F456939

General Info

Members Datasets Scaffolds Average Seq Length
509 197 1018 249

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100006527|Ga0070706_1000065276
Length 287
Sequence MALPGVPAGTVAGPGLARGNQACEPASVAPNPVRPSSDAPLRGEPVARSVFTGLPGRYDRLAYLLSFGQDRRWRGAVARHAAAGSPRLVLDVATGPAGVALAVAARTGADVVGVDLNEPMLRAGLPRIHRPGLRGRVRVAAGRADQLPFADATFDAVTFSYLLRYVDSPAATIAEMARCLRPGGTLACLEFHVPPRPAWRAAWWCYTRLALPVLGAVAGGPAWYRVGRFLGPSISAHYRRHPLAWHVSAWRAAGLTDVGTELMSRGGGLVMWGTKGQGGEDQRGRGS

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
96 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.75
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100006527 3300005467 Bacteria 11009
2 JGI25406J46586_10008239 3300003203 Bacteria 4730
3 Ga0070658_10002079 3300005327 Bacteria 16808
4 Ga0070658_10150454 3300005327 Bacteria 1948
5 Ga0070658_10299410 3300005327 Unclassified 1371
6 Ga0070658_10346246 3300005327 Bacteria 1271
7 Ga0070683_100030890 3300005329 Bacteria 4867
8 Ga0070680_100030927 3300005336 Bacteria 4301
9 Ga0070680_100220774 3300005336 Unclassified 1600
10 Ga0070660_100064241 3300005339 Bacteria 2855
11 Ga0070691_10079775 3300005341 Bacteria 1600
12 Ga0070709_10002017 3300005434 Bacteria 11031
13 Ga0070709_10007610 3300005434 Bacteria 5946
14 Ga0070709_10023467 3300005434 Bacteria 3623
15 Ga0070714_100017063 3300005435 Bacteria 5878
16 Ga0070714_100092983 3300005435 Bacteria 2644
17 Ga0070714_100239107 3300005435 Unclassified 1675
18 Ga0070714_100304925 3300005435 Bacteria 1485
19 Ga0070713_100001196 3300005436 Bacteria 16585
20 Ga0070713_100011138 3300005436 Bacteria 6536
21 Ga0070713_100034148 3300005436 Bacteria 4082
22 Ga0070713_100049626 3300005436 Bacteria 3463
23 Ga0070713_100122725 3300005436 Bacteria 2280
24 Ga0070713_100153067 3300005436 Bacteria 2053
25 Ga0070710_10000554 3300005437 Bacteria 17712
26 Ga0070710_10014913 3300005437 Bacteria 3920
27 Ga0070710_10127569 3300005437 Bacteria 1547
28 Ga0070711_100004533 3300005439 Bacteria 8215
29 Ga0070711_100018180 3300005439 Bacteria 4485
30 Ga0070711_100152820 3300005439 Bacteria 1742
31 Ga0070708_100013974 3300005445 Bacteria 6595
32 Ga0070708_100032384 3300005445 Bacteria 4534
33 Ga0070708_100039973 3300005445 Bacteria 4106
34 Ga0070708_100070680 3300005445 Bacteria 3141
35 Ga0070708_100086167 3300005445 Bacteria 2852
36 Ga0070678_100279193 3300005456 Unclassified 1412
37 Ga0070681_10005101 3300005458 Bacteria 12674
38 Ga0070681_10043625 3300005458 Bacteria 4491
39 Ga0070681_10096169 3300005458 Bacteria 2910
40 Ga0070681_10145835 3300005458 Bacteria 2296
41 Ga0070681_10306319 3300005458 Bacteria 1498
42 Ga0070706_100000348 3300005467 Bacteria 55783
43 Ga0070706_100001609 3300005467 Bacteria 23533
44 Ga0070706_100027754 3300005467 Bacteria 5206
45 Ga0070706_100169585 3300005467 Bacteria 2038
46 Ga0070706_100209843 3300005467 Unclassified 1819
47 Ga0070706_100245682 3300005467 Unclassified 1671
48 Ga0070706_100373894 3300005467 Bacteria 1328
49 Ga0070707_100000012 3300005468 Bacteria 157939
50 Ga0070707_100007353 3300005468 Bacteria 10230
51 Ga0070707_100014114 3300005468 Bacteria 7485
52 Ga0070698_100000553 3300005471 Bacteria 39988
53 Ga0070698_100000869 3300005471 Bacteria 33204
54 Ga0070698_100004640 3300005471 Bacteria 15105
55 Ga0070698_100012070 3300005471 Bacteria 9161
56 Ga0070698_100012426 3300005471 Bacteria 9017
57 Ga0070698_100014787 3300005471 Bacteria 8249
58 Ga0070698_100042567 3300005471 Bacteria 4659
59 Ga0070698_100136689 3300005471 Bacteria 2405
60 Ga0070698_100176582 3300005471 Unclassified 2075
61 Ga0070699_100017455 3300005518 Bacteria 6161
62 Ga0070699_100113449 3300005518 Unclassified 2381
63 Ga0070699_100524940 3300005518 Bacteria 1076
64 Ga0070679_100021070 3300005530 Bacteria 6360
65 Ga0070679_100084495 3300005530 Bacteria 3162
66 Ga0070679_100180127 3300005530 Bacteria 2086
67 Ga0070679_100239812 3300005530 Unclassified 1771
68 Ga0070697_100002536 3300005536 Bacteria 14046
69 Ga0070697_100052741 3300005536 Bacteria 3305
70 Ga0070697_100056883 3300005536 Bacteria 3182
71 Ga0070697_100125064 3300005536 Bacteria 2154
72 Ga0070697_100150729 3300005536 Unclassified 1960
73 Ga0070697_100162313 3300005536 Archaea 1888
74 Ga0070696_100047838 3300005546 Unclassified 2969
75 Ga0070696_100048316 3300005546 Unclassified 2954
76 Ga0070696_100360188 3300005546 Bacteria 1129
77 Ga0070696_100365399 3300005546 Bacteria 1121
78 Ga0070693_100064387 3300005547 Bacteria 2140
79 Ga0070693_100306871 3300005547 Bacteria 1072
80 Ga0070665_100340174 3300005548 Bacteria 1505
81 Ga0070704_100235481 3300005549 Bacteria 1496
82 Ga0068855_100060958 3300005563 Bacteria 4408
83 Ga0068855_100089064 3300005563 Bacteria 3564
84 Ga0068854_100253889 3300005578 Bacteria 1405
85 Ga0068854_100600064 3300005578 Bacteria 940
86 Ga0068856_100097181 3300005614 Bacteria 2934
87 Ga0068856_100107587 3300005614 Bacteria 2784
88 Ga0068852_100034540 3300005616 Bacteria 4208
89 Ga0068859_100540636 3300005617 Bacteria 1260
90 Ga0068864_100535727 3300005618 Bacteria 1130
91 Ga0081540_1000334 3300005983 Bacteria 48288
92 Ga0081539_10001085 3300005985 Bacteria 49445
93 Ga0081539_10003741 3300005985 Bacteria 18098
94 Ga0070717_10000002 3300006028 Bacteria 378525
95 Ga0070717_10023641 3300006028 Bacteria 4872
96 Ga0070717_10031217 3300006028 Bacteria 4284
