
272 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 11
Rhizosphere 84.28
Stem 0
Stem Tuber 0
Unclassified 3.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1003358 3300000532 Unclassified 1066
2 JGI24746J21847_1000055 3300001977 Bacteria 11340
3 JGI24740J21852_10001321 3300001979 Bacteria 11267
4 JGI24034J26672_10000207 3300002239 Bacteria 7761
5 JGI24742J22300_10009033 3300002244 Bacteria 1644
6 rootH2_10156820 3300003320 Bacteria 1383
7 JGI25404J52841_10003786 3300003659 Bacteria 3018
8 Ga0070658_10308148 3300005327 Bacteria 1351
9 Ga0070683_100009175 3300005329 Bacteria 8445
10 Ga0070683_100020190 3300005329 Bacteria 5927
11 Ga0070683_100236556 3300005329 Bacteria 1737
12 Ga0070683_100496789 3300005329 Bacteria 1165
13 Ga0070677_10000004 3300005333 Bacteria 81101
14 Ga0068869_100285565 3300005334 Bacteria 1328
15 Ga0070680_100092076 3300005336 Bacteria 2510
16 Ga0070682_100000117 3300005337 Bacteria 69662
17 Ga0068868_100000878 3300005338 Bacteria 20396
18 Ga0068868_100002616 3300005338 Bacteria 12489
19 Ga0070689_100046763 3300005340 Bacteria 3335
20 Ga0070691_10000114 3300005341 Bacteria 24224
21 Ga0070691_10008513 3300005341 Bacteria 4697
22 Ga0070661_100000023 3300005344 Bacteria 123104
23 Ga0070668_100034077 3300005347 Bacteria 3880
24 Ga0070668_100055354 3300005347 Bacteria 3061
25 Ga0070668_100893226 3300005347 Unclassified 794
26 Ga0070675_100000111 3300005354 Bacteria 47699
27 Ga0070674_100000064 3300005356 Bacteria 47689
28 Ga0070674_100000088 3300005356 Bacteria 42730
29 Ga0070673_100011064 3300005364 Bacteria 6148
30 Ga0070688_100001862 3300005365 Bacteria 10574
31 Ga0070688_100002739 3300005365 Bacteria 8952
32 Ga0070659_100056745 3300005366 Bacteria 3088
33 Ga0070667_100015704 3300005367 Bacteria 6261
34 Ga0070667_100089494 3300005367 Bacteria 2644
35 Ga0070714_100041949 3300005435 Bacteria 3863
36 Ga0070713_100006276 3300005436 Bacteria 8229
37 Ga0070713_100238926 3300005436 Bacteria 1654
38 Ga0070701_10084723 3300005438 Unclassified 1724
39 Ga0070700_100027741 3300005441 Bacteria 3361
40 Ga0070700_100119119 3300005441 Unclassified 1766
41 Ga0070663_100012768 3300005455 Bacteria 5327
42 Ga0070678_100010114 3300005456 Bacteria 5744
43 Ga0070678_100045907 3300005456 Bacteria 3129
44 Ga0070662_100000004 3300005457 Bacteria 195534
45 Ga0070681_10060396 3300005458 Bacteria 3768
46 Ga0070681_10191341 3300005458 Bacteria 1965
47 Ga0068867_100007033 3300005459 Bacteria 7948
48 Ga0070685_10000189 3300005466 Bacteria 41176
49 Ga0070685_10002457 3300005466 Bacteria 9510
50 Ga0070685_10021760 3300005466 Bacteria 3488
51 Ga0070685_10396414 3300005466 Bacteria 955
52 Ga0070679_100000068 3300005530 Bacteria 77184
53 Ga0070679_100004640 3300005530 Bacteria 12683
54 Ga0070684_100020221 3300005535 Bacteria 5523
55 Ga0070684_100037113 3300005535 Bacteria 4177
56 Ga0070684_100099139 3300005535 Bacteria 2600
57 Ga0070684_100113629 3300005535 Bacteria 2430
58 Ga0070684_100174172 3300005535 Bacteria 1955
59 Ga0070684_100381581 3300005535 Bacteria 1298
60 Ga0068853_100004641 3300005539 Bacteria 10652
61 Ga0070672_100000015 3300005543 Bacteria 72591
62 Ga0070695_100213603 3300005545 Unclassified 1386
63 Ga0070693_100018982 3300005547 Bacteria 3598
64 Ga0070693_100415341 3300005547 Bacteria 936
65 Ga0070665_100000106 3300005548 Bacteria 157315
66 Ga0070665_100096537 3300005548 Bacteria 2960
67 Ga0070665_100124078 3300005548 Bacteria 2584
68 Ga0068855_100199249 3300005563 Bacteria 2255
69 Ga0070664_100082712 3300005564 Bacteria 2769
70 Ga0068854_100000183 3300005578 Bacteria 42525
71 Ga0068854_100026557 3300005578 Bacteria 3981
72 Ga0068856_100000757 3300005614 Bacteria 35080
73 Ga0068856_100065218 3300005614 Bacteria 3598
74 Ga0068856_100208015 3300005614 Bacteria 1971
75 Ga0068856_100257319 3300005614 Bacteria 1761
76 Ga0070702_100105177 3300005615 Unclassified 1739
77 Ga0068852_100000093 3300005616 Bacteria 60834
78 Ga0068852_100000184 3300005616 Bacteria 42515
79 Ga0068852_100473610 3300005616 Bacteria 1243
80 Ga0068864_100000053 3300005618 Bacteria 133049
81 Ga0068866_10000001 3300005718 Bacteria 519680
82 Ga0068866_10002045 3300005718 Bacteria 8401
83 Ga0068866_10118277 3300005718 Bacteria 1489
84 Ga0068851_10014831 3300005834 Bacteria 3706
85 Ga0068851_10261609 3300005834 Bacteria 984
86 Ga0068863_100003824 3300005841 Bacteria 14883
87 Ga0068863_100041919 3300005841 Bacteria 4350
88 Ga0068863_100200649 3300005841 Bacteria 1919
89 Ga0068858_100000091 3300005842 Bacteria 93802
90 Ga0068858_100000216 3300005842 Bacteria 62188
91 Ga0068860_100009408 3300005843 Bacteria 9711
92 Ga0068860_100100466 3300005843 Bacteria 2760
93 Ga0068860_100203003 3300005843 Bacteria 1921
94 Ga0068862_100064035 3300005844 Bacteria 3164
95 Ga0081455_10016180 3300005937 Bacteria 7211
96 Ga0081455_10020586 3300005937 Bacteria 6208
97 Ga0081540_1000049 3300005983 Bacteria 127322
98 Ga0081539_10000791 3300005985 Bacteria 61600
99 Ga0070715_10000001 3300006163 Bacteria 693690
100 Ga0070715_10042222 3300006163 Bacteria 1916
101 Ga0070712_100009103 3300006175 Bacteria 6251
102 Ga0068871_100346630 3300006358 Unclassified 1313
103 Ga0068871_100357903 3300006358 Unclassified 1292
104 Ga0075430_100118679 3300006846 Bacteria 2205
105 Ga0075430_100590663 3300006846 Bacteria 916
106 Ga0075433_10000041 3300006852 Bacteria 52354
107 Ga0075433_10283226 3300006852 Bacteria 1468
108 Ga0068865_100001277 3300006881 Bacteria 14651
109 Ga0105240_10393293 3300009093 Bacteria 1563
110 Ga0105245_10001831 3300009098 Bacteria 19354
111 Ga0105245_10014091 3300009098 Bacteria 6966
112 Ga0105245_10049211 3300009098 Bacteria 3774
113 Ga0105245_10057318 3300009098 Bacteria 3504
114 Ga0105245_10506295 3300009098 Unclassified 1224
115 Ga0105247_10000242 3300009101 Bacteria 51204
116 Ga0105243_10064297 3300009148 Bacteria 2944
117 Ga0105243_10212980 3300009148 Bacteria 1703
118 Ga0105241_10075574 3300009174 Bacteria 2625
119 Ga0105242_10004263 3300009176 Bacteria 11148
120 Ga0105242_10006049 3300009176 Bacteria 9326
121 Ga0105242_10040881 3300009176 Bacteria 3736
122 Ga0105242_10046516 3300009176 Bacteria 3520
123 Ga0105248_10000008 3300009177 Bacteria 403910
124 Ga0105237_10140426 3300009545 Bacteria 2410
125 Ga0105249_10007533 3300009553 Bacteria 9496
126 Ga0105249_10214149 3300009553 Unclassified 1892
127 Ga0105239_10086142 3300010375 Bacteria 3462
128 Ga0105239_11408742 3300010375 Unclassified 805
129 Ga0157371_10005310 3300013102 Bacteria 10906
130 Ga0157370_10011805 3300013104 Bacteria 9116
131 Ga0157370_10065492 3300013104 Bacteria 3438
132 Ga0157370_10213701 3300013104 Bacteria 1787
133 Ga0157369_10000110 3300013105 Bacteria 115514
134 Ga0157369_10541824 3300013105 Unclassified 1203
135 Ga0157369_10617400 3300013105 Bacteria 1119
136 Ga0157374_10025432 3300013296 Bacteria 5316
137 Ga0157374_10080363 3300013296 Bacteria 3092
138 Ga0157374_10099651 3300013296 Bacteria 2784
139 Ga0157378_10009271 3300013297 Bacteria 8574
140 Ga0157378_10013004 3300013297 Bacteria 7281
141 Ga0157372_10000129 3300013307 Bacteria 82491
142 Ga0157375_10000477 3300013308 Bacteria 36502
143 Ga0157375_10015827 3300013308 Bacteria 6759
144 Ga0157375_10636891 3300013308 Bacteria 1223
145 Ga0163163_10463891 3300014325 Unclassified 1327
