F456926

General Info

Members Datasets Scaffolds Average Seq Length
509 203 1018 299

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100034572|Ga0070683_1000345722
Length 300
Sequence MQLAMIGLGRMGGNMTERLLRKGHSMVAYDRTPDVVAKYQKIGATGVNDLPAVISALSAPRVIWIMVPAGDPVDQTIAALVPSLSKGDVIIDGGNSNFHDSIRRGQELASSGIEFIDAGTSGGIWGLENGYCLMVGGSDAAVSHCEPIFRALAPDDGYAHVGPTGAGHYVKMVHNGIEYGMLQAYAEGYEILHASKTFPSLDLEQIANVWQHGSVVRSWLNELAAAAFARDASLSAIKGWVADSGEGRWTVQEAIDLDVPAPVITLSLQARFRSRQTDSFGAKVIAALRNEFGGHAVKTT

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.73
Rhizosphere 96.27
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100034572 3300005329 Bacteria 4618
2 Ga0070658_10079597 3300005327 Bacteria 2691
3 Ga0070658_10289957 3300005327 Bacteria 1394
4 Ga0070683_100013660 3300005329 Bacteria 7089
5 Ga0070683_100052302 3300005329 Bacteria 3783
6 Ga0070683_100168240 3300005329 Bacteria 2080
7 Ga0070683_100261984 3300005329 Bacteria 1645
8 Ga0070690_100063199 3300005330 Bacteria 2389
9 Ga0070690_100157929 3300005330 Bacteria 1552
10 Ga0070690_100239786 3300005330 Bacteria 1278
11 Ga0070670_100462579 3300005331 Bacteria 1125
12 Ga0070666_10068996 3300005335 Bacteria 2403
13 Ga0070666_10089708 3300005335 Bacteria 2110
14 Ga0070680_100013270 3300005336 Bacteria 6415
15 Ga0070680_100044012 3300005336 Bacteria 3627
16 Ga0070680_100050785 3300005336 Bacteria 3383
17 Ga0070680_100098631 3300005336 Bacteria 2424
18 Ga0070680_100105093 3300005336 Bacteria 2347
19 Ga0070680_100137766 3300005336 Bacteria 2045
20 Ga0070682_100003163 3300005337 Bacteria 9119
21 Ga0070682_100004315 3300005337 Bacteria 7897
22 Ga0070682_100005192 3300005337 Bacteria 7243
23 Ga0070682_100006459 3300005337 Bacteria 6593
24 Ga0070682_100185640 3300005337 Bacteria 1456
25 Ga0068868_100004269 3300005338 Bacteria 10002
26 Ga0070660_100042260 3300005339 Bacteria 3478
27 Ga0070660_100073446 3300005339 Bacteria 2674
28 Ga0070689_100024007 3300005340 Bacteria 4571
29 Ga0070689_100038155 3300005340 Bacteria 3674
30 Ga0070691_10067048 3300005341 Bacteria 1736
31 Ga0070691_10075476 3300005341 Bacteria 1642
32 Ga0070687_100060660 3300005343 Bacteria 1996
33 Ga0070661_100062458 3300005344 Bacteria 2734
34 Ga0070692_10030799 3300005345 Bacteria 2685
35 Ga0070675_100078703 3300005354 Bacteria 2746
36 Ga0070675_100324665 3300005354 Bacteria 1360
37 Ga0070674_100043835 3300005356 Bacteria 3045
38 Ga0070673_100680440 3300005364 Bacteria 943
39 Ga0070688_100050916 3300005365 Bacteria 2582
40 Ga0070659_100003679 3300005366 Bacteria 10931
41 Ga0070659_100207279 3300005366 Bacteria 1615
42 Ga0070703_10000373 3300005406 Bacteria 19158
43 Ga0070709_10009717 3300005434 Bacteria 5313
44 Ga0070709_10312199 3300005434 Bacteria 1151
45 Ga0070701_10004773 3300005438 Bacteria 5538
46 Ga0070711_100000089 3300005439 Bacteria 49966
47 Ga0070711_100022103 3300005439 Bacteria 4118
48 Ga0070711_100077179 3300005439 Bacteria 2364
49 Ga0070705_100001392 3300005440 Bacteria 12813
50 Ga0070705_100003811 3300005440 Bacteria 7377
51 Ga0070705_100013235 3300005440 Bacteria 4214
52 Ga0070705_100100206 3300005440 Bacteria 1827
53 Ga0070705_100223540 3300005440 Bacteria 1305