97 Ga0070717_10047280 3300006028 Bacteria 3525
98 Ga0070717_10187607 3300006028 Bacteria 1805
99 Ga0070717_10212176 3300006028 Bacteria 1699
100 Ga0070716_100000223 3300006173 Bacteria 22742
101 Ga0070716_100003347 3300006173 Bacteria 7533
102 Ga0070716_100010194 3300006173 Bacteria 4708
103 Ga0070716_100013274 3300006173 Bacteria 4195
104 Ga0070712_100038146 3300006175 Bacteria 3281
105 Ga0070712_100148571 3300006175 Bacteria 1796
106 Ga0070712_100190946 3300006175 Bacteria 1603
107 Ga0070712_100210299 3300006175 Bacteria 1533
108 Ga0097621_100072114 3300006237 Bacteria 2856
109 Ga0068871_100248179 3300006358 Bacteria 1550
110 Ga0075428_100045223 3300006844 Bacteria 4837
111 Ga0075428_100359742 3300006844 Bacteria 1561
112 Ga0075428_100461865 3300006844 Unclassified 1359
113 Ga0075430_100221539 3300006846 Bacteria 1569
114 Ga0075431_100125285 3300006847 Bacteria 2651
115 Ga0075431_100204817 3300006847 Unclassified 2017
116 Ga0075433_10020330 3300006852 Bacteria 5548
117 Ga0075434_100013770 3300006871 Bacteria 7712
118 Ga0075434_100252052 3300006871 Bacteria 1784
119 Ga0075429_100022505 3300006880 Bacteria 5465
120 Ga0075429_100250619 3300006880 Bacteria 1551
121 Ga0075436_100015507 3300006914 Bacteria 5216
122 Ga0075436_100048726 3300006914 Unclassified 2923
123 Ga0075436_100123744 3300006914 Bacteria 1811
124 Ga0075436_100167076 3300006914 Bacteria 1553
125 Ga0097620_100540611 3300006931 Bacteria 1260
126 Ga0075435_100070892 3300007076 Bacteria 2845
127 Ga0075435_100161207 3300007076 Bacteria 1889
128 Ga0099794_10000079 3300007265 Bacteria 35772
129 Ga0105240_10002689 3300009093 Bacteria 28305
130 Ga0111539_10076127 3300009094 Bacteria 3952
131 Ga0111539_10082720 3300009094 Bacteria 3776
132 Ga0111539_10163924 3300009094 Bacteria 2600
133 Ga0105245_10019476 3300009098 Bacteria 5945
134 Ga0114129_10010643 3300009147 Bacteria 13119
135 Ga0114129_10113368 3300009147 Unclassified 3739
136 Ga0114129_10309690 3300009147 Bacteria 2102
137 Ga0114129_11357202 3300009147 Unclassified 879
138 Ga0105243_10050609 3300009148 Bacteria 3283
139 Ga0105241_10049723 3300009174 Bacteria 3194
140 Ga0105238_10465885 3300009551 Bacteria 1262
141 Ga0105249_10245374 3300009553 Unclassified 1773
142 Ga0157370_10009569 3300013104 Bacteria 10322
143 Ga0157378_10402879 3300013297 Bacteria 1348
144 Ga0157372_10271554 3300013307 Bacteria 1971
145 Ga0157372_10891030 3300013307 Bacteria 1032
146 Ga0163163_11668382 3300014325 Bacteria 698
147 Ga0157379_10662195 3300014968 Bacteria 978
148 Ga0197907_10355066 3300020069 Bacteria 1430
149 Ga0206354_10629026 3300020081 Bacteria 1103
150 Ga0206354_10915900 3300020081 Bacteria 15182
151 Ga0206353_11246013 3300020082 Bacteria 5430
152 Ga0224712_10008342 3300022467 Bacteria 3067
153 Ga0224712_10178094 3300022467 Bacteria 957
154 Ga0207692_10003652 3300025898 Bacteria 6026
155 Ga0207692_10013464 3300025898 Bacteria 3549
156 Ga0207692_10020149 3300025898 Bacteria 3027
157 Ga0207692_10212007 3300025898 Bacteria 1144
158 Ga0207685_10006385 3300025905 Bacteria 3207
159 Ga0207699_10005349 3300025906 Bacteria 6153
160 Ga0207699_10026839 3300025906 Bacteria 3180
161 Ga0207699_10183860 3300025906 Bacteria 1406
162 Ga0207699_10216395 3300025906 Bacteria 1305
163 Ga0207705_10000803 3300025909 Bacteria 25796
164 Ga0207705_10016520 3300025909 Bacteria 5289
165 Ga0207705_10200035 3300025909 Archaea 1514
166 Ga0207684_10001503 3300025910 Bacteria 24986
167 Ga0207684_10001798 3300025910 Bacteria 22472
168 Ga0207684_10009152 3300025910 Bacteria 8766
169 Ga0207684_10056089 3300025910 Bacteria 3342
170 Ga0207684_10224612 3300025910 Unclassified 1621
171 Ga0207684_10522740 3300025910 Bacteria 1016
172 Ga0207654_10123466 3300025911 Unclassified 1629
173 Ga0207707_10024497 3300025912 Bacteria 5281
174 Ga0207707_10039377 3300025912 Bacteria 4132
175 Ga0207707_10124323 3300025912 Bacteria 2256
176 Ga0207707_10166909 3300025912 Bacteria 1924
177 Ga0207695_10157188 3300025913 Bacteria 2208
178 Ga0207693_10001183 3300025915 Bacteria 23297
179 Ga0207693_10028138 3300025915 Bacteria 4441
180 Ga0207693_10048736 3300025915 Bacteria 3326
181 Ga0207693_10064851 3300025915 Bacteria 2861
182 Ga0207693_10166634 3300025915 Bacteria 1734
183 Ga0207663_10017460 3300025916 Bacteria 3999
184 Ga0207663_10023205 3300025916 Bacteria 3556
185 Ga0207660_10044911 3300025917 Bacteria 3110
186 Ga0207660_10459376 3300025917 Bacteria 1030
187 Ga0207657_10098616 3300025919 Bacteria 2428
188 Ga0207657_10247210 3300025919 Bacteria 1423
189 Ga0207657_10468162 3300025919 Bacteria 988
190 Ga0207652_10010635 3300025921 Bacteria 7409
191 Ga0207652_10032843 3300025921 Bacteria 4367
192 Ga0207646_10000058 3300025922 Bacteria 158096
193 Ga0207646_10011497 3300025922 Bacteria 8567
194 Ga0207646_10059361 3300025922 Bacteria 3416
195 Ga0207646_10169741 3300025922 Bacteria 1970
196 Ga0207687_10056222 3300025927 Unclassified 2759
197 Ga0207700_10000091 3300025928 Bacteria 55792
198 Ga0207700_10003303 3300025928 Bacteria 9344
199 Ga0207700_10009064 3300025928 Bacteria 6196
200 Ga0207700_10034082 3300025928 Bacteria 3651
201 Ga0207700_10185613 3300025928 Bacteria 1744
202 Ga0207664_10000979 3300025929 Bacteria 19243
203 Ga0207664_10003255 3300025929 Bacteria 10786
204 Ga0207664_10026067 3300025929 Bacteria 4413
205 Ga0207664_10044828 3300025929 Bacteria 3465