146 Ga0157380_10000281 3300014326 Bacteria 30636
147 Ga0157380_10000843 3300014326 Bacteria 19177
148 Ga0157380_10152215 3300014326 Bacteria 2001
149 Ga0157379_10022281 3300014968 Bacteria 5611
150 Ga0157379_10053684 3300014968 Bacteria 3600
151 Ga0157379_10099202 3300014968 Bacteria 2615
152 Ga0157379_10164376 3300014968 Bacteria 2003
153 Ga0157376_10074861 3300014969 Bacteria 2888
154 Ga0163161_10000035 3300017792 Bacteria 155979
155 Ga0206356_10071296 3300020070 Bacteria 1771
156 Ga0206352_10696586 3300020078 Bacteria 864
157 Ga0206350_11173658 3300020080 Bacteria 1673
158 Ga0224712_10057272 3300022467 Bacteria 1540
159 Ga0207656_10001601 3300025321 Bacteria 7532
160 Ga0207656_10169880 3300025321 Bacteria 1042
161 Ga0207682_10000274 3300025893 Bacteria 23379
162 Ga0207642_10000002 3300025899 Bacteria 658166
163 Ga0207642_10000447 3300025899 Bacteria 12522
164 Ga0207710_10000531 3300025900 Bacteria 23383
165 Ga0207685_10000027 3300025905 Bacteria 102101
166 Ga0207685_10019416 3300025905 Bacteria 2240
167 Ga0207707_10023876 3300025912 Bacteria 5347
168 Ga0207693_10004716 3300025915 Bacteria 11470
169 Ga0207649_10000523 3300025920 Bacteria 26930
170 Ga0207649_10175589 3300025920 Bacteria 1496
171 Ga0207652_10000044 3300025921 Bacteria 127779
172 Ga0207652_10008706 3300025921 Bacteria 8168
173 Ga0207694_10608575 3300025924 Bacteria 919
174 Ga0207650_10055049 3300025925 Bacteria 2952
175 Ga0207659_10000010 3300025926 Bacteria 286639
176 Ga0207687_10000007 3300025927 Bacteria 604185
177 Ga0207687_10000018 3300025927 Bacteria 236159
178 Ga0207687_10002454 3300025927 Bacteria 12584
179 Ga0207687_10002457 3300025927 Bacteria 12576
180 Ga0207687_10389648 3300025927 Unclassified 1143
181 Ga0207700_10000027 3300025928 Bacteria 137708
182 Ga0207664_10015668 3300025929 Bacteria 5510
183 Ga0207706_10000012 3300025933 Bacteria 195475
184 Ga0207686_10000033 3300025934 Bacteria 143602
185 Ga0207686_10001975 3300025934 Bacteria 11300
186 Ga0207686_10030930 3300025934 Bacteria 3175
187 Ga0207686_10032253 3300025934 Bacteria 3117
188 Ga0207709_10033039 3300025935 Bacteria 3034
189 Ga0207709_10234121 3300025935 Unclassified 1332
190 Ga0207670_10075101 3300025936 Bacteria 2348
191 Ga0207669_10000018 3300025937 Bacteria 114254
192 Ga0207669_10000560 3300025937 Bacteria 16246
193 Ga0207704_10000093 3300025938 Bacteria 52224
194 Ga0207665_10531296 3300025939 Unclassified 912
195 Ga0207691_10000044 3300025940 Bacteria 100027
196 Ga0207711_10000006 3300025941 Bacteria 792692
197 Ga0207689_10328562 3300025942 Unclassified 1270
198 Ga0207661_10000262 3300025944 Bacteria 33960
199 Ga0207661_10004696 3300025944 Bacteria 9570
200 Ga0207661_10017394 3300025944 Bacteria 5319
201 Ga0207661_10129624 3300025944 Bacteria 2158
202 Ga0207661_10574521 3300025944 Bacteria 1034
203 Ga0207679_10066507 3300025945 Bacteria 2701
204 Ga0207667_10096326 3300025949 Bacteria 3054
205 Ga0207651_10003318 3300025960 Bacteria 7892
206 Ga0207712_10000007 3300025961 Bacteria 539589
207 Ga0207712_10028557 3300025961 Bacteria 3733
208 Ga0207712_10185531 3300025961 Unclassified 1637
209 Ga0207712_10301722 3300025961 Bacteria 1315
210 Ga0207668_10024588 3300025972 Bacteria 3890
211 Ga0207640_10000200 3300025981 Bacteria 42738
212 Ga0207658_10003306 3300025986 Bacteria 11441
213 Ga0207658_10060423 3300025986 Bacteria 2828
214 Ga0207677_10002133 3300026023 Bacteria 10392
215 Ga0207677_10002836 3300026023 Bacteria 9133
216 Ga0207703_10000023 3300026035 Bacteria 222018
217 Ga0207703_10000152 3300026035 Bacteria 79658
218 Ga0207639_10002934 3300026041 Bacteria 11462
219 Ga0207708_10032385 3300026075 Bacteria 3970
220 Ga0207708_10094640 3300026075 Bacteria 2306
221 Ga0207702_10000060 3300026078 Bacteria 125473
222 Ga0207702_10003333 3300026078 Bacteria 14742
223 Ga0207702_10174007 3300026078 Bacteria 1977
224 Ga0207641_10000405 3300026088 Bacteria 50517
225 Ga0207641_10012343 3300026088 Bacteria 7009
226 Ga0207648_10002917 3300026089 Bacteria 18105
227 Ga0207676_10000094 3300026095 Bacteria 80575
228 Ga0207675_100137883 3300026118 Bacteria 2316
229 Ga0207683_10010521 3300026121 Bacteria 7895
230 Ga0207683_10052815 3300026121 Bacteria 3562
231 Ga0207698_10000440 3300026142 Bacteria 23916
232 Ga0207698_10114229 3300026142 Bacteria 2271
233 Ga0207698_11242734 3300026142 Unclassified 759
234 Ga0268266_10000047 3300028379 Bacteria 310996
235 Ga0268266_10011189 3300028379 Bacteria 7808
236 Ga0268266_10047678 3300028379 Bacteria 3672
237 Ga0268266_10430709 3300028379 Bacteria 1251
238 Ga0268265_10006440 3300028380 Bacteria 7958
239 Ga0268264_10005284 3300028381 Bacteria 10935
240 Ga0268264_10062371 3300028381 Bacteria 3130
241 Ga0265326_10000102 3300028558 Bacteria 43681
242 Ga0265319_1000122 3300028563 Bacteria 58869
243 Ga0265334_10079477 3300028573 Unclassified 1210
244 Ga0265322_10000001 3300028654 Bacteria 543854
245 Ga0265338_10000706 3300028800 Bacteria 56988
246 Ga0265338_10314739 3300028800 Bacteria 1135
247 Ga0265324_10004881 3300029957 Bacteria 5905
248 Ga0265328_10004536 3300031239 Bacteria 6023
249 Ga0265320_10000002 3300031240 Bacteria 542875
250 Ga0265329_10017040 3300031242 Bacteria 2507
251 Ga0265331_10001492 3300031250 Bacteria 17280
252 Ga0265331_10050112 3300031250 Bacteria 2003
253 Ga0265327_10000011 3300031251 Bacteria 543807
254 Ga0265327_10159981 3300031251 Bacteria 1041
255 Ga0265316_10005389 3300031344 Bacteria 12443
256 Ga0265314_10000062 3300031711 Bacteria 159496
257 Ga0307415_100021962 3300032126 Bacteria 3932
258 Ga0373937_0002885 3300036401 Bacteria 14356
259 Ga0451833_0049203 3300041491 Unclassified 986
260 Ga0451835_1207196 3300041492 Bacteria 725
261 Ga0451839_1548401 3300041496 Bacteria 2260
262 Ga0451853_1164472 3300041512 Unclassified 1222
263 Ga0451853_2489483 3300041512 Bacteria 3249
264 Ga0466963_0000001 3300044694 Bacteria 110556
265 Ga0466963_0032694 3300044694 Bacteria 3371
266 Ga0466963_0190061 3300044694 Bacteria 1434
267 Ga0466957_0007902 3300044842 Bacteria 6034
268 Ga0466957_0233193 3300044842 Unclassified 1219
269 Ga0466958_0043625 3300045836 Bacteria 2701
270 Ga0466967_0000009 3300045976 Bacteria 122610
271 Ga0466967_0339084 3300045976 Bacteria 1453
272 Ga0495592_0000141 3300046454 Bacteria 63776
273 Ga0495603_0000016 3300046455 Bacteria 67399
274 Ga0495603_0000333 3300046455 Bacteria 25490
275 Ga0495629_0003074 3300046459 Bacteria 12673
276 Ga0495629_0024075 3300046459 Bacteria 4336
277 Ga0495629_0054557 3300046459 Bacteria 2795
278 Ga0495638_0069471 3300046460 Bacteria 2159
279 Ga0495641_0000874 3300046461 Bacteria 25824
280 Ga0495651_0214944 3300046462 Unclassified 1335
281 Ga0495653_0232745 3300046463 Unclassified 1232
282 Ga0495582_0000011 3300046473 Bacteria 113352
283 Ga0495662_0000061 3300046476 Bacteria 37295
284 Ga0495594_0000003 3300046499 Bacteria 199267
285 Ga0495606_0000565 3300046507 Bacteria 58752
286 Ga0495608_0000068 3300046511 Bacteria 79694
287 Ga0495608_0009775 3300046511 Bacteria 6694
288 Ga0495608_0112860 3300046511 Bacteria 1746
289 Ga0495610_0059515 3300046512 Bacteria 1823
290 Ga0495618_0000174 3300046514 Bacteria 45942
291 Ga0495618_0487226 3300046514 Bacteria 745
292 Ga0495620_0000144 3300046515 Bacteria 58204
293 Ga0495620_0053343 3300046515 Bacteria 1712
294 Ga0495628_0001677 3300046516 Bacteria 20220