54 Ga0070705_100229226 3300005440 Bacteria 1291
55 Ga0070700_100169611 3300005441 Bacteria 1510
56 Ga0070694_100010396 3300005444 Bacteria 5741
57 Ga0070694_100034651 3300005444 Bacteria 3330
58 Ga0070694_100089354 3300005444 Bacteria 2159
59 Ga0070694_100100818 3300005444 Bacteria 2043
60 Ga0070708_100000055 3300005445 Bacteria 75728
61 Ga0070708_100008044 3300005445 Bacteria 8451
62 Ga0070708_100019161 3300005445 Bacteria 5743
63 Ga0070708_100047672 3300005445 Bacteria 3785
64 Ga0070708_100174859 3300005445 Bacteria 2006
65 Ga0070708_100202273 3300005445 Bacteria 1859
66 Ga0070708_100242439 3300005445 Bacteria 1692
67 Ga0070663_100002562 3300005455 Bacteria 10266
68 Ga0070678_100034428 3300005456 Bacteria 3528
69 Ga0070662_100001743 3300005457 Bacteria 13384
70 Ga0070662_100009925 3300005457 Bacteria 6239
71 Ga0070662_100122452 3300005457 Bacteria 1995
72 Ga0070681_10000634 3300005458 Bacteria 28917
73 Ga0070681_10007402 3300005458 Bacteria 10735
74 Ga0070681_10017448 3300005458 Bacteria 7175
75 Ga0070681_10021152 3300005458 Bacteria 6519
76 Ga0070681_10125396 3300005458 Bacteria 2500
77 Ga0070681_10171965 3300005458 Bacteria 2088
78 Ga0068867_100049329 3300005459 Bacteria 3099
79 Ga0068867_100069709 3300005459 Bacteria 2626
80 Ga0068867_100149106 3300005459 Bacteria 1835
81 Ga0070706_100025789 3300005467 Bacteria 5409
82 Ga0070706_100052175 3300005467 Bacteria 3775
83 Ga0070706_100089844 3300005467 Bacteria 2848
84 Ga0070706_100108469 3300005467 Bacteria 2583
85 Ga0070706_100110944 3300005467 Bacteria 2553
86 Ga0070706_100117386 3300005467 Bacteria 2479
87 Ga0070706_100166707 3300005467 Bacteria 2057
88 Ga0070707_100008952 3300005468 Bacteria 9285
89 Ga0070707_100068118 3300005468 Bacteria 3425
90 Ga0070707_100101046 3300005468 Bacteria 2794
91 Ga0070707_100165752 3300005468 Bacteria 2153
92 Ga0070707_100206775 3300005468 Bacteria 1913
93 Ga0070707_100258507 3300005468 Bacteria 1694
94 Ga0070707_100465669 3300005468 Bacteria 1225
95 Ga0070698_100040922 3300005471 Bacteria 4760
96 Ga0070698_100078960 3300005471 Bacteria 3288
97 Ga0070698_100111339 3300005471 Bacteria 2703
98 Ga0070699_100000137 3300005518 Bacteria 68489
99 Ga0070699_100001366 3300005518 Bacteria 22434
100 Ga0070699_100001496 3300005518 Bacteria 21415
101 Ga0070699_100056752 3300005518 Bacteria 3391
102 Ga0070699_100071976 3300005518 Bacteria 3007
103 Ga0070699_100097930 3300005518 Bacteria 2569
104 Ga0070699_100140129 3300005518 Bacteria 2135
105 Ga0070699_100166114 3300005518 Bacteria 1955
106 Ga0070699_100258464 3300005518 Bacteria 1557
107 Ga0070699_100272054 3300005518 Bacteria 1516
108 Ga0070699_100489171 3300005518 Bacteria 1117
109 Ga0070679_100001705 3300005530 Bacteria 19795
110 Ga0070679_100002881 3300005530 Bacteria 15628
111 Ga0070679_100044881 3300005530 Bacteria 4403
112 Ga0070679_100046462 3300005530 Bacteria 4328
113 Ga0070679_100072418 3300005530 Bacteria 3438
114 Ga0070684_100031579 3300005535 Bacteria 4510
115 Ga0070684_100054138 3300005535 Bacteria 3495
116 Ga0070684_100350586 3300005535 Bacteria 1358
117 Ga0070697_100007511 3300005536 Bacteria 8484
118 Ga0070697_100015142 3300005536 Bacteria 6055