206 Ga0207664_10100080 3300025929 Unclassified 2393
207 Ga0207664_10124031 3300025929 Bacteria 2166
208 Ga0207644_10365720 3300025931 Bacteria 1174
209 Ga0207665_10000406 3300025939 Bacteria 29572
210 Ga0207665_10004138 3300025939 Bacteria 9664
211 Ga0207665_10008687 3300025939 Bacteria 6684
212 Ga0207665_10025977 3300025939 Bacteria 3864
213 Ga0207665_10044122 3300025939 Bacteria 2983
214 Ga0207665_10070846 3300025939 Bacteria 2379
215 Ga0207661_10023301 3300025944 Bacteria 4676
216 Ga0207667_10059907 3300025949 Bacteria 3985
217 Ga0207702_10072568 3300026078 Bacteria 2967
218 Ga0207702_10087698 3300026078 Bacteria 2717
219 Ga0207641_10261050 3300026088 Bacteria 1622
220 Ga0207648_10121017 3300026089 Bacteria 2302
221 Ga0209588_1000065 3300027671 Bacteria 36875
222 Ga0207428_10131836 3300027907 Unclassified 1912
223 Ga0265338_10007198 3300028800 Bacteria 13909
224 Ga0265325_10028163 3300031241 Bacteria 3031
225 Ga0265340_10026392 3300031247 Unclassified 2937
226 Ga0265340_10199598 3300031247 Bacteria 900
227 Ga0265314_10142823 3300031711 Unclassified 1478
228 Ga0373958_0014228 3300034819 Bacteria 1389
229 Ga0373929_0002242 3300035085 Bacteria 3575
230 Ga0373934_0000031 3300035086 Bacteria 45039
231 Ga0373934_0010410 3300035086 Bacteria 3491
232 Ga0373934_0053945 3300035086 Bacteria 1595
233 Ga0373923_0033980 3300035111 Bacteria 2067
234 Ga0373936_0073109 3300035113 Bacteria 1416
235 Ga0373953_0000151 3300035117 Bacteria 17853
236 Ga0373953_0018255 3300035117 Bacteria 2593
237 Ga0373953_0032390 3300035117 Bacteria 2039
238 Ga0373953_0043872 3300035117 Bacteria 1786
239 Ga0373954_0005864 3300035118 Bacteria 5335
240 Ga0373954_0007890 3300035118 Bacteria 4663
241 Ga0373956_0000231 3300035119 Bacteria 22066
242 Ga0373956_0005847 3300035119 Unclassified 4921
243 Ga0373956_0007926 3300035119 Bacteria 4288
244 Ga0373956_0018489 3300035119 Bacteria 2952
245 Ga0373956_0030665 3300035119 Bacteria 2352
246 Ga0373956_0054907 3300035119 Bacteria 1795
247 Ga0373957_0000081 3300035120 Bacteria 22990
248 Ga0373957_0020064 3300035120 Bacteria 2358
249 Ga0373957_0037002 3300035120 Bacteria 1821
250 Ga0373957_0048684 3300035120 Bacteria 1616
251 Ga0373960_0020921 3300035121 Bacteria 1734
252 Ga0373943_0032709 3300035170 Bacteria 2474
253 Ga0373943_0261404 3300035170 Bacteria 974
254 Ga0373946_0025698 3300035171 Bacteria 2317
255 Ga0373955_0000208 3300035172 Bacteria 24470
256 Ga0373955_0005712 3300035172 Bacteria 5603
257 Ga0373962_0004193 3300035242 Bacteria 3473
258 Ga0373924_0001926 3300035410 Bacteria 6905
259 Ga0373924_0003855 3300035410 Bacteria 5193
260 Ga0373924_0041627 3300035410 Bacteria 1882
261 Ga0373931_0111275 3300035691 Bacteria 1554
262 Ga0373935_0006247 3300035692 Bacteria 7090
263 Ga0373935_0085168 3300035692 Bacteria 2060
264 Ga0373935_0110967 3300035692 Bacteria 1820
265 Ga0373935_0145177 3300035692 Unclassified 1606
266 Ga0373933_0000015 3300035724 Bacteria 103111
267 Ga0373933_0000790 3300035724 Bacteria 19347
268 Ga0373933_0030642 3300035724 Bacteria 3115
269 Ga0373933_0133448 3300035724 Bacteria 1562
270 Ga0373947_0081267 3300035725 Bacteria 2006
271 Ga0373947_0094162 3300035725 Bacteria 1873
272 Ga0373947_0123505 3300035725 Bacteria 1646
273 Ga0373947_0515838 3300035725 Unclassified 813
274 Ga0373937_0000053 3300036401 Bacteria 103072
275 Ga0373937_0022407 3300036401 Bacteria 5679
276 Ga0373937_0033942 3300036401 Bacteria 4639
277 Ga0373937_0079794 3300036401 Unclassified 3025
278 Ga0373937_0196410 3300036401 Bacteria 1896
279 Ga0373937_0377894 3300036401 Bacteria 1343
280 Ga0373925_0000926 3300037068 Bacteria 26707
281 Ga0373925_0024604 3300037068 Bacteria 4397
282 Ga0373925_0095322 3300037068 Bacteria 2279
283 Ga0373925_0140374 3300037068 Bacteria 1890
284 Ga0373925_0166450 3300037068 Unclassified 1739
285 Ga0395899_0179564 3300037312 Bacteria 1487
286 Ga0395899_0234466 3300037312 Bacteria 1266
287 Ga0395900_0666481 3300037418 Bacteria 976
288 Ga0395900_1037905 3300037418 Unclassified 739
289 Ga0395898_0059264 3300037466 Bacteria 3725
290 Ga0395898_0278026 3300037466 Unclassified 1597
291 Ga0395905_0476029 3300037471 Bacteria 1148
292 Ga0395901_0045920 3300038443 Bacteria 4535
293 Ga0395901_0590378 3300038443 Unclassified 1121
294 Ga0436363_0741738 3300039450 Bacteria 1738
295 Ga0466963_0136782 3300044694 Bacteria 1696
296 Ga0466958_0094318 3300045836 Bacteria 1854
297 Ga0466967_0512897 3300045976 Bacteria 1178
298 Ga0495592_0000057 3300046454 Bacteria 103108
299 Ga0495592_0067602 3300046454 Bacteria 2610
300 Ga0495592_0150257 3300046454 Bacteria 1611
301 Ga0495603_0034959 3300046455 Bacteria 3020
302 Ga0495629_0004524 3300046459 Bacteria 10403
303 Ga0495629_0023894 3300046459 Bacteria 4353
304 Ga0495629_0034730 3300046459 Bacteria 3564
305 Ga0495629_0103501 3300046459 Bacteria 1986
306 Ga0495629_0372728 3300046459 Bacteria 972
307 Ga0495641_0013830 3300046461 Bacteria 4402
308 Ga0495641_0031544 3300046461 Bacteria 2531
309 Ga0495641_0064984 3300046461 Bacteria 1642
310 Ga0495651_0000032 3300046462 Bacteria 103111
311 Ga0495651_0003572 3300046462 Bacteria 11928
312 Ga0495651_0009789 3300046462 Bacteria 7370
313 Ga0495651_0029844 3300046462 Bacteria 4251
314 Ga0495651_0060065 3300046462 Bacteria 2913
315 Ga0495653_0003850 3300046463 Bacteria 12134