295 Ga0495628_0035454 3300046516 Bacteria 4008
296 Ga0495628_0095389 3300046516 Bacteria 2298
297 Ga0495630_0000056 3300046517 Bacteria 91477
298 Ga0495630_0002389 3300046517 Bacteria 13049
299 Ga0495630_0125789 3300046517 Bacteria 1945
300 Ga0495630_0311217 3300046517 Bacteria 1204
301 Ga0495644_0000091 3300046523 Bacteria 45180
302 Ga0495652_0451763 3300046529 Bacteria 899
303 Ga0495640_0061096 3300046533 Bacteria 2561
304 Ga0495640_0088310 3300046533 Bacteria 2049
305 Ga0495586_0001090 3300046535 Bacteria 15336
306 Ga0495587_0002685 3300046536 Bacteria 11874
307 Ga0495587_0038513 3300046536 Bacteria 2865
308 Ga0495587_0054004 3300046536 Bacteria 2368
309 Ga0495598_0029827 3300046537 Bacteria 1523
310 Ga0495645_0359327 3300046543 Bacteria 936
311 Ga0495667_0000018 3300046559 Bacteria 188610
312 Ga0495656_0001290 3300046615 Bacteria 8149
313 Ga0495668_0119610 3300046616 Bacteria 1440
314 Ga0495634_0000247 3300046642 Bacteria 50931
315 Ga0495634_0005521 3300046642 Bacteria 9712
316 Ga0495625_0000587 3300046660 Bacteria 52838
317 Ga0495635_0000016 3300046663 Bacteria 214088
318 Ga0495635_0047417 3300046663 Bacteria 2963
319 Ga0495635_0050935 3300046663 Bacteria 2854
320 Ga0495588_0000165 3300046674 Bacteria 85841
321 Ga0495657_0000004 3300046675 Bacteria 266465
322 Ga0495657_0019232 3300046675 Bacteria 4931
323 Ga0495647_0000008 3300046681 Bacteria 101193
324 Ga0495647_0000397 3300046681 Bacteria 12436
325 Ga0495647_0000603 3300046681 Bacteria 10627
326 Ga0495647_0088673 3300046681 Bacteria 1265
327 Ga0495658_0000005 3300046683 Bacteria 149839
328 Ga0495658_0099908 3300046683 Bacteria 1730
329 Ga0495658_0130534 3300046683 Bacteria 1529
330 Ga0495669_0000308 3300046684 Bacteria 26995
331 Ga0495669_0107271 3300046684 Unclassified 1301
332 Ga0495613_0000179 3300046689 Bacteria 62109
333 Ga0495613_0000803 3300046689 Bacteria 24344
334 Ga0495613_0187413 3300046689 Bacteria 1463
335 Ga0495624_0000008 3300046690 Bacteria 145035
336 Ga0495624_0000073 3300046690 Bacteria 65582
337 Ga0495624_0143204 3300046690 Bacteria 1463
338 Ga0495649_0019907 3300046694 Bacteria 3767
339 Ga0495600_0020679 3300046809 Bacteria 4209
340 Ga0495604_0000055 3300047317 Bacteria 100430
341 Ga0495604_0000357 3300047317 Bacteria 40931
342 Ga0495674_0000607 3300047319 Bacteria 33608
343 Ga0495674_0095683 3300047319 Bacteria 2532
344 Ga0495672_0060798 3300047320 Bacteria 2180
345 Ga0495676_0032369 3300047321 Bacteria 4414
346 Ga0495676_0132389 3300047321 Bacteria 1798
347 Ga0495676_0309465 3300047321 Bacteria 1063
348 Ga0495680_0001641 3300047322 Bacteria 23765
349 Ga0495680_0001716 3300047322 Bacteria 23253
350 Ga0495680_0008749 3300047322 Bacteria 9169
351 Ga0495680_0213359 3300047322 Unclassified 1381
352 Ga0495680_0400103 3300047322 Bacteria 948
353 Ga0495675_0000107 3300047444 Bacteria 59970
354 Ga0495673_0078027 3300047469 Bacteria 1378
355 Ga0495684_0154683 3300047471 Bacteria 1713
356 Ga0495686_0052126 3300047472 Bacteria 2566
357 Ga0495686_0249369 3300047472 Unclassified 998
358 Ga0495593_0102687 3300047673 Bacteria 1465
359 Ga0495602_0001172 3300048088 Bacteria 25703
360 Ga0495602_0007085 3300048088 Bacteria 11769
361 Ga0495602_0129621 3300048088 Unclassified 2014
362 Ga0495602_0181248 3300048088 Bacteria 1624
363 Ga0496100_0000002 3300048903 Bacteria 489057
364 Ga0496101_0000001 3300048904 Bacteria 489057
365 Ga0496101_0000062 3300048904 Bacteria 126595
366 Ga0496102_0000039 3300048905 Bacteria 198306
367 Ga0496102_0215198 3300048905 Bacteria 1811
368 Ga0496102_0373326 3300048905 Unclassified 1342
369 Ga0496103_0000008 3300048906 Bacteria 340474
370 Ga0496103_0051550 3300048906 Bacteria 2547
371 Ga0496103_0057331 3300048906 Bacteria 2418
372 Ga0496104_0000004 3300048907 Bacteria 641830
373 Ga0496104_0000650 3300048907 Bacteria 29817
374 Ga0496104_0089025 3300048907 Bacteria 2949
375 Ga0496105_0000001 3300048908 Bacteria 1328178
376 Ga0496105_0000007 3300048908 Bacteria 339658
377 Ga0496105_0000347 3300048908 Bacteria 30490
378 Ga0496106_0000061 3300048909 Bacteria 86524
379 Ga0496106_0002128 3300048909 Bacteria 14816
380 Ga0496106_0003741 3300048909 Bacteria 11350
381 Ga0496107_0000006 3300048910 Bacteria 258746
382 Ga0496107_0000013 3300048910 Bacteria 178284
383 Ga0496107_0079309 3300048910 Bacteria 2393
384 Ga0496108_0000001 3300048911 Bacteria 919044
385 Ga0496108_0000062 3300048911 Bacteria 122391
386 Ga0496108_0000187 3300048911 Bacteria 57568
387 Ga0496108_0102393 3300048911 Bacteria 2443
388 Ga0496109_0000003 3300048912 Bacteria 420862
389 Ga0496109_0000007 3300048912 Bacteria 247554
390 Ga0496109_0000129 3300048912 Bacteria 77469
391 Ga0496109_0000636 3300048912 Bacteria 29254
392 Ga0496109_0157685 3300048912 Bacteria 2126
393 Ga0496109_0356647 3300048912 Bacteria 1381
394 Ga0496109_0434037 3300048912 Bacteria 1241
395 Ga0496110_0000087 3300048913 Bacteria 48905
396 Ga0496110_0016119 3300048913 Bacteria 6233
397 Ga0496110_0106752 3300048913 Bacteria 2513
398 Ga0496110_0184037 3300048913 Bacteria 1897
399 Ga0496111_0000010 3300048914 Bacteria 92600
400 Ga0496111_0064222 3300048914 Bacteria 2663
401 Ga0496111_0120142 3300048914 Bacteria 1941
402 Ga0496111_0233624 3300048914 Bacteria 1366
403 Ga0496112_0000006 3300048915 Bacteria 365227
404 Ga0496112_0053466 3300048915 Bacteria 3967
405 Ga0496112_0286713 3300048915 Bacteria 1593
406 Ga0496112_1019846 3300048915 Unclassified 747
407 Ga0496113_0011978 3300048916 Bacteria 5813
408 Ga0496113_0029942 3300048916 Bacteria 3936
409 Ga0496113_0055077 3300048916 Bacteria 2980
410 Ga0496113_0088669 3300048916 Bacteria 2380
411 Ga0496113_0253937 3300048916 Bacteria 1404
412 Ga0496114_0000014 3300048917 Bacteria 297902
413 Ga0496114_0033155 3300048917 Bacteria 4254
414 Ga0496114_0182470 3300048917 Bacteria 1833
415 Ga0496114_0247493 3300048917 Unclassified 1568
416 Ga0496115_0000003 3300048918 Bacteria 354994
417 Ga0496115_0000125 3300048918 Bacteria 69936
418 Ga0496115_0031289 3300048918 Bacteria 4192
419 Ga0496116_0001565 3300048919 Bacteria 25265
420 Ga0496117_0113649 3300048920 Bacteria 1680
421 Ga0496118_0000818 3300048921 Bacteria 49518
422 Ga0496118_0276065 3300048921 Unclassified 938
423 Ga0496119_0004406 3300048922 Bacteria 14035
424 Ga0496119_0017577 3300048922 Bacteria 5373
425 Ga0496119_0079081 3300048922 Bacteria 1900
426 Ga0496120_0047251 3300048923 Bacteria 2483
427 Ga0496121_0023382 3300048924 Bacteria 5954
428 Ga0496125_0041535 3300048928 Bacteria 3930
429 Ga0496125_0139526 3300048928 Bacteria 1688
430 Ga0496125_0195812 3300048928 Bacteria 1329
431 Ga0496126_0113103 3300048929 Bacteria 2363
432 Ga0501031_0000289 3300049568 Bacteria 28551
433 Ga0501032_0000732 3300049569 Bacteria 26642
434 Ga0501033_0000353 3300049570 Bacteria 43786
435 Ga0501034_0176473 3300049571 Unclassified 2102
436 Ga0501034_0436529 3300049571 Unclassified 1228
437 Ga0501036_0000572 3300049572 Bacteria 26492
438 Ga0501037_0001054 3300049573 Bacteria 20408
439 Ga0501038_0000820 3300049574 Bacteria 27656
440 Ga0501042_0071829 3300049578 Bacteria 2476
441 Ga0501042_0342437 3300049578 Bacteria 1081
442 Ga0501043_0000818 3300049579 Bacteria 27694
443 Ga0501046_0000799 3300049580 Bacteria 30520
444 Ga0501047_0002001 3300049581 Bacteria 19529
445 Ga0501047_0117811 3300049581 Bacteria 2537