119 Ga0070697_100039623 3300005536 Bacteria 3810
120 Ga0070697_100044016 3300005536 Bacteria 3615
121 Ga0070697_100094606 3300005536 Bacteria 2476
122 Ga0070697_100126176 3300005536 Bacteria 2144
123 Ga0070697_100130400 3300005536 Bacteria 2108
124 Ga0070697_100168040 3300005536 Bacteria 1855
125 Ga0070697_100199464 3300005536 Bacteria 1701
126 Ga0070697_100301371 3300005536 Bacteria 1378
127 Ga0068853_100135471 3300005539 Bacteria 2207
128 Ga0070686_100009768 3300005544 Bacteria 5392
129 Ga0070695_100002334 3300005545 Bacteria 10887
130 Ga0070695_100002365 3300005545 Bacteria 10828
131 Ga0070695_100004618 3300005545 Bacteria 8088
132 Ga0070695_100014235 3300005545 Bacteria 4793
133 Ga0070695_100051797 3300005545 Bacteria 2635
134 Ga0070695_100062931 3300005545 Bacteria 2410
135 Ga0070695_100084175 3300005545 Bacteria 2109
136 Ga0070696_100002396 3300005546 Bacteria 12411
137 Ga0070696_100005732 3300005546 Bacteria 8288
138 Ga0070696_100007389 3300005546 Bacteria 7341
139 Ga0070696_100010050 3300005546 Bacteria 6332
140 Ga0070696_100127103 3300005546 Bacteria 1851
141 Ga0070696_100256158 3300005546 Bacteria 1325
142 Ga0070693_100115398 3300005547 Bacteria 1658
143 Ga0070704_100000848 3300005549 Bacteria 15249
144 Ga0070704_100002888 3300005549 Bacteria 9751
145 Ga0070704_100008689 3300005549 Bacteria 6108
146 Ga0070704_100012655 3300005549 Bacteria 5219
147 Ga0070704_100015731 3300005549 Bacteria 4762
148 Ga0070704_100016036 3300005549 Bacteria 4724
149 Ga0070704_100040066 3300005549 Bacteria 3221
150 Ga0070704_100083729 3300005549 Bacteria 2356
151 Ga0070704_100161203 3300005549 Bacteria 1774
152 Ga0070704_100181590 3300005549 Bacteria 1683
153 Ga0068855_100000786 3300005563 Bacteria 39197
154 Ga0068855_100003477 3300005563 Bacteria 19278
155 Ga0068855_100067328 3300005563 Bacteria 4173
156 Ga0068855_100698770 3300005563 Bacteria 1085
157 Ga0070664_100013174 3300005564 Bacteria 6733
158 Ga0070664_100053003 3300005564 Bacteria 3437
159 Ga0070664_100287380 3300005564 Bacteria 1484
160 Ga0068857_100138392 3300005577 Bacteria 2199
161 Ga0068854_100006431 3300005578 Bacteria 7472
162 Ga0068854_100047402 3300005578 Bacteria 3062
163 Ga0068856_100041524 3300005614 Bacteria 4521
164 Ga0070702_100074739 3300005615 Bacteria 2011
165 Ga0070702_100129337 3300005615 Bacteria 1592
166 Ga0068852_100051453 3300005616 Bacteria 3535
167 Ga0068852_100606880 3300005616 Bacteria 1099
168 Ga0068859_100005326 3300005617 Bacteria 13084
169 Ga0068859_100005825 3300005617 Bacteria 12512
170 Ga0068859_100017152 3300005617 Bacteria 7272
171 Ga0068859_100101593 3300005617 Bacteria 2933
172 Ga0068864_100079520 3300005618 Bacteria 2871
173 Ga0068864_100238187 3300005618 Bacteria 1685
174 Ga0068864_100372057 3300005618 Bacteria 1352
175 Ga0068866_10023028 3300005718 Bacteria 2892
176 Ga0068861_100145353 3300005719 Bacteria 1940
177 Ga0068870_10011340 3300005840 Bacteria 4130
178 Ga0068862_100032501 3300005844 Bacteria 4409
179 Ga0070717_10015630 3300006028 Bacteria 5866
180 Ga0070716_100056975 3300006173 Bacteria 2244
181 Ga0075428_100030365 3300006844 Bacteria 5977
182 Ga0075428_100055185 3300006844 Bacteria 4353