316 Ga0495653_0037607 3300046463 Bacteria 3801
317 Ga0495653_0119100 3300046463 Bacteria 1885
318 Ga0495653_0142023 3300046463 Bacteria 1687
319 Ga0495653_0200047 3300046463 Bacteria 1356
320 Ga0495580_0218044 3300046472 Bacteria 1312
321 Ga0495580_0226021 3300046472 Bacteria 1285
322 Ga0495582_0020992 3300046473 Bacteria 3576
323 Ga0495582_0062776 3300046473 Bacteria 2052
324 Ga0495639_0007023 3300046475 Bacteria 4841
325 Ga0495639_0154954 3300046475 Bacteria 1106
326 Ga0495662_0056783 3300046476 Bacteria 1890
327 Ga0495662_0108843 3300046476 Bacteria 1357
328 Ga0495662_0249288 3300046476 Bacteria 874
329 Ga0495664_0011629 3300046477 Bacteria 4966
330 Ga0495664_0023381 3300046477 Bacteria 3587
331 Ga0495664_0065780 3300046477 Bacteria 2161
332 Ga0495664_0149218 3300046477 Bacteria 1418
333 Ga0495664_0220031 3300046477 Bacteria 1149
334 Ga0495584_0233690 3300046491 Bacteria 935
335 Ga0495608_0000045 3300046511 Bacteria 100413
336 Ga0495608_0002959 3300046511 Bacteria 12149
337 Ga0495608_0033269 3300046511 Bacteria 3486
338 Ga0495608_0069330 3300046511 Bacteria 2303
339 Ga0495608_0089055 3300046511 Bacteria 1998
340 Ga0495618_0053186 3300046514 Bacteria 2560
341 Ga0495618_0112534 3300046514 Unclassified 1743
342 Ga0495618_0132383 3300046514 Bacteria 1595
343 Ga0495618_0194094 3300046514 Bacteria 1286
344 Ga0495628_0000063 3300046516 Bacteria 86231
345 Ga0495628_0022000 3300046516 Bacteria 5240
346 Ga0495628_0038076 3300046516 Bacteria 3851
347 Ga0495628_0114626 3300046516 Bacteria 2070
348 Ga0495628_0187218 3300046516 Bacteria 1564
349 Ga0495630_0020664 3300046517 Bacteria 4855
350 Ga0495630_0127385 3300046517 Bacteria 1932
351 Ga0495630_0340422 3300046517 Bacteria 1147
352 Ga0495630_0462001 3300046517 Unclassified 973
353 Ga0495663_0081859 3300046525 Bacteria 1041
354 Ga0495666_0035402 3300046526 Bacteria 2434
355 Ga0495652_0000078 3300046529 Bacteria 103039
356 Ga0495652_0008603 3300046529 Bacteria 9305
357 Ga0495652_0032375 3300046529 Bacteria 4573
358 Ga0495652_0139199 3300046529 Bacteria 1910
359 Ga0495652_0184590 3300046529 Bacteria 1597
360 Ga0495652_0210662 3300046529 Bacteria 1467
361 Ga0495665_0009906 3300046531 Bacteria 5160
362 Ga0495665_0038800 3300046531 Bacteria 2538
363 Ga0495665_0129724 3300046531 Bacteria 1319
364 Ga0495665_0290140 3300046531 Bacteria 839
365 Ga0495640_0018599 3300046533 Bacteria 5146
366 Ga0495640_0078048 3300046533 Bacteria 2206
367 Ga0495640_0080866 3300046533 Bacteria 2160
368 Ga0495586_0014631 3300046535 Bacteria 4169
369 Ga0495586_0115624 3300046535 Bacteria 1495
370 Ga0495587_0000050 3300046536 Bacteria 103111
371 Ga0495587_0005595 3300046536 Bacteria 8198
372 Ga0495587_0014452 3300046536 Bacteria 4951
373 Ga0495587_0108553 3300046536 Bacteria 1595
374 Ga0495645_0013640 3300046543 Bacteria 5756
375 Ga0495645_0040563 3300046543 Bacteria 3395
376 Ga0495645_0047943 3300046543 Bacteria 3112
377 Ga0495645_0056504 3300046543 Bacteria 2849
378 Ga0495645_0131727 3300046543 Bacteria 1751
379 Ga0495645_0138250 3300046543 Bacteria 1702
380 Ga0495667_0000055 3300046559 Bacteria 103111
381 Ga0495667_0003259 3300046559 Bacteria 10878
382 Ga0495667_0026784 3300046559 Bacteria 3884
383 Ga0495667_0129623 3300046559 Bacteria 1627
384 Ga0495667_0180065 3300046559 Bacteria 1356
385 Ga0495634_0025049 3300046642 Bacteria 4181
386 Ga0495634_0056654 3300046642 Bacteria 2617
387 Ga0495634_0090127 3300046642 Bacteria 1993
388 Ga0495635_0010609 3300046663 Bacteria 6449
389 Ga0495635_0036728 3300046663 Bacteria 3394
390 Ga0495635_0104097 3300046663 Bacteria 1939
391 Ga0495635_0284466 3300046663 Bacteria 1110
392 Ga0495659_0149531 3300046664 Unclassified 937
393 Ga0495657_0000009 3300046675 Bacteria 217555
394 Ga0495657_0002134 3300046675 Bacteria 16801
395 Ga0495657_0036295 3300046675 Bacteria 3407
396 Ga0495657_0092720 3300046675 Bacteria 1934
397 Ga0495657_0197429 3300046675 Bacteria 1227
398 Ga0495599_0000033 3300046678 Bacteria 106425
399 Ga0495599_0085916 3300046678 Bacteria 1964
400 Ga0495623_0000524 3300046679 Bacteria 25382
401 Ga0495623_0029313 3300046679 Bacteria 3541
402 Ga0495623_0057116 3300046679 Bacteria 2455
403 Ga0495646_0005623 3300046680 Bacteria 7933
404 Ga0495646_0139525 3300046680 Bacteria 1356
405 Ga0495647_0084041 3300046681 Unclassified 1295
406 Ga0495658_0007448 3300046683 Bacteria 5417
407 Ga0495658_0013651 3300046683 Bacteria 4138
408 Ga0495658_0250091 3300046683 Unclassified 1115
409 Ga0495613_0023644 3300046689 Bacteria 4580
410 Ga0495613_0057107 3300046689 Unclassified 2866
411 Ga0495624_0136297 3300046690 Bacteria 1504
412 Ga0495624_0182999 3300046690 Bacteria 1276
413 Ga0495624_0233951 3300046690 Bacteria 1112
414 Ga0495600_0004010 3300046809 Bacteria 8751
415 Ga0495600_0062563 3300046809 Bacteria 2431
416 Ga0495600_0160845 3300046809 Bacteria 1451
417 Ga0495581_0005622 3300047315 Bacteria 7265
418 Ga0495581_0021947 3300047315 Bacteria 3700
419 Ga0495581_0037700 3300047315 Bacteria 2798
420 Ga0495604_0000052 3300047317 Bacteria 103088
421 Ga0495604_0040540 3300047317 Bacteria 3656
422 Ga0495604_0333913 3300047317 Bacteria 1010
423 Ga0495674_0005797 3300047319 Bacteria 11841
424 Ga0495674_0019408 3300047319 Bacteria 6310
425 Ga0495674_0030083 3300047319 Bacteria 4941
426 Ga0495674_0031298 3300047319 Bacteria 4834
427 Ga0495674_0184809 3300047319 Bacteria 1734