446 Ga0501048_0000551 3300049582 Bacteria 26439
447 Ga0501067_0038705 3300049583 Bacteria 2648
448 Ga0501068_0063011 3300049584 Bacteria 2255
449 Ga0501068_0068204 3300049584 Bacteria 2168
450 Ga0501068_0279396 3300049584 Bacteria 1067
451 Ga0501069_0038582 3300049585 Bacteria 2637
452 Ga0501070_0000651 3300049586 Bacteria 31939
453 Ga0501070_0029415 3300049586 Bacteria 4606
454 Ga0501070_0120255 3300049586 Bacteria 2170
455 Ga0501070_0307165 3300049586 Bacteria 1291
456 Ga0501071_0055286 3300049587 Bacteria 2865
457 Ga0501071_0277824 3300049587 Bacteria 1267
458 Ga0501071_0290310 3300049587 Unclassified 1239
459 Ga0501072_0018276 3300049588 Bacteria 5395
460 Ga0501073_0011682 3300049589 Bacteria 6414
461 Ga0501074_0010425 3300049590 Bacteria 6744
462 Ga0501074_0132540 3300049590 Bacteria 1782
463 Ga0501076_0111071 3300049592 Bacteria 2215
464 Ga0501079_0009049 3300049741 Bacteria 7543
465 Ga0501079_0031968 3300049741 Bacteria 4044
466 Ga0501080_0021593 3300049742 Bacteria 5959
467 Ga0501080_0194096 3300049742 Bacteria 1865
468 Ga0501080_0450287 3300049742 Unclassified 1154
469 Ga0501083_0005621 3300049744 Bacteria 8876
470 Ga0501083_0134337 3300049744 Bacteria 1621
471 Ga0501035_0000495 3300049822 Bacteria 44328
472 Ga0501035_0392089 3300049822 Unclassified 1156
473 Ga0501035_0738285 3300049822 Unclassified 791
474 Ga0501044_0011736 3300049823 Bacteria 9490
475 Ga0501044_0135079 3300049823 Bacteria 2458
476 Ga0501044_0265692 3300049823 Bacteria 1653
477 Ga0501045_0056886 3300049824 Bacteria 2861
478 nmdc:mga0yw44_467161_c1 3300050492 Bacteria 855
479 nmdc:mga0qj67_19036_c1 3300050509 Bacteria 5241
480 nmdc:mga0a205_1030_c2 3300050515 Bacteria 6201
481 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
482 Ga0495601_0000013 3300053077 Bacteria 226476
483 Ga0495601_0000124 3300053077 Bacteria 43205
484 Ga0495601_0047331 3300053077 Bacteria 2707
485 Ga0495601_0098169 3300053077 Bacteria 1890
486 Ga0495601_0353973 3300053077 Unclassified 954
487 Ga0495612_0002368 3300053078 Bacteria 7768
488 Ga0495612_0010729 3300053078 Bacteria 3700
489 Ga0495612_0029758 3300053078 Bacteria 2200
490 Ga0495655_0000001 3300053083 Bacteria 419518
491 Ga0495595_0000003 3300053084 Bacteria 266465
492 Ga0495595_0000103 3300053084 Bacteria 38598
493 Ga0495595_0094380 3300053084 Bacteria 1438
494 Ga0495595_0113341 3300053084 Bacteria 1316
495 Ga0495595_0198919 3300053084 Unclassified 997
496 Ga0495619_0000025 3300053085 Bacteria 167905
497 Ga0495619_0000031 3300053085 Bacteria 145508
498 Ga0495619_0000106 3300053085 Bacteria 62413
499 Ga0495619_0000580 3300053085 Bacteria 24292
500 Ga0495619_0001003 3300053085 Bacteria 18481
501 Ga0495619_0002742 3300053085 Bacteria 11502
502 Ga0495619_0018989 3300053085 Bacteria 4366
503 Ga0495619_0355791 3300053085 Bacteria 1013
504 Ga0500566_0003325 3300053094 Bacteria 9619
505 Ga0500641_0000840 3300053096 Bacteria 11072
506 Ga0500614_001709 3300053123 Bacteria 5123
507 Ga0500628_000010 3300053129 Bacteria 122210
508 Ga0501084_0282866 3300054114 Unclassified 1401
509 Ga0501082_0022970 3300060353 Bacteria 5376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0279396 Ga0501068_0279396_232_930 191
2 3300014326 Ga0157380_10000843 Ga0157380_100008434 194
3 3300046809 Ga0495600_0020679 Ga0495600_0020679_150_740 196
4 3300050515 nmdc:mga0a205_1030_c2 nmdc:mga0a205_1030_c2_5080_5706 196
5 3300009093 Ga0105240_10393293 Ga0105240_103932932 197
6 3300009545 Ga0105237_10140426 Ga0105237_101404262 197
7 3300010375 Ga0105239_10086142 Ga0105239_100861423 197
8 3300046511 Ga0495608_0000068 Ga0495608_0000068_61714_62379 197
9 3300046675 Ga0495657_0000004 Ga0495657_0000004_105463_106128 197
10 3300047444 Ga0495675_0000107 Ga0495675_0000107_59249_59914 197
11 3300048911 Ga0496108_0102393 Ga0496108_0102393_143_814 197
12 3300048912 Ga0496109_0356647 Ga0496109_0356647_73_744 197
13 3300048916 Ga0496113_0011978 Ga0496113_0011978_3049_3720 197
14 3300048922 Ga0496119_0079081 Ga0496119_0079081_204_926 197
15 3300048928 Ga0496125_0139526 Ga0496125_0139526_861_1583 197
16 3300053084 Ga0495595_0000003 Ga0495595_0000003_105463_106128 197
17 3300053085 Ga0495619_0000106 Ga0495619_0000106_45_710 197
18 3300025924 Ga0207694_10608575 Ga0207694_106085752 198
19 3300025961 Ga0207712_10301722 Ga0207712_103017222 198
20 3300047321 Ga0495676_0309465 Ga0495676_0309465_120_794 198
21 3300053084 Ga0495595_0198919 Ga0495595_0198919_132_833 198
22 3300005347 Ga0070668_100893226 Ga0070668_1008932261 199
23 3300046536 Ga0495587_0038513 Ga0495587_0038513_583_1323 199
24 3300049586 Ga0501070_0120255 Ga0501070_0120255_560_1282 199
25 3300049587 Ga0501071_0055286 Ga0501071_0055286_78_800 199
26 3300049590 Ga0501074_0132540 Ga0501074_0132540_808_1530 199
27 3300049741 Ga0501079_0031968 Ga0501079_0031968_255_977 199
28 3300049742 Ga0501080_0194096 Ga0501080_0194096_271_993 199
29 3300049744 Ga0501083_0134337 Ga0501083_0134337_26_748 199
30 3300049823 Ga0501044_0265692 Ga0501044_0265692_956_1597 199
31 3300003320 rootH2_10156820 rootH2_101568202 200
32 3300005356 Ga0070674_100000088 Ga0070674_1000000889 200
33 3300005718 Ga0068866_10002045 Ga0068866_100020459 200
34 3300009148 Ga0105243_10212980 Ga0105243_102129802 200
35 3300009176 Ga0105242_10046516 Ga0105242_100465163 200
36 3300025899 Ga0207642_10000447 Ga0207642_100004476 200
37 3300025934 Ga0207686_10030930 Ga0207686_100309302 200
38 3300025935 Ga0207709_10234121 Ga0207709_102341212 200
39 3300025937 Ga0207669_10000560 Ga0207669_100005609 200
40 3300026118 Ga0207675_100137883 Ga0207675_1001378833 200
41 3300046537 Ga0495598_0029827 Ga0495598_0029827_32_718 200
42 3300046663 Ga0495635_0050935 Ga0495635_0050935_1404_2129 200
43 3300048924 Ga0496121_0023382 Ga0496121_0023382_4240_4962 200
44 3300049742 Ga0501080_0450287 Ga0501080_0450287_183_866 200
45 3300049822 Ga0501035_0738285 Ga0501035_0738285_86_769 200
46 3300049823 Ga0501044_0135079 Ga0501044_0135079_1298_1981 200
47 3300005329 Ga0070683_100496789 Ga0070683_1004967891 201
48 3300047319 Ga0495674_0095683 Ga0495674_0095683_900_1595 201
49 3300047320 Ga0495672_0060798 Ga0495672_0060798_1417_2085 201
50 3300048913 Ga0496110_0106752 Ga0496110_0106752_333_1028 201
51 3300048914 Ga0496111_0120142 Ga0496111_0120142_1046_1741 201
52 3300049584 Ga0501068_0063011 Ga0501068_0063011_80_766 201
53 3300053078 Ga0495612_0029758 Ga0495612_0029758_1403_2098 201
54 3300046615 Ga0495656_0001290 Ga0495656_0001290_7403_8131 202
55 3300048905 Ga0496102_0373326 Ga0496102_0373326_329_1021 202
56 3300048906 Ga0496103_0057331 Ga0496103_0057331_749_1441 202
57 3300048909 Ga0496106_0003741 Ga0496106_0003741_9599_10270 202
58 3300048910 Ga0496107_0079309 Ga0496107_0079309_1207_1878 202
59 3300049568 Ga0501031_0000289 Ga0501031_0000289_8874_9560 202
60 3300049569 Ga0501032_0000732 Ga0501032_0000732_6953_7639 202
61 3300049570 Ga0501033_0000353 Ga0501033_0000353_36163_36849 202
62 3300049571 Ga0501034_0436529 Ga0501034_0436529_263_949 202
63 3300049572 Ga0501036_0000572 Ga0501036_0000572_6816_7502 202
64 3300049573 Ga0501037_0001054 Ga0501037_0001054_9402_10088 202
65 3300049574 Ga0501038_0000820 Ga0501038_0000820_19377_20063 202
66 3300049579 Ga0501043_0000818 Ga0501043_0000818_18998_19684 202