183 Ga0075428_100065512 3300006844 Bacteria 3978
184 Ga0075428_100094485 3300006844 Bacteria 3260
185 Ga0075428_100136790 3300006844 Bacteria 2664
186 Ga0075430_100126080 3300006846 Bacteria 2134
187 Ga0075430_100312162 3300006846 Bacteria 1300
188 Ga0075431_100035770 3300006847 Bacteria 5114
189 Ga0075431_100120582 3300006847 Bacteria 2706
190 Ga0075431_100363798 3300006847 Bacteria 1452
191 Ga0075433_10010046 3300006852 Bacteria 7586
192 Ga0075433_10031402 3300006852 Bacteria 4540
193 Ga0075433_10034762 3300006852 Bacteria 4331
194 Ga0075433_10077103 3300006852 Bacteria 2936
195 Ga0075433_10177224 3300006852 Bacteria 1897
196 Ga0075434_100001322 3300006871 Bacteria 20722
197 Ga0075434_100005383 3300006871 Bacteria 11645
198 Ga0075434_100007083 3300006871 Bacteria 10355
199 Ga0075434_100038124 3300006871 Bacteria 4760
200 Ga0075434_100042407 3300006871 Bacteria 4511
201 Ga0075434_100064478 3300006871 Bacteria 3647
202 Ga0075434_100156174 3300006871 Bacteria 2301
203 Ga0075434_100209115 3300006871 Bacteria 1972
204 Ga0075434_100220317 3300006871 Bacteria 1917
205 Ga0075429_100000353 3300006880 Bacteria 33619
206 Ga0075429_100002919 3300006880 Bacteria 14502
207 Ga0075429_100006191 3300006880 Bacteria 10349
208 Ga0068865_100006477 3300006881 Bacteria 7145
209 Ga0075436_100006079 3300006914 Bacteria 8286
210 Ga0075436_100006115 3300006914 Bacteria 8262
211 Ga0075436_100009852 3300006914 Bacteria 6536
212 Ga0075436_100014344 3300006914 Bacteria 5425
213 Ga0075436_100026582 3300006914 Bacteria 3985
214 Ga0075436_100060017 3300006914 Bacteria 2627
215 Ga0075436_100083479 3300006914 Bacteria 2217
216 Ga0075436_100102194 3300006914 Bacteria 1997
217 Ga0075436_100103428 3300006914 Bacteria 1985
218 Ga0075436_100144182 3300006914 Bacteria 1674
219 Ga0075436_100371894 3300006914 Bacteria 1032
220 Ga0097620_100005326 3300006931 Bacteria 13084
221 Ga0097620_100005825 3300006931 Bacteria 12512
222 Ga0097620_100017152 3300006931 Bacteria 7272
223 Ga0097620_100101595 3300006931 Bacteria 2933
224 Ga0075435_100026795 3300007076 Bacteria 4502
225 Ga0075435_100062572 3300007076 Bacteria 3020
226 Ga0075435_100113782 3300007076 Bacteria 2252
227 Ga0075435_100205868 3300007076 Bacteria 1668
228 Ga0075435_100243205 3300007076 Bacteria 1531
229 Ga0099794_10000615 3300007265 Bacteria 11844
230 Ga0099794_10007109 3300007265 Bacteria 4577
231 Ga0099794_10020964 3300007265 Bacteria 2965
232 Ga0105240_10234727 3300009093 Bacteria 2129
233 Ga0105240_10921754 3300009093 Bacteria 939
234 Ga0111539_10204803 3300009094 Bacteria 2300
235 Ga0111539_10541847 3300009094 Bacteria 1356
236 Ga0111539_10863521 3300009094 Bacteria 1053
237 Ga0105245_10014135 3300009098 Bacteria 6955
238 Ga0105245_10082570 3300009098 Bacteria 2940
239 Ga0114129_10037448 3300009147 Bacteria 6847
240 Ga0114129_10058707 3300009147 Bacteria 5381
241 Ga0114129_10086161 3300009147 Bacteria 4357
242 Ga0114129_10108572 3300009147 Bacteria 3831
243 Ga0114129_10129254 3300009147 Bacteria 3471
244 Ga0114129_10141227 3300009147 Bacteria 3301
245 Ga0105241_10000078 3300009174 Bacteria 72328
246 Ga0105241_10002144 3300009174 Bacteria 14882