428 Ga0495676_0106567 3300047321 Bacteria 2065
429 Ga0495676_0195036 3300047321 Bacteria 1410
430 Ga0495676_0386442 3300047321 Bacteria 930
431 Ga0495680_0000027 3300047322 Bacteria 113036
432 Ga0495680_0008219 3300047322 Bacteria 9511
433 Ga0495680_0014318 3300047322 Bacteria 6875
434 Ga0495680_0044268 3300047322 Bacteria 3520
435 Ga0495680_0048185 3300047322 Bacteria 3347
436 Ga0495680_0256940 3300047322 Bacteria 1236
437 Ga0495675_0000191 3300047444 Bacteria 44921
438 Ga0495675_0007968 3300047444 Bacteria 6551
439 Ga0495675_0097851 3300047444 Bacteria 1838
440 Ga0495675_0121007 3300047444 Bacteria 1630
441 Ga0495684_0023938 3300047471 Bacteria 4696
442 Ga0495684_0066693 3300047471 Bacteria 2736
443 Ga0495684_0067081 3300047471 Bacteria 2728
444 Ga0495602_0000756 3300048088 Bacteria 30716
445 Ga0495602_0015346 3300048088 Bacteria 7738
446 Ga0495602_0041390 3300048088 Bacteria 4209
447 Ga0495602_0123150 3300048088 Bacteria 2082
448 Ga0495602_0183446 3300048088 Bacteria 1611
449 Ga0496100_0048419 3300048903 Bacteria 2743
450 Ga0496100_0267709 3300048903 Bacteria 1269
451 Ga0496101_0082976 3300048904 Bacteria 2372
452 Ga0496104_0001331 3300048907 Bacteria 21347
453 Ga0496105_0000737 3300048908 Bacteria 22184
454 Ga0496105_0050346 3300048908 Bacteria 3440
455 Ga0496106_0189362 3300048909 Bacteria 1635
456 Ga0496109_0064298 3300048912 Bacteria 3357
457 Ga0496110_0090373 3300048913 Bacteria 2738
458 Ga0496110_0464297 3300048913 Bacteria 1154
459 Ga0496112_0000523 3300048915 Bacteria 26185
460 Ga0496112_0097963 3300048915 Bacteria 2902
461 Ga0496113_0040275 3300048916 Bacteria 3442
462 Ga0496115_0504694 3300048918 Bacteria 972
463 Ga0501040_0008971 3300049576 Bacteria 6505
464 Ga0501070_0012298 3300049586 Bacteria 7223
465 Ga0501074_0357299 3300049590 Unclassified 1037
466 Ga0501075_0022482 3300049591 Bacteria 4607
467 Ga0501080_0054931 3300049742 Bacteria 3709
468 nmdc:mga05p37_1140107_c1 3300050507 Unclassified 812
469 nmdc:mga05p37_40826_c1 3300050507 Bacteria 5697
470 nmdc:mga05p37_42228_c1 3300050507 Bacteria 5602
471 nmdc:mga05p37_454807_c1 3300050507 Bacteria 1481
472 nmdc:mga05p37_6076_c1 3300050507 Bacteria 14219
473 nmdc:mga09592_464851_c1 3300050508 Unclassified 1091
474 nmdc:mga06r32_180937_c1 3300050510 Bacteria 2094
475 nmdc:mga06r32_302703_c1 3300050510 Unclassified 1585
476 nmdc:mga06r32_458499_c1 3300050510 Bacteria 1254
477 nmdc:mga08y16_209400_c1 3300050511 Unclassified 2019
478 nmdc:mga08y16_24689_c1 3300050511 Bacteria 6343
479 nmdc:mga08y16_260020_c1 3300050511 Unclassified 1793
480 nmdc:mga0n895_110496_c1 3300050512 Bacteria 2765
481 nmdc:mga0n895_20577_c1 3300050512 Bacteria 6156
482 nmdc:mga0n895_331067_c1 3300050512 Bacteria 1543
483 nmdc:mga0n895_48390_c1 3300050512 Bacteria 4162
484 nmdc:mga0rr50_14719_c1 3300050513 Bacteria 5143
485 nmdc:mga0rr50_22144_c1 3300050513 Bacteria 4355
486 nmdc:mga0rr50_390403_c1 3300050513 Bacteria 1175
487 nmdc:mga0rr50_85359_c1 3300050513 Bacteria 2447
488 nmdc:mga08x19_113579_c1 3300050514 Bacteria 1809
489 nmdc:mga08x19_143718_c1 3300050514 Unclassified 1613
490 nmdc:mga08x19_15565_c1 3300050514 Bacteria 4629
491 nmdc:mga08x19_158390_c1 3300050514 Bacteria 1537
492 nmdc:mga08x19_250913_c1 3300050514 Unclassified 1222
493 nmdc:mga0a205_118347_c1 3300050515 Bacteria 2548
494 nmdc:mga0a205_20169_c1 3300050515 Bacteria 6288
495 nmdc:mga0a205_296628_c1 3300050515 Bacteria 1490
496 nmdc:mga0a205_320757_c1 3300050515 Bacteria 1420
497 nmdc:mga0a205_43447_c1 3300050515 Bacteria 4333
498 nmdc:mga0a205_9438_c1 3300050515 Bacteria 8919
499 Ga0495601_0080758 3300053077 Bacteria 2086
500 Ga0495612_0004023 3300053078 Bacteria 6091
501 Ga0495612_0035529 3300053078 Bacteria 2020
502 Ga0495595_0000710 3300053084 Bacteria 12697
503 Ga0495595_0023501 3300053084 Bacteria 2714
504 Ga0495595_0069608 3300053084 Bacteria 1661
505 Ga0495619_0001896 3300053085 Bacteria 13932
506 Ga0495619_0013235 3300053085 Bacteria 5199
507 Ga0495619_0047942 3300053085 Bacteria 2815
508 Ga0495619_0084893 3300053085 Bacteria 2137
509 Ga0501082_0327031 3300060353 Unclassified 1336
510 Ga0070706_100006527
511 JGI25406J46586_10008239
512 Ga0070658_10002079
513 Ga0070658_10150454
514 Ga0070658_10299410
515 Ga0070658_10346246
516 Ga0070683_100030890
517 Ga0070680_100030927
518 Ga0070680_100220774
519 Ga0070660_100064241
520 Ga0070691_10079775
521 Ga0070709_10002017
522 Ga0070709_10007610
523 Ga0070709_10023467
524 Ga0070714_100017063
525 Ga0070714_100092983
526 Ga0070714_100239107
527 Ga0070714_100304925
528 Ga0070713_100001196
529 Ga0070713_100011138
530 Ga0070713_100034148
531 Ga0070713_100049626
532 Ga0070713_100122725
533 Ga0070713_100153067
534 Ga0070710_10000554
535 Ga0070710_10014913
536 Ga0070710_10127569
537 Ga0070711_100004533
538 Ga0070711_100018180
539 Ga0070711_100152820
540 Ga0070708_100013974
541 Ga0070708_100032384
542 Ga0070708_100039973
543 Ga0070708_100070680
544 Ga0070708_100086167
545 Ga0070678_100279193
546 Ga0070681_10005101
547 Ga0070681_10043625
548 Ga0070681_10096169
549 Ga0070681_10145835
550 Ga0070681_10306319
551 Ga0070706_100000348
552 Ga0070706_100001609
553 Ga0070706_100027754
554 Ga0070706_100169585
555 Ga0070706_100209843
556 Ga0070706_100245682
557 Ga0070706_100373894
558 Ga0070707_100000012
559 Ga0070707_100007353
560 Ga0070707_100014114