67 3300049580 Ga0501046_0000799 Ga0501046_0000799_18972_19658 202
68 3300049581 Ga0501047_0002001 Ga0501047_0002001_9760_10446 202
69 3300049582 Ga0501048_0000551 Ga0501048_0000551_6764_7450 202
70 3300049583 Ga0501067_0038705 Ga0501067_0038705_1249_1935 202
71 3300049585 Ga0501069_0038582 Ga0501069_0038582_216_902 202
72 3300049586 Ga0501070_0000651 Ga0501070_0000651_11951_12637 202
73 3300049587 Ga0501071_0290310 Ga0501071_0290310_56_742 202
74 3300049589 Ga0501073_0011682 Ga0501073_0011682_870_1556 202
75 3300049590 Ga0501074_0010425 Ga0501074_0010425_4502_5188 202
76 3300049741 Ga0501079_0009049 Ga0501079_0009049_3175_3861 202
77 3300049742 Ga0501080_0021593 Ga0501080_0021593_3902_4588 202
78 3300049744 Ga0501083_0005621 Ga0501083_0005621_6777_7463 202
79 3300049822 Ga0501035_0000495 Ga0501035_0000495_7499_8185 202
80 3300049823 Ga0501044_0011736 Ga0501044_0011736_1306_1992 202
81 3300049824 Ga0501045_0056886 Ga0501045_0056886_173_859 202
82 3300054114 Ga0501084_0282866 Ga0501084_0282866_383_1069 202
83 3300060353 Ga0501082_0022970 Ga0501082_0022970_3470_4156 202
84 3300005364 Ga0070673_100011064 Ga0070673_1000110647 203
85 3300025960 Ga0207651_10003318 Ga0207651_100033189 203
86 3300048088 Ga0495602_0129621 Ga0495602_0129621_1181_1867 203
87 3300014968 Ga0157379_10099202 Ga0157379_100992022 204
88 3300048905 Ga0496102_0215198 Ga0496102_0215198_883_1572 204
89 3300046681 Ga0495647_0000008 Ga0495647_0000008_37_702 205
90 3300053077 Ga0495601_0353973 Ga0495601_0353973_75_809 205
91 3300005338 Ga0068868_100002616 Ga0068868_1000026167 206
92 3300005457 Ga0070662_100000004 Ga0070662_10000000492 206
93 3300005614 Ga0068856_100257319 Ga0068856_1002573192 206
94 3300005616 Ga0068852_100473610 Ga0068852_1004736101 206
95 3300025933 Ga0207706_10000012 Ga0207706_10000012126 206
96 3300025939 Ga0207665_10531296 Ga0207665_105312962 206
97 3300026023 Ga0207677_10002836 Ga0207677_100028363 206
98 3300026078 Ga0207702_10174007 Ga0207702_101740072 206
99 3300026142 Ga0207698_11242734 Ga0207698_112427341 206
100 3300048921 Ga0496118_0276065 Ga0496118_0276065_69_704 206
101 3300049571 Ga0501034_0176473 Ga0501034_0176473_261_947 206
102 3300049588 Ga0501072_0018276 Ga0501072_0018276_313_999 206
103 3300049822 Ga0501035_0392089 Ga0501035_0392089_40_726 206
104 3300005366 Ga0070659_100056745 Ga0070659_1000567453 207
105 3300009176 Ga0105242_10040881 Ga0105242_100408813 207
106 3300044694 Ga0466963_0032694 Ga0466963_0032694_912_1628 207
107 3300005333 Ga0070677_10000004 Ga0070677_1000000472 208
108 3300005341 Ga0070691_10008513 Ga0070691_100085131 208
109 3300005347 Ga0070668_100034077 Ga0070668_1000340773 208
110 3300005367 Ga0070667_100015704 Ga0070667_1000157041 208
111 3300005547 Ga0070693_100018982 Ga0070693_1000189823 208
112 3300005578 Ga0068854_100026557 Ga0068854_1000265573 208
113 3300005843 Ga0068860_100203003 Ga0068860_1002030032 208
114 3300005844 Ga0068862_100064035 Ga0068862_1000640353 208
115 3300005937 Ga0081455_10016180 Ga0081455_100161803 208
116 3300006852 Ga0075433_10283226 Ga0075433_102832262 208
117 3300025893 Ga0207682_10000274 Ga0207682_100002747 208
118 3300025961 Ga0207712_10028557 Ga0207712_100285572 208
119 3300025986 Ga0207658_10003306 Ga0207658_1000330610 208
120 3300028379 Ga0268266_10430709 Ga0268266_104307092 208
121 3300028380 Ga0268265_10006440 Ga0268265_100064404 208
122 3300041492 Ga0451835_1207196 Ga0451835_1207196_10_636 208
123 3300046660 Ga0495625_0000587 Ga0495625_0000587_13190_13819 208
124 3300047317 Ga0495604_0000055 Ga0495604_0000055_5106_5834 208
125 3300048929 Ga0496126_0113103 Ga0496126_0113103_1294_1980 208
126 3300049581 Ga0501047_0117811 Ga0501047_0117811_335_994 208
127 3300049586 Ga0501070_0307165 Ga0501070_0307165_418_1077 208
128 3300009098 Ga0105245_10057318 Ga0105245_100573182 209
129 3300013105 Ga0157369_10617400 Ga0157369_106174002 209
130 3300014968 Ga0157379_10022281 Ga0157379_100222814 209
131 3300025927 Ga0207687_10000018 Ga0207687_10000018225 209
132 3300046511 Ga0495608_0009775 Ga0495608_0009775_2434_3162 209
133 3300046533 Ga0495640_0061096 Ga0495640_0061096_1114_1803 209
134 3300046684 Ga0495669_0000308 Ga0495669_0000308_26133_26819 209
135 3300047319 Ga0495674_0000607 Ga0495674_0000607_20196_20885 209
136 3300048911 Ga0496108_0000001 Ga0496108_0000001_665716_666402 209
137 3300048912 Ga0496109_0000003 Ga0496109_0000003_340262_340948 209
138 3300048912 Ga0496109_0157685 Ga0496109_0157685_1057_1725 209
139 3300048928 Ga0496125_0195812 Ga0496125_0195812_411_1097 209
140 3300049587 Ga0501071_0277824 Ga0501071_0277824_187_915 209
141 3300050515 nmdc:mga0a205_24_c2 nmdc:mga0a205_24_c2_36576_37331 209
142 3300053077 Ga0495601_0098169 Ga0495601_0098169_1016_1684 209
143 3300002239 JGI24034J26672_10000207 JGI24034J26672_100002073 210
144 3300002244 JGI24742J22300_10009033 JGI24742J22300_100090331 210
145 3300005937 Ga0081455_10020586 Ga0081455_100205867 210
146 3300006852 Ga0075433_10000041 Ga0075433_1000004119 210
147 3300020080 Ga0206350_11173658 Ga0206350_111736581 210
148 3300046473 Ga0495582_0000011 Ga0495582_0000011_88925_89662 210
149 3300046514 Ga0495618_0000174 Ga0495618_0000174_69_797 210
150 3300046535 Ga0495586_0001090 Ga0495586_0001090_12965_13657 210
151 3300046543 Ga0495645_0359327 Ga0495645_0359327_47_682 210
152 3300046683 Ga0495658_0000005 Ga0495658_0000005_23688_24425 210
153 3300048903 Ga0496100_0000002 Ga0496100_0000002_322596_323282 210
154 3300048904 Ga0496101_0000001 Ga0496101_0000001_322596_323282 210
155 3300048907 Ga0496104_0000004 Ga0496104_0000004_232451_233110 210
156 3300048908 Ga0496105_0000001 Ga0496105_0000001_408721_409380 210
157 3300048909 Ga0496106_0000061 Ga0496106_0000061_27960_28646 210
158 3300048910 Ga0496107_0000013 Ga0496107_0000013_149640_150326 210
159 3300048911 Ga0496108_0000187 Ga0496108_0000187_38768_39493 210
160 3300048912 Ga0496109_0000636 Ga0496109_0000636_8756_9481 210
161 3300048922 Ga0496119_0017577 Ga0496119_0017577_1273_1932 210
162 3300048923 Ga0496120_0047251 Ga0496120_0047251_661_1320 210
163 3300005356 Ga0070674_100000064 Ga0070674_10000006431 211
164 3300005718 Ga0068866_10000001 Ga0068866_10000001351 211
165 3300006358 Ga0068871_100346630 Ga0068871_1003466301 211
166 3300013296 Ga0157374_10099651 Ga0157374_100996513 211
167 3300025899 Ga0207642_10000002 Ga0207642_1000000271 211
168 3300025937 Ga0207669_10000018 Ga0207669_1000001876 211
169 3300045976 Ga0466967_0339084 Ga0466967_0339084_713_1360 211
170 3300048917 Ga0496114_0033155 Ga0496114_0033155_3031_3759 211
171 3300048918 Ga0496115_0000003 Ga0496115_0000003_197867_198517 211
172 3300048918 Ga0496115_0031289 Ga0496115_0031289_2709_3437 211
173 3300053084 Ga0495595_0113341 Ga0495595_0113341_10_669 211
174 3300005455 Ga0070663_100012768 Ga0070663_1000127684 212
175 3300005530 Ga0070679_100004640 Ga0070679_1000046404 212
176 3300013296 Ga0157374_10080363 Ga0157374_100803633 212
177 3300014968 Ga0157379_10164376 Ga0157379_101643762 212
178 3300025920 Ga0207649_10175589 Ga0207649_101755892 212
179 3300025921 Ga0207652_10008706 Ga0207652_100087068 212
180 3300046463 Ga0495653_0232745 Ga0495653_0232745_446_1183 212
181 3300048914 Ga0496111_0064222 Ga0496111_0064222_1372_2031 212
182 3300048928 Ga0496125_0041535 Ga0496125_0041535_2443_3165 212