247 Ga0105248_10007232 3300009177 Bacteria 12179
248 Ga0105248_10109809 3300009177 Bacteria 3110
249 Ga0105237_10054620 3300009545 Bacteria 4002
250 Ga0105237_10197902 3300009545 Bacteria 2009
251 Ga0105239_10046745 3300010375 Bacteria 4744
252 Ga0105239_10389074 3300010375 Bacteria 1577
253 Ga0105246_10000770 3300011119 Bacteria 18240
254 Ga0157373_10002111 3300013100 Bacteria 15043
255 Ga0157373_10006988 3300013100 Bacteria 8407
256 Ga0157371_10005022 3300013102 Bacteria 11337
257 Ga0157371_10036234 3300013102 Bacteria 3533
258 Ga0157370_10029530 3300013104 Bacteria 5377
259 Ga0157370_10030079 3300013104 Bacteria 5323
260 Ga0157370_10139969 3300013104 Bacteria 2255
261 Ga0157370_10284132 3300013104 Bacteria 1529
262 Ga0157369_10006429 3300013105 Bacteria 13622
263 Ga0157374_10133465 3300013296 Bacteria 2404
264 Ga0157378_10003409 3300013297 Bacteria 14117
265 Ga0157378_10006588 3300013297 Bacteria 10145
266 Ga0157378_10087533 3300013297 Bacteria 2826
267 Ga0163162_10635676 3300013306 Bacteria 1192
268 Ga0157372_10028699 3300013307 Bacteria 6074
269 Ga0157372_10031475 3300013307 Bacteria 5809
270 Ga0157372_10053419 3300013307 Bacteria 4503
271 Ga0157372_10062451 3300013307 Bacteria 4174
272 Ga0157372_10089814 3300013307 Bacteria 3491
273 Ga0157372_10096711 3300013307 Bacteria 3366
274 Ga0157372_10737141 3300013307 Bacteria 1146
275 Ga0157375_10095291 3300013308 Bacteria 3047
276 Ga0157375_10148553 3300013308 Bacteria 2477
277 Ga0163163_10020735 3300014325 Bacteria 6195
278 Ga0163163_10023230 3300014325 Bacteria 5883
279 Ga0157376_10032780 3300014969 Bacteria 4174
280 Ga0224712_10080388 3300022467 Bacteria 1344
281 Ga0207653_10000085 3300025885 Bacteria 68322
282 Ga0207653_10001267 3300025885 Bacteria 8234
283 Ga0207642_10014080 3300025899 Bacteria 2940
284 Ga0207680_10121858 3300025903 Bacteria 1706
285 Ga0207699_10013562 3300025906 Bacteria 4176
286 Ga0207645_10036570 3300025907 Bacteria 3152
287 Ga0207643_10049964 3300025908 Bacteria 2371
288 Ga0207705_10055760 3300025909 Bacteria 2849
289 Ga0207705_10136946 3300025909 Unclassified 1826
290 Ga0207684_10004698 3300025910 Bacteria 12818
291 Ga0207684_10077984 3300025910 Bacteria 2818
292 Ga0207684_10118051 3300025910 Bacteria 2273
293 Ga0207684_10126150 3300025910 Bacteria 2196
294 Ga0207684_10194015 3300025910 Bacteria 1752
295 Ga0207684_10394699 3300025910 Bacteria 1189
296 Ga0207654_10000050 3300025911 Bacteria 88868
297 Ga0207707_10001688 3300025912 Bacteria 20305
298 Ga0207707_10001801 3300025912 Bacteria 19689
299 Ga0207707_10015861 3300025912 Bacteria 6571
300 Ga0207707_10030233 3300025912 Bacteria 4738
301 Ga0207707_10206666 3300025912 Bacteria 1711
302 Ga0207695_10002651 3300025913 Bacteria 26154
303 Ga0207695_10005926 3300025913 Bacteria 16017
304 Ga0207695_10069957 3300025913 Bacteria 3590
305 Ga0207695_10243616 3300025913 Bacteria 1699
306 Ga0207695_10493355 3300025913 Bacteria 1107
307 Ga0207693_10228327 3300025915 Bacteria 1462
308 Ga0207663_10000069 3300025916 Bacteria 51386
309 Ga0207660_10003263 3300025917 Bacteria 10623
310 Ga0207660_10014701 3300025917 Bacteria 5155
311 Ga0207660_10017897 3300025917 Bacteria 4717