561 Ga0070698_100000553
562 Ga0070698_100000869
563 Ga0070698_100004640
564 Ga0070698_100012070
565 Ga0070698_100012426
566 Ga0070698_100014787
567 Ga0070698_100042567
568 Ga0070698_100136689
569 Ga0070698_100176582
570 Ga0070699_100017455
571 Ga0070699_100113449
572 Ga0070699_100524940
573 Ga0070679_100021070
574 Ga0070679_100084495
575 Ga0070679_100180127
576 Ga0070679_100239812
577 Ga0070697_100002536
578 Ga0070697_100052741
579 Ga0070697_100056883
580 Ga0070697_100125064
581 Ga0070697_100150729
582 Ga0070697_100162313
583 Ga0070696_100047838
584 Ga0070696_100048316
585 Ga0070696_100360188
586 Ga0070696_100365399
587 Ga0070693_100064387
588 Ga0070693_100306871
589 Ga0070665_100340174
590 Ga0070704_100235481
591 Ga0068855_100060958
592 Ga0068855_100089064
593 Ga0068854_100253889
594 Ga0068854_100600064
595 Ga0068856_100097181
596 Ga0068856_100107587
597 Ga0068852_100034540
598 Ga0068859_100540636
599 Ga0068864_100535727
600 Ga0081540_1000334
601 Ga0081539_10001085
602 Ga0081539_10003741
603 Ga0070717_10000002
604 Ga0070717_10023641
605 Ga0070717_10031217
606 Ga0070717_10047280
607 Ga0070717_10187607
608 Ga0070717_10212176
609 Ga0070716_100000223
610 Ga0070716_100003347
611 Ga0070716_100010194
612 Ga0070716_100013274
613 Ga0070712_100038146
614 Ga0070712_100148571
615 Ga0070712_100190946
616 Ga0070712_100210299
617 Ga0097621_100072114
618 Ga0068871_100248179
619 Ga0075428_100045223
620 Ga0075428_100359742
621 Ga0075428_100461865
622 Ga0075430_100221539
623 Ga0075431_100125285
624 Ga0075431_100204817
625 Ga0075433_10020330
626 Ga0075434_100013770
627 Ga0075434_100252052
628 Ga0075429_100022505
629 Ga0075429_100250619
630 Ga0075436_100015507
631 Ga0075436_100048726
632 Ga0075436_100123744
633 Ga0075436_100167076
634 Ga0097620_100540611
635 Ga0075435_100070892
636 Ga0075435_100161207
637 Ga0099794_10000079
638 Ga0105240_10002689
639 Ga0111539_10076127
640 Ga0111539_10082720
641 Ga0111539_10163924
642 Ga0105245_10019476
643 Ga0114129_10010643
644 Ga0114129_10113368
645 Ga0114129_10309690
646 Ga0114129_11357202
647 Ga0105243_10050609
648 Ga0105241_10049723
649 Ga0105238_10465885
650 Ga0105249_10245374
651 Ga0157370_10009569
652 Ga0157378_10402879
653 Ga0157372_10271554
654 Ga0157372_10891030
655 Ga0163163_11668382
656 Ga0157379_10662195
657 Ga0197907_10355066
658 Ga0206354_10629026
659 Ga0206354_10915900
660 Ga0206353_11246013
661 Ga0224712_10008342
662 Ga0224712_10178094
663 Ga0207692_10003652
664 Ga0207692_10013464
665 Ga0207692_10020149
666 Ga0207692_10212007
667 Ga0207685_10006385
668 Ga0207699_10005349
669 Ga0207699_10026839
670 Ga0207699_10183860
671 Ga0207699_10216395
672 Ga0207705_10000803
673 Ga0207705_10016520
674 Ga0207705_10200035
675 Ga0207684_10001503
676 Ga0207684_10001798
677 Ga0207684_10009152
678 Ga0207684_10056089
679 Ga0207684_10224612
680 Ga0207684_10522740
681 Ga0207654_10123466
682 Ga0207707_10024497
683 Ga0207707_10039377
684 Ga0207707_10124323
685 Ga0207707_10166909
686 Ga0207695_10157188
687 Ga0207693_10001183
688 Ga0207693_10028138
689 Ga0207693_10048736
690 Ga0207693_10064851
691 Ga0207693_10166634
692 Ga0207663_10017460
693 Ga0207663_10023205
694 Ga0207660_10044911
695 Ga0207660_10459376
696 Ga0207657_10098616
697 Ga0207657_10247210
698 Ga0207657_10468162
699 Ga0207652_10010635
700 Ga0207652_10032843
701 Ga0207646_10000058
702 Ga0207646_10011497
703 Ga0207646_10059361
704 Ga0207646_10169741
705 Ga0207687_10056222
706 Ga0207700_10000091
707 Ga0207700_10003303
708 Ga0207700_10009064
709 Ga0207700_10034082
710 Ga0207700_10185613
711 Ga0207664_10000979
712 Ga0207664_10003255
713 Ga0207664_10026067
714 Ga0207664_10044828
715 Ga0207664_10100080
716 Ga0207664_10124031
717 Ga0207644_10365720
718 Ga0207665_10000406
719 Ga0207665_10004138
720 Ga0207665_10008687
721 Ga0207665_10025977
722 Ga0207665_10044122
723 Ga0207665_10070846
724 Ga0207661_10023301
725 Ga0207667_10059907
726 Ga0207702_10072568
727 Ga0207702_10087698
728 Ga0207641_10261050
729 Ga0207648_10121017
730 Ga0209588_1000065
731 Ga0207428_10131836
732 Ga0265338_10007198
733 Ga0265325_10028163
734 Ga0265340_10026392
735 Ga0265340_10199598
736 Ga0265314_10142823
737 Ga0373958_0014228
738 Ga0373929_0002242
739 Ga0373934_0000031
740 Ga0373934_0010410
741 Ga0373934_0053945
742 Ga0373923_0033980
743 Ga0373936_0073109
744 Ga0373953_0000151
745 Ga0373953_0018255
746 Ga0373953_0032390
747 Ga0373953_0043872
748 Ga0373954_0005864
749 Ga0373954_0007890
750 Ga0373956_0000231
751 Ga0373956_0005847
752 Ga0373956_0007926
753 Ga0373956_0018489
754 Ga0373956_0030665
755 Ga0373956_0054907
756 Ga0373957_0000081
757 Ga0373957_0020064
758 Ga0373957_0037002
759 Ga0373957_0048684
760 Ga0373960_0020921
761 Ga0373943_0032709
762 Ga0373943_0261404
763 Ga0373946_0025698
764 Ga0373955_0000208
765 Ga0373955_0005712
766 Ga0373962_0004193
767 Ga0373924_0001926
768 Ga0373924_0003855
769 Ga0373924_0041627
770 Ga0373931_0111275
771 Ga0373935_0006247
772 Ga0373935_0085168
773 Ga0373935_0110967
774 Ga0373935_0145177
775 Ga0373933_0000015
776 Ga0373933_0000790
777 Ga0373933_0030642
778 Ga0373933_0133448
779 Ga0373947_0081267
780 Ga0373947_0094162
781 Ga0373947_0123505
782 Ga0373947_0515838
783 Ga0373937_0000053
784 Ga0373937_0022407
785 Ga0373937_0033942
786 Ga0373937_0079794
787 Ga0373937_0196410
788 Ga0373937_0377894
789 Ga0373925_0000926