183 3300053084 Ga0495595_0000103 Ga0495595_0000103_85_825 212
184 3300053085 Ga0495619_0000025 Ga0495619_0000025_40951_41616 212
185 3300005547 Ga0070693_100415341 Ga0070693_1004153411 213
186 3300009553 Ga0105249_10007533 Ga0105249_1000753312 213
187 3300013296 Ga0157374_10025432 Ga0157374_100254323 213
188 3300014325 Ga0163163_10463891 Ga0163163_104638912 213
189 3300046455 Ga0495603_0000333 Ga0495603_0000333_7984_8652 213
190 3300046690 Ga0495624_0143204 Ga0495624_0143204_39_767 213
191 3300048914 Ga0496111_0233624 Ga0496111_0233624_324_989 213
192 3300053085 Ga0495619_0000580 Ga0495619_0000580_3303_4043 213
193 3300005456 Ga0070678_100045907 Ga0070678_1000459072 214
194 3300013308 Ga0157375_10636891 Ga0157375_106368912 214
195 3300025961 Ga0207712_10000007 Ga0207712_10000007341 214
196 3300026121 Ga0207683_10052815 Ga0207683_100528152 214
197 3300046476 Ga0495662_0000061 Ga0495662_0000061_61_732 214
198 3300046514 Ga0495618_0487226 Ga0495618_0487226_23_694 214
199 3300046674 Ga0495588_0000165 Ga0495588_0000165_17885_18550 214
200 3300046675 Ga0495657_0019232 Ga0495657_0019232_2358_3086 214
201 3300046683 Ga0495658_0130534 Ga0495658_0130534_808_1479 214
202 3300046689 Ga0495613_0000179 Ga0495613_0000179_5083_5751 214
203 3300047317 Ga0495604_0000357 Ga0495604_0000357_16303_16971 214
204 3300048088 Ga0495602_0001172 Ga0495602_0001172_24987_25655 214
205 3300048907 Ga0496104_0089025 Ga0496104_0089025_1301_1969 214
206 3300053077 Ga0495601_0000013 Ga0495601_0000013_100698_101366 214
207 3300053078 Ga0495612_0010729 Ga0495612_0010729_2092_2757 214
208 3300053084 Ga0495595_0094380 Ga0495595_0094380_203_871 214
209 3300053096 Ga0500641_0000840 Ga0500641_0000840_9032_9697 214
210 3300014969 Ga0157376_10074861 Ga0157376_100748612 215
211 3300028558 Ga0265326_10000102 Ga0265326_100001024 215
212 3300028563 Ga0265319_1000122 Ga0265319_100012226 215
213 3300028654 Ga0265322_10000001 Ga0265322_10000001341 215
214 3300028800 Ga0265338_10000706 Ga0265338_1000070626 215
215 3300028800 Ga0265338_10314739 Ga0265338_103147392 215
216 3300029957 Ga0265324_10004881 Ga0265324_100048812 215
217 3300031239 Ga0265328_10004536 Ga0265328_100045363 215
218 3300031240 Ga0265320_10000002 Ga0265320_10000002340 215
219 3300031242 Ga0265329_10017040 Ga0265329_100170402 215
220 3300031250 Ga0265331_10001492 Ga0265331_100014924 215
221 3300031250 Ga0265331_10050112 Ga0265331_100501122 215
222 3300031251 Ga0265327_10000011 Ga0265327_10000011340 215
223 3300031344 Ga0265316_10005389 Ga0265316_100053892 215
224 3300031711 Ga0265314_10000062 Ga0265314_1000006274 215
225 3300041496 Ga0451839_1548401 Ga0451839_1548401_1096_1770 215
226 3300044842 Ga0466957_0233193 Ga0466957_0233193_43_714 215
227 3300046460 Ga0495638_0069471 Ga0495638_0069471_1062_1730 215
228 3300047472 Ga0495686_0249369 Ga0495686_0249369_70_738 215
229 3300049578 Ga0501042_0071829 Ga0501042_0071829_756_1538 215
230 3300049578 Ga0501042_0342437 Ga0501042_0342437_37_705 215
231 3300005458 Ga0070681_10191341 Ga0070681_101913411 216
232 3300005535 Ga0070684_100174172 Ga0070684_1001741722 216
233 3300006846 Ga0075430_100590663 Ga0075430_1005906631 216
234 3300025944 Ga0207661_10129624 Ga0207661_101296241 216
235 3300045836 Ga0466958_0043625 Ga0466958_0043625_1251_1925 216
236 3300046523 Ga0495644_0000091 Ga0495644_0000091_44377_45111 216
237 3300046536 Ga0495587_0002685 Ga0495587_0002685_10885_11556 216
238 3300046681 Ga0495647_0000603 Ga0495647_0000603_2412_3140 216
239 3300048906 Ga0496103_0051550 Ga0496103_0051550_1343_2065 216
240 3300048912 Ga0496109_0434037 Ga0496109_0434037_10_687 216
241 3300048920 Ga0496117_0113649 Ga0496117_0113649_153_875 216
242 3300048921 Ga0496118_0000818 Ga0496118_0000818_26299_27021 216
243 3300053085 Ga0495619_0000031 Ga0495619_0000031_76955_77626 216
244 3300005441 Ga0070700_100027741 Ga0070700_1000277413 217
245 3300005441 Ga0070700_100119119 Ga0070700_1001191192 217
246 3300013297 Ga0157378_10009271 Ga0157378_100092711 217
247 3300026075 Ga0207708_10032385 Ga0207708_100323853 217
248 3300026075 Ga0207708_10094640 Ga0207708_100946402 217
249 3300046642 Ga0495634_0000247 Ga0495634_0000247_38252_38932 217
250 3300047322 Ga0495680_0001641 Ga0495680_0001641_2428_3108 217
251 3300048912 Ga0496109_0000129 Ga0496109_0000129_58123_58848 217
252 3300048919 Ga0496116_0001565 Ga0496116_0001565_1474_2196 217
253 3300048922 Ga0496119_0004406 Ga0496119_0004406_11523_12245 217
254 3300053085 Ga0495619_0355791 Ga0495619_0355791_247_927 217
255 3300005334 Ga0068869_100285565 Ga0068869_1002855652 218
256 3300009101 Ga0105247_10000242 Ga0105247_1000024245 218
257 3300013104 Ga0157370_10011805 Ga0157370_100118055 218
258 3300020070 Ga0206356_10071296 Ga0206356_100712962 218
259 3300025942 Ga0207689_10328562 Ga0207689_103285622 218
260 3300046689 Ga0495613_0000803 Ga0495613_0000803_23551_24279 218
261 3300048917 Ga0496114_0182470 Ga0496114_0182470_63_734 218
262 3300005459 Ga0068867_100007033 Ga0068867_1000070337 219
263 3300005618 Ga0068864_100000053 Ga0068864_10000005337 219
264 3300005843 Ga0068860_100100466 Ga0068860_1001004662 219
265 3300006163 Ga0070715_10000001 Ga0070715_10000001315 219
266 3300006358 Ga0068871_100357903 Ga0068871_1003579032 219
267 3300009098 Ga0105245_10001831 Ga0105245_1000183118 219
268 3300009177 Ga0105248_10000008 Ga0105248_10000008369 219
269 3300013105 Ga0157369_10000110 Ga0157369_1000011094 219
270 3300014326 Ga0157380_10000281 Ga0157380_1000028127 219
271 3300025905 Ga0207685_10000027 Ga0207685_100000277 219
272 3300026089 Ga0207648_10002917 Ga0207648_1000291712 219
273 3300026095 Ga0207676_10000094 Ga0207676_1000009435 219
274 3300028381 Ga0268264_10062371 Ga0268264_100623712 219
275 3300046642 Ga0495634_0005521 Ga0495634_0005521_8708_9406 219
276 3300046684 Ga0495669_0107271 Ga0495669_0107271_153_851 219
277 3300047472 Ga0495686_0052126 Ga0495686_0052126_1110_1796 219
278 3300048907 Ga0496104_0000650 Ga0496104_0000650_9918_10586 219
279 3300048908 Ga0496105_0000347 Ga0496105_0000347_21211_21879 219
280 3300048913 Ga0496110_0184037 Ga0496110_0184037_181_879 219
281 3300048915 Ga0496112_0286713 Ga0496112_0286713_775_1473 219
282 3300048916 Ga0496113_0055077 Ga0496113_0055077_2105_2803 219
283 3300049586 Ga0501070_0029415 Ga0501070_0029415_1634_2356 219
284 3300050492 nmdc:mga0yw44_467161_c1 nmdc:mga0yw44_467161_c1_134_832 219
285 3300005436 Ga0070713_100238926 Ga0070713_1002389262 220
286 3300005548 Ga0070665_100124078 Ga0070665_1001240782 220
287 3300028379 Ga0268266_10047678 Ga0268266_100476783 220
288 3300044694 Ga0466963_0000001 Ga0466963_0000001_40966_41688 220
289 3300046515 Ga0495620_0053343 Ga0495620_0053343_1006_1692 220
290 3300046681 Ga0495647_0088673 Ga0495647_0088673_539_1249 220
291 3300048915 Ga0496112_0000006 Ga0496112_0000006_353073_353798 220
292 3300053085 Ga0495619_0002742 Ga0495619_0002742_7418_8128 220
293 3300005336 Ga0070680_100092076 Ga0070680_1000920762 221
294 3300005458 Ga0070681_10060396 Ga0070681_100603963 221
295 3300005530 Ga0070679_100000068 Ga0070679_10000006821 221
296 3300005535 Ga0070684_100037113 Ga0070684_1000371132 221
297 3300005539 Ga0068853_100004641 Ga0068853_1000046417 221
298 3300005548 Ga0070665_100000106 Ga0070665_10000010687 221
299 3300005614 Ga0068856_100065218 Ga0068856_1000652182 221