312 Ga0207660_10023403 3300025917 Bacteria 4172
313 Ga0207660_10024836 3300025917 Bacteria 4060
314 Ga0207660_10037193 3300025917 Bacteria 3390
315 Ga0207660_10038689 3300025917 Bacteria 3330
316 Ga0207660_10175511 3300025917 Bacteria 1661
317 Ga0207662_10063631 3300025918 Bacteria 2218
318 Ga0207662_10114424 3300025918 Bacteria 1685
319 Ga0207657_10000525 3300025919 Bacteria 40596
320 Ga0207657_10210408 3300025919 Bacteria 1561
321 Ga0207657_10305968 3300025919 Bacteria 1259
322 Ga0207649_10005217 3300025920 Bacteria 7017
323 Ga0207649_10068374 3300025920 Bacteria 2258
324 Ga0207652_10000949 3300025921 Bacteria 27209
325 Ga0207652_10048876 3300025921 Bacteria 3618
326 Ga0207652_10065379 3300025921 Bacteria 3149
327 Ga0207652_10120380 3300025921 Bacteria 2335
328 Ga0207652_10371780 3300025921 Bacteria 1290
329 Ga0207646_10000092 3300025922 Bacteria 120151
330 Ga0207646_10001041 3300025922 Bacteria 35388
331 Ga0207646_10015945 3300025922 Bacteria 7064
332 Ga0207646_10036110 3300025922 Bacteria 4462
333 Ga0207646_10041846 3300025922 Bacteria 4117
334 Ga0207646_10090529 3300025922 Bacteria 2739
335 Ga0207646_10141259 3300025922 Bacteria 2169
336 Ga0207646_10185519 3300025922 Bacteria 1879
337 Ga0207681_10012740 3300025923 Bacteria 5194
338 Ga0207694_10195621 3300025924 Bacteria 1644
339 Ga0207700_10072725 3300025928 Bacteria 2652
340 Ga0207664_10025032 3300025929 Bacteria 4489
341 Ga0207690_10004796 3300025932 Bacteria 7978
342 Ga0207706_10001304 3300025933 Bacteria 25077
343 Ga0207706_10096242 3300025933 Bacteria 2604
344 Ga0207709_10173208 3300025935 Bacteria 1516
345 Ga0207670_10099278 3300025936 Bacteria 2076
346 Ga0207670_10159456 3300025936 Bacteria 1683
347 Ga0207669_10037569 3300025937 Bacteria 2780
348 Ga0207669_10103980 3300025937 Bacteria 1885
349 Ga0207704_10002003 3300025938 Bacteria 9138
350 Ga0207665_10020222 3300025939 Bacteria 4373
351 Ga0207711_10018651 3300025941 Bacteria 5769
352 Ga0207711_10035832 3300025941 Bacteria 4208
353 Ga0207689_10003112 3300025942 Bacteria 15230
354 Ga0207661_10003608 3300025944 Bacteria 10768
355 Ga0207661_10020676 3300025944 Bacteria 4924
356 Ga0207661_10039436 3300025944 Bacteria 3707
357 Ga0207661_10386912 3300025944 Bacteria 1267
358 Ga0207679_10019453 3300025945 Bacteria 4561
359 Ga0207679_10192426 3300025945 Bacteria 1697
360 Ga0207667_10004021 3300025949 Bacteria 18073
361 Ga0207667_10014209 3300025949 Bacteria 9085
362 Ga0207667_10127487 3300025949 Bacteria 2622
363 Ga0207667_10159398 3300025949 Bacteria 2321
364 Ga0207667_10418092 3300025949 Bacteria 1364
365 Ga0207651_10065196 3300025960 Bacteria 2553
366 Ga0207651_10135476 3300025960 Bacteria 1893
367 Ga0207712_10490545 3300025961 Bacteria 1048
368 Ga0207640_10005759 3300025981 Bacteria 6755
369 Ga0207640_10011054 3300025981 Bacteria 5099
370 Ga0207640_10315462 3300025981 Bacteria 1242
371 Ga0207703_10029133 3300026035 Bacteria 4356
372 Ga0207639_10170643 3300026041 Bacteria 1842
373 Ga0207678_10001153 3300026067 Bacteria 24167
374 Ga0207678_10120882 3300026067 Bacteria 2235
375 Ga0207708_10056540 3300026075 Bacteria 2993
376 Ga0207702_10044861 3300026078 Bacteria 3717