790 Ga0373925_0024604
791 Ga0373925_0095322
792 Ga0373925_0140374
793 Ga0373925_0166450
794 Ga0395899_0179564
795 Ga0395899_0234466
796 Ga0395900_0666481
797 Ga0395900_1037905
798 Ga0395898_0059264
799 Ga0395898_0278026
800 Ga0395905_0476029
801 Ga0395901_0045920
802 Ga0395901_0590378
803 Ga0436363_0741738
804 Ga0466963_0136782
805 Ga0466958_0094318
806 Ga0466967_0512897
807 Ga0495592_0000057
808 Ga0495592_0067602
809 Ga0495592_0150257
810 Ga0495603_0034959
811 Ga0495629_0004524
812 Ga0495629_0023894
813 Ga0495629_0034730
814 Ga0495629_0103501
815 Ga0495629_0372728
816 Ga0495641_0013830
817 Ga0495641_0031544
818 Ga0495641_0064984
819 Ga0495651_0000032
820 Ga0495651_0003572
821 Ga0495651_0009789
822 Ga0495651_0029844
823 Ga0495651_0060065
824 Ga0495653_0003850
825 Ga0495653_0037607
826 Ga0495653_0119100
827 Ga0495653_0142023
828 Ga0495653_0200047
829 Ga0495580_0218044
830 Ga0495580_0226021
831 Ga0495582_0020992
832 Ga0495582_0062776
833 Ga0495639_0007023
834 Ga0495639_0154954
835 Ga0495662_0056783
836 Ga0495662_0108843
837 Ga0495662_0249288
838 Ga0495664_0011629
839 Ga0495664_0023381
840 Ga0495664_0065780
841 Ga0495664_0149218
842 Ga0495664_0220031
843 Ga0495584_0233690
844 Ga0495608_0000045
845 Ga0495608_0002959
846 Ga0495608_0033269
847 Ga0495608_0069330
848 Ga0495608_0089055
849 Ga0495618_0053186
850 Ga0495618_0112534
851 Ga0495618_0132383
852 Ga0495618_0194094
853 Ga0495628_0000063
854 Ga0495628_0022000
855 Ga0495628_0038076
856 Ga0495628_0114626
857 Ga0495628_0187218
858 Ga0495630_0020664
859 Ga0495630_0127385
860 Ga0495630_0340422
861 Ga0495630_0462001
862 Ga0495663_0081859
863 Ga0495666_0035402
864 Ga0495652_0000078
865 Ga0495652_0008603
866 Ga0495652_0032375
867 Ga0495652_0139199
868 Ga0495652_0184590
869 Ga0495652_0210662
870 Ga0495665_0009906
871 Ga0495665_0038800
872 Ga0495665_0129724
873 Ga0495665_0290140
874 Ga0495640_0018599
875 Ga0495640_0078048
876 Ga0495640_0080866
877 Ga0495586_0014631
878 Ga0495586_0115624
879 Ga0495587_0000050
880 Ga0495587_0005595
881 Ga0495587_0014452
882 Ga0495587_0108553
883 Ga0495645_0013640
884 Ga0495645_0040563
885 Ga0495645_0047943
886 Ga0495645_0056504
887 Ga0495645_0131727
888 Ga0495645_0138250
889 Ga0495667_0000055
890 Ga0495667_0003259
891 Ga0495667_0026784
892 Ga0495667_0129623
893 Ga0495667_0180065
894 Ga0495634_0025049
895 Ga0495634_0056654
896 Ga0495634_0090127
897 Ga0495635_0010609
898 Ga0495635_0036728
899 Ga0495635_0104097
900 Ga0495635_0284466
901 Ga0495659_0149531
902 Ga0495657_0000009
903 Ga0495657_0002134
904 Ga0495657_0036295
905 Ga0495657_0092720
906 Ga0495657_0197429
907 Ga0495599_0000033
908 Ga0495599_0085916
909 Ga0495623_0000524
910 Ga0495623_0029313
911 Ga0495623_0057116
912 Ga0495646_0005623
913 Ga0495646_0139525
914 Ga0495647_0084041
915 Ga0495658_0007448
916 Ga0495658_0013651
917 Ga0495658_0250091
918 Ga0495613_0023644
919 Ga0495613_0057107
920 Ga0495624_0136297
921 Ga0495624_0182999
922 Ga0495624_0233951
923 Ga0495600_0004010
924 Ga0495600_0062563
925 Ga0495600_0160845
926 Ga0495581_0005622
927 Ga0495581_0021947
928 Ga0495581_0037700
929 Ga0495604_0000052
930 Ga0495604_0040540
931 Ga0495604_0333913
932 Ga0495674_0005797
933 Ga0495674_0019408
934 Ga0495674_0030083
935 Ga0495674_0031298
936 Ga0495674_0184809
937 Ga0495676_0106567
938 Ga0495676_0195036
939 Ga0495676_0386442
940 Ga0495680_0000027
941 Ga0495680_0008219
942 Ga0495680_0014318
943 Ga0495680_0044268
944 Ga0495680_0048185
945 Ga0495680_0256940
946 Ga0495675_0000191
947 Ga0495675_0007968
948 Ga0495675_0097851
949 Ga0495675_0121007
950 Ga0495684_0023938
951 Ga0495684_0066693
952 Ga0495684_0067081
953 Ga0495602_0000756
954 Ga0495602_0015346
955 Ga0495602_0041390
956 Ga0495602_0123150
957 Ga0495602_0183446
958 Ga0496100_0048419
959 Ga0496100_0267709
960 Ga0496101_0082976
961 Ga0496104_0001331
962 Ga0496105_0000737
963 Ga0496105_0050346
964 Ga0496106_0189362
965 Ga0496109_0064298
966 Ga0496110_0090373
967 Ga0496110_0464297
968 Ga0496112_0000523
969 Ga0496112_0097963
970 Ga0496113_0040275
971 Ga0496115_0504694
972 Ga0501040_0008971
973 Ga0501070_0012298
974 Ga0501074_0357299
975 Ga0501075_0022482
976 Ga0501080_0054931
977 nmdc:mga05p37_1140107_c1
978 nmdc:mga05p37_40826_c1
979 nmdc:mga05p37_42228_c1
980 nmdc:mga05p37_454807_c1
981 nmdc:mga05p37_6076_c1
982 nmdc:mga09592_464851_c1
983 nmdc:mga06r32_180937_c1
984 nmdc:mga06r32_302703_c1
985 nmdc:mga06r32_458499_c1
986 nmdc:mga08y16_209400_c1
987 nmdc:mga08y16_24689_c1
988 nmdc:mga08y16_260020_c1
989 nmdc:mga0n895_110496_c1
990 nmdc:mga0n895_20577_c1
991 nmdc:mga0n895_331067_c1
992 nmdc:mga0n895_48390_c1
993 nmdc:mga0rr50_14719_c1
994 nmdc:mga0rr50_22144_c1
995 nmdc:mga0rr50_390403_c1
996 nmdc:mga0rr50_85359_c1
997 nmdc:mga08x19_113579_c1
998 nmdc:mga08x19_143718_c1
999 nmdc:mga08x19_15565_c1
1000 nmdc:mga08x19_158390_c1
1001 nmdc:mga08x19_250913_c1
1002 nmdc:mga0a205_118347_c1
1003 nmdc:mga0a205_20169_c1
1004 nmdc:mga0a205_296628_c1
1005 nmdc:mga0a205_320757_c1
1006 nmdc:mga0a205_43447_c1
1007 nmdc:mga0a205_9438_c1
1008 Ga0495601_0080758
1009 Ga0495612_0004023
1010 Ga0495612_0035529
1011 Ga0495595_0000710
1012 Ga0495595_0023501
1013 Ga0495595_0069608
1014 Ga0495619_0001896
1015 Ga0495619_0013235
1016 Ga0495619_0047942
1017 Ga0495619_0084893
1018 Ga0501082_0327031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