300 3300005841 Ga0068863_100200649 Ga0068863_1002006492 221
301 3300005842 Ga0068858_100000216 Ga0068858_1000002163 221
302 3300009098 Ga0105245_10049211 Ga0105245_100492112 221
303 3300009553 Ga0105249_10214149 Ga0105249_102141492 221
304 3300020078 Ga0206352_10696586 Ga0206352_106965861 221
305 3300025912 Ga0207707_10023876 Ga0207707_100238763 221
306 3300025921 Ga0207652_10000044 Ga0207652_1000004423 221
307 3300025927 Ga0207687_10002457 Ga0207687_1000245715 221
308 3300025961 Ga0207712_10185531 Ga0207712_101855312 221
309 3300026035 Ga0207703_10000023 Ga0207703_10000023149 221
310 3300026041 Ga0207639_10002934 Ga0207639_100029348 221
311 3300026078 Ga0207702_10003333 Ga0207702_1000333310 221
312 3300026088 Ga0207641_10012343 Ga0207641_100123436 221
313 3300028379 Ga0268266_10000047 Ga0268266_10000047239 221
314 3300041512 Ga0451853_2489483 Ga0451853_2489483_1924_2616 221
315 3300046459 Ga0495629_0024075 Ga0495629_0024075_743_1417 221
316 3300046461 Ga0495641_0000874 Ga0495641_0000874_3634_4326 221
317 3300046515 Ga0495620_0000144 Ga0495620_0000144_3075_3761 221
318 3300046529 Ga0495652_0451763 Ga0495652_0451763_44_718 221
319 3300046694 Ga0495649_0019907 Ga0495649_0019907_86_778 221
320 3300047321 Ga0495676_0032369 Ga0495676_0032369_153_845 221
321 3300048908 Ga0496105_0000007 Ga0496105_0000007_278245_278931 221
322 3300048913 Ga0496110_0016119 Ga0496110_0016119_3585_4277 221
323 3300048916 Ga0496113_0088669 Ga0496113_0088669_88_780 221
324 3300049584 Ga0501068_0068204 Ga0501068_0068204_265_1029 221
325 3300053077 Ga0495601_0000124 Ga0495601_0000124_12071_12763 221
326 3300053078 Ga0495612_0002368 Ga0495612_0002368_4238_4930 221
327 3300053123 Ga0500614_001709 Ga0500614_001709_3486_4178 221
328 3300006175 Ga0070712_100009103 Ga0070712_1000091034 222
329 3300013105 Ga0157369_10541824 Ga0157369_105418241 222
330 3300025915 Ga0207693_10004716 Ga0207693_100047165 222
331 3300036401 Ga0373937_0002885 Ga0373937_0002885_3200_3895 222
332 3300046517 Ga0495630_0311217 Ga0495630_0311217_16_693 222
333 3300048088 Ga0495602_0181248 Ga0495602_0181248_609_1304 222
334 3300053085 Ga0495619_0018989 Ga0495619_0018989_996_1691 222
335 3300047469 Ga0495673_0078027 Ga0495673_0078027_127_861 223
336 3300005985 Ga0081539_10000791 Ga0081539_1000079155 224
337 3300031251 Ga0265327_10159981 Ga0265327_101599811 224
338 3300046499 Ga0495594_0000003 Ga0495594_0000003_169220_169915 224
339 3300046516 Ga0495628_0035454 Ga0495628_0035454_2109_2843 224
340 3300046517 Ga0495630_0125789 Ga0495630_0125789_1109_1843 224
341 3300046533 Ga0495640_0088310 Ga0495640_0088310_270_1004 224
342 3300005843 Ga0068860_100009408 Ga0068860_1000094089 225
343 3300028381 Ga0268264_10005284 Ga0268264_100052843 225
344 3300046663 Ga0495635_0000016 Ga0495635_0000016_213291_214025 225
345 3300046663 Ga0495635_0047417 Ga0495635_0047417_1800_2507 225
346 3300047322 Ga0495680_0400103 Ga0495680_0400103_26_733 225
347 3300053085 Ga0495619_0001003 Ga0495619_0001003_16988_17695 225
348 3300046455 Ga0495603_0000016 Ga0495603_0000016_42362_43090 226
349 3300046511 Ga0495608_0112860 Ga0495608_0112860_46_777 226
350 3300046517 Ga0495630_0002389 Ga0495630_0002389_853_1563 226
351 3300046690 Ga0495624_0000008 Ga0495624_0000008_124010_124744 226
352 3300047322 Ga0495680_0008749 Ga0495680_0008749_790_1524 226
353 3300047322 Ga0495680_0213359 Ga0495680_0213359_479_1189 226
354 3300047471 Ga0495684_0154683 Ga0495684_0154683_76_786 226
355 3300053077 Ga0495601_0047331 Ga0495601_0047331_38_748 226
356 3300009098 Ga0105245_10506295 Ga0105245_105062951 227
357 3300009174 Ga0105241_10075574 Ga0105241_100755743 227
358 3300014326 Ga0157380_10152215 Ga0157380_101522151 227
359 3300046459 Ga0495629_0003074 Ga0495629_0003074_4551_5261 227
360 3300046459 Ga0495629_0054557 Ga0495629_0054557_162_896 227
361 3300046683 Ga0495658_0099908 Ga0495658_0099908_942_1646 227
362 3300046690 Ga0495624_0000073 Ga0495624_0000073_54976_55680 227
363 3300048915 Ga0496112_1019846 Ga0496112_1019846_28_732 227
364 3300048916 Ga0496113_0253937 Ga0496113_0253937_20_724 227
365 3300053094 Ga0500566_0003325 Ga0500566_0003325_405_1139 227
366 3300005466 Ga0070685_10396414 Ga0070685_103964141 228
367 3300005535 Ga0070684_100099139 Ga0070684_1000991392 228
368 3300005564 Ga0070664_100082712 Ga0070664_1000827122 228
369 3300005842 Ga0068858_100000091 Ga0068858_10000009154 228
370 3300013104 Ga0157370_10065492 Ga0157370_100654923 228
371 3300013308 Ga0157375_10000477 Ga0157375_1000047728 228
372 3300025934 Ga0207686_10032253 Ga0207686_100322533 228
373 3300025944 Ga0207661_10574521 Ga0207661_105745212 228
374 3300025945 Ga0207679_10066507 Ga0207679_100665073 228
375 3300026035 Ga0207703_10000152 Ga0207703_1000015255 228
376 3300044694 Ga0466963_0190061 Ga0466963_0190061_65_772 228
377 3300046462 Ga0495651_0214944 Ga0495651_0214944_35_751 228
378 3300046689 Ga0495613_0187413 Ga0495613_0187413_203_931 228
379 3300047673 Ga0495593_0102687 Ga0495593_0102687_75_782 228
380 3300048911 Ga0496108_0000062 Ga0496108_0000062_106060_106770 228
381 3300048912 Ga0496109_0000007 Ga0496109_0000007_68_778 228
382 3300010375 Ga0105239_11408742 Ga0105239_114087421 229
383 3300005329 Ga0070683_100009175 Ga0070683_1000091752 230
384 3300005341 Ga0070691_10000114 Ga0070691_1000011414 230
385 3300005535 Ga0070684_100020221 Ga0070684_1000202212 230
386 3300005535 Ga0070684_100113629 Ga0070684_1001136292 230
387 3300005545 Ga0070695_100213603 Ga0070695_1002136032 230
388 3300005841 Ga0068863_100003824 Ga0068863_10000382411 230
389 3300009176 Ga0105242_10004263 Ga0105242_100042639 230
390 3300014968 Ga0157379_10053684 Ga0157379_100536842 230
391 3300025934 Ga0207686_10001975 Ga0207686_100019759 230
392 3300025944 Ga0207661_10017394 Ga0207661_100173942 230
393 3300026088 Ga0207641_10000405 Ga0207641_1000040537 230
394 3300046454 Ga0495592_0000141 Ga0495592_0000141_18362_19096 230
395 3300046616 Ga0495668_0119610 Ga0495668_0119610_629_1363 230
396 3300017792 Ga0163161_10000035 Ga0163161_10000035127 231
397 3300025900 Ga0207710_10000531 Ga0207710_100005312 231
398 3300046516 Ga0495628_0095389 Ga0495628_0095389_581_1318 231
399 3300001977 JGI24746J21847_1000055 JGI24746J21847_10000557 232
400 3300001979 JGI24740J21852_10001321 JGI24740J21852_100013214 232
401 3300006846 Ga0075430_100118679 Ga0075430_1001186793 232
402 3300041512 Ga0451853_1164472 Ga0451853_1164472_426_1148 232
403 3300050509 nmdc:mga0qj67_19036_c1 nmdc:mga0qj67_19036_c1_2461_3180 232
404 3300005367 Ga0070667_100089494 Ga0070667_1000894942 233
405 3300005436 Ga0070713_100006276 Ga0070713_1000062766 233
406 3300005438 Ga0070701_10084723 Ga0070701_100847232 233
407 3300005615 Ga0070702_100105177 Ga0070702_1001051772 233
408 3300005616 Ga0068852_100000093 Ga0068852_1000000932 233
409 3300005718 Ga0068866_10118277 Ga0068866_101182771 233
410 3300009176 Ga0105242_10006049 Ga0105242_100060496 233
411 3300013297 Ga0157378_10013004 Ga0157378_100130047 233
412 3300025928 Ga0207700_10000027 Ga0207700_10000027121 233
413 3300025934 Ga0207686_10000033 Ga0207686_100000336 233
414 3300025986 Ga0207658_10060423 Ga0207658_100604232 233
415 3300026142 Ga0207698_10000440 Ga0207698_1000044022 233
416 3300028573 Ga0265334_10079477 Ga0265334_100794772 233