377 Ga0207641_10108351 3300026088 Bacteria 2458
378 Ga0207648_10009916 3300026089 Bacteria 9080
379 Ga0207648_10020561 3300026089 Bacteria 5942
380 Ga0207648_10190717 3300026089 Bacteria 1816
381 Ga0207648_10373235 3300026089 Bacteria 1289
382 Ga0207676_10040707 3300026095 Bacteria 3562
383 Ga0207674_10005719 3300026116 Bacteria 14738
384 Ga0207674_10128041 3300026116 Bacteria 2503
385 Ga0207675_100277979 3300026118 Bacteria 1626
386 Ga0207683_10003189 3300026121 Bacteria 14309
387 Ga0209588_1000237 3300027671 Bacteria 14718
388 Ga0209588_1001639 3300027671 Bacteria 5883
389 Ga0209588_1016499 3300027671 Bacteria 2281
390 Ga0268265_10367546 3300028380 Bacteria 1319
391 Ga0268264_10008641 3300028381 Bacteria 8461
392 Ga0307408_100023448 3300031548 Bacteria 4203
393 Ga0307408_100070326 3300031548 Bacteria 2584
394 Ga0307405_10123786 3300031731 Bacteria 1774
395 Ga0307412_10211905 3300031911 Bacteria 1479
396 Ga0307412_10235474 3300031911 Bacteria 1413
397 Ga0307416_100026061 3300032002 Bacteria 4301
398 Ga0307416_100199196 3300032002 Bacteria 1898
399 Ga0373941_0073897 3300035115 Bacteria 1138
400 Ga0373960_0042279 3300035121 Bacteria 1323
401 Ga0373931_0004972 3300035691 Bacteria 6113
402 Ga0395905_0227685 3300037471 Bacteria 1744
403 Ga0242420_007058 3300038996 Bacteria 1795
404 Ga0439460_0041541 3300042461 Bacteria 1352
405 Ga0451577_0301199 3300042876 Bacteria 1453
406 Ga0453683_0001876 3300044673 Bacteria 17226
407 Ga0453683_0015156 3300044673 Bacteria 5002
408 Ga0453683_0047857 3300044673 Bacteria 2682
409 Ga0466966_0007526 3300044684 Bacteria 7214
410 Ga0466966_0078511 3300044684 Bacteria 2058
411 Ga0466961_0148256 3300044693 Bacteria 1466
412 Ga0466959_0019968 3300045049 Bacteria 4931
413 Ga0466959_0021443 3300045049 Bacteria 4765
414 Ga0451576_0003493 3300045051 Bacteria 21507
415 Ga0451576_0041594 3300045051 Bacteria 4858
416 Ga0451576_0102987 3300045051 Bacteria 2969
417 Ga0451576_0322677 3300045051 Bacteria 1616
418 Ga0495629_0022185 3300046459 Bacteria 4528
419 Ga0495582_0034316 3300046473 Bacteria 2789
420 Ga0495645_0261621 3300046543 Bacteria 1145
421 Ga0495588_0094913 3300046674 Bacteria 1564
422 Ga0495677_0081954 3300047445 Bacteria 1210
423 Ga0496101_0202146 3300048904 Bacteria 1536
424 Ga0496102_0080226 3300048905 Bacteria 3006
425 Ga0496102_0138907 3300048905 Bacteria 2277
426 Ga0496103_0262883 3300048906 Bacteria 1110
427 Ga0496104_0025331 3300048907 Bacteria 5468
428 Ga0496104_0564061 3300048907 Bacteria 1049
429 Ga0496106_0106314 3300048909 Bacteria 2181
430 Ga0496107_0023553 3300048910 Bacteria 4353
431 Ga0496109_0002802 3300048912 Bacteria 14598
432 Ga0496109_0005855 3300048912 Bacteria 10305
433 Ga0496109_0021525 3300048912 Bacteria 5703
434 Ga0496109_0452434 3300048912 Bacteria 1213
435 Ga0496112_0006901 3300048915 Bacteria 10016
436 Ga0496112_0012381 3300048915 Bacteria 7839
437 Ga0496112_0399758 3300048915 Bacteria 1314
438 Ga0496113_0007287 3300048916 Bacteria 7099
439 Ga0496113_0015175 3300048916 Bacteria 5284
440 Ga0496114_0127498 3300048917 Bacteria 2195
441 Ga0496114_0491335 3300048917 Bacteria 1086
442 Ga0501031_0047811 3300049568 Bacteria 