89

184

0.97

PF08241

Methyltransf_11

Methyltransferase domain

90

188

0.94

PF13847

Methyltransf_31

Methyltransferase domain

86

203

0.94

PF08242

Methyltransf_12

Methyltransferase domain

90

186

0.89

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

41

275

0.87

PF13489

Methyltransf_23

Methyltransferase domain

66

214

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8821 27 248
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8373 42 249
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8326 27 248
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8088 49 249
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.7986 42 249
ID Description Score Start End Superfamily
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9585 62 115 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.932 62 118 3.40.50.150
af_P75672_56_184_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9255 113 159 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9176 27 248 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9098 27 248 3.40.50.150
ID Description Score Start End GO Terms
AF-I7FIN3-F1-model_v4 S-adenosylmethionine-dependent methyltransferases 0.9696 21 176 GO:0008168
GO:0032259
AF-A0A2N6CEJ4-F1-model_v4 deleted 0.9482 61 159
AF-A0A535DYW8-F1-model_v4 Methyltransferase domain-containing protein 0.9454 21 257 GO:0008168
GO:0032259
GO:0042181
AF-A0A1F9A4U4-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9426 21 248 GO:0008425
GO:0009234
GO:0032259
GO:0043770
AF-A0A2E2UPB1-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9425 25 249 GO:0009234
GO:0032259
GO:0043770

Map