417 3300032126 Ga0307415_100021962 Ga0307415_1000219622 233
418 3300041491 Ga0451833_0049203 Ga0451833_0049203_151_882 233
419 3300048905 Ga0496102_0000039 Ga0496102_0000039_95344_96075 233
420 3300048906 Ga0496103_0000008 Ga0496103_0000008_216599_217330 233
421 3300048917 Ga0496114_0000014 Ga0496114_0000014_247450_248175 233
422 3300048918 Ga0496115_0000125 Ga0496115_0000125_69109_69834 233
423 3300003659 JGI25404J52841_10003786 JGI25404J52841_100037863 234
424 3300005327 Ga0070658_10308148 Ga0070658_103081482 234
425 3300005329 Ga0070683_100020190 Ga0070683_1000201902 234
426 3300005365 Ga0070688_100002739 Ga0070688_1000027392 234
427 3300005456 Ga0070678_100010114 Ga0070678_1000101147 234
428 3300005466 Ga0070685_10000189 Ga0070685_100001898 234
429 3300005543 Ga0070672_100000015 Ga0070672_10000001528 234
430 3300005548 Ga0070665_100096537 Ga0070665_1000965373 234
431 3300005563 Ga0068855_100199249 Ga0068855_1001992492 234
432 3300005616 Ga0068852_100000184 Ga0068852_10000018439 234
433 3300005834 Ga0068851_10261609 Ga0068851_102616091 234
434 3300005841 Ga0068863_100041919 Ga0068863_1000419192 234
435 3300005983 Ga0081540_1000049 Ga0081540_100004960 234
436 3300013308 Ga0157375_10015827 Ga0157375_100158275 234
437 3300025321 Ga0207656_10169880 Ga0207656_101698801 234
438 3300025927 Ga0207687_10000007 Ga0207687_10000007370 234
439 3300025927 Ga0207687_10389648 Ga0207687_103896482 234
440 3300025940 Ga0207691_10000044 Ga0207691_1000004453 234
441 3300025944 Ga0207661_10004696 Ga0207661_100046962 234
442 3300025949 Ga0207667_10096326 Ga0207667_100963262 234
443 3300026121 Ga0207683_10010521 Ga0207683_100105216 234
444 3300026142 Ga0207698_10114229 Ga0207698_101142292 234
445 3300028379 Ga0268266_10011189 Ga0268266_1001118913 234
446 3300046507 Ga0495606_0000565 Ga0495606_0000565_52161_52892 234
447 3300046517 Ga0495630_0000056 Ga0495630_0000056_72562_73287 234
448 3300046559 Ga0495667_0000018 Ga0495667_0000018_169860_170588 234
449 3300046681 Ga0495647_0000397 Ga0495647_0000397_10486_11211 234
450 3300047321 Ga0495676_0132389 Ga0495676_0132389_766_1491 234
451 3300047322 Ga0495680_0001716 Ga0495680_0001716_13024_13752 234
452 3300048904 Ga0496101_0000062 Ga0496101_0000062_64674_65402 234
453 3300048909 Ga0496106_0002128 Ga0496106_0002128_3282_4010 234
454 3300048910 Ga0496107_0000006 Ga0496107_0000006_196748_197476 234
455 3300048917 Ga0496114_0247493 Ga0496114_0247493_486_1217 234
456 3300049592 Ga0501076_0111071 Ga0501076_0111071_1303_2031 234
457 3300053083 Ga0495655_0000001 Ga0495655_0000001_183686_184420 234
458 3300053129 Ga0500628_000010 Ga0500628_000010_57887_58621 234
459 3300000532 CNAas_1003358 CNAas_10033581 235
460 3300005329 Ga0070683_100236556 Ga0070683_1002365562 235
461 3300005337 Ga0070682_100000117 Ga0070682_10000011762 235
462 3300005338 Ga0068868_100000878 Ga0068868_10000087813 235
463 3300005340 Ga0070689_100046763 Ga0070689_1000467633 235
464 3300005344 Ga0070661_100000023 Ga0070661_1000000233 235
465 3300005347 Ga0070668_100055354 Ga0070668_1000553542 235
466 3300005354 Ga0070675_100000111 Ga0070675_10000011119 235
467 3300005365 Ga0070688_100001862 Ga0070688_1000018623 235
468 3300005435 Ga0070714_100041949 Ga0070714_1000419493 235
469 3300005466 Ga0070685_10002457 Ga0070685_100024578 235
470 3300005466 Ga0070685_10021760 Ga0070685_100217603 235
471 3300005535 Ga0070684_100381581 Ga0070684_1003815811 235
472 3300005578 Ga0068854_100000183 Ga0068854_10000018321 235
473 3300005614 Ga0068856_100000757 Ga0068856_10000075711 235
474 3300005614 Ga0068856_100208015 Ga0068856_1002080152 235
475 3300005834 Ga0068851_10014831 Ga0068851_100148313 235
476 3300006163 Ga0070715_10042222 Ga0070715_100422222 235
477 3300006881 Ga0068865_100001277 Ga0068865_10000127711 235
478 3300009098 Ga0105245_10014091 Ga0105245_100140919 235
479 3300009148 Ga0105243_10064297 Ga0105243_100642972 235
480 3300013102 Ga0157371_10005310 Ga0157371_1000531012 235
481 3300013104 Ga0157370_10213701 Ga0157370_102137012 235
482 3300013307 Ga0157372_10000129 Ga0157372_1000012990 235
483 3300022467 Ga0224712_10057272 Ga0224712_100572721 235
484 3300025321 Ga0207656_10001601 Ga0207656_100016018 235
485 3300025905 Ga0207685_10019416 Ga0207685_100194162 235
486 3300025920 Ga0207649_10000523 Ga0207649_100005233 235
487 3300025925 Ga0207650_10055049 Ga0207650_100550492 235
488 3300025926 Ga0207659_10000010 Ga0207659_10000010116 235
489 3300025927 Ga0207687_10002454 Ga0207687_100024545 235
490 3300025929 Ga0207664_10015668 Ga0207664_100156684 235
491 3300025935 Ga0207709_10033039 Ga0207709_100330393 235
492 3300025936 Ga0207670_10075101 Ga0207670_100751012 235
493 3300025938 Ga0207704_10000093 Ga0207704_1000009334 235
494 3300025941 Ga0207711_10000006 Ga0207711_10000006763 235
495 3300025944 Ga0207661_10000262 Ga0207661_100002622 235
496 3300025972 Ga0207668_10024588 Ga0207668_100245883 235
497 3300025981 Ga0207640_10000200 Ga0207640_1000020017 235
498 3300026023 Ga0207677_10002133 Ga0207677_100021334 235
499 3300026078 Ga0207702_10000060 Ga0207702_1000006036 235
500 3300044842 Ga0466957_0007902 Ga0466957_0007902_4403_5131 235
501 3300045976 Ga0466967_0000009 Ga0466967_0000009_41195_41923 235
502 3300046512 Ga0495610_0059515 Ga0495610_0059515_192_920 235
503 3300046516 Ga0495628_0001677 Ga0495628_0001677_198_926 235
504 3300046536 Ga0495587_0054004 Ga0495587_0054004_658_1386 235
505 3300048088 Ga0495602_0007085 Ga0495602_0007085_7013_7741 235
506 3300048913 Ga0496110_0000087 Ga0496110_0000087_39550_40278 235
507 3300048914 Ga0496111_0000010 Ga0496111_0000010_8669_9397 235
508 3300048915 Ga0496112_0053466 Ga0496112_0053466_98_826 235
509 3300048916 Ga0496113_0029942 Ga0496113_0029942_2301_3029 235

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vzr-assembly1.cif.gz_A c-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with glucuronic acid 0.5755 81 174
8ivw-assembly4.cif.gz_J crystal structure of nrp2 in complex with anrp2-10 fab fragment 0.5718 84 233
6tdb-assembly2.cif.gz_B neuropilin2-b1 domain in a complex with the c-terminal vegfb167 peptide 0.5198 77 234
4qds-assembly1.cif.gz_B physical basis for nrp2 ligand binding 0.5131 77 172
2wz8-assembly1.cif.gz_A family 35 carbohydrate binding module from clostridium thermocellum 0.5079 64 174
ID Description Score Start End Superfamily
af_Q9U3K3_110_268_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.568 81 171 2.60.120.200
af_Q8N436_120_295_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5563 84 234 2.60.120.260
2vzqA00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5489 81 174 2.60.120.260
af_Q18163_11_183_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5212 79 235 2.60.120.260
4qdsB00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5131 77 172 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A838V794-F1-model_v4 DUF1326 domain-containing protein 0.9265 23 235
AF-A0A1M3BH89-F1-model_v4 Uncharacterized protein 0.9259 28 235
AF-A0A524JIX7-F1-model_v4 Uncharacterized protein 0.9197 41 235
AF-A0A7W0S1W3-F1-model_v4 Uncharacterized protein 0.9047 32 235
AF-A0A6J5ZYB9-F1-model_v4 Unannotated protein 0.9029 35 235

Feature Viewer

pLDDT pTM Quality
82.69 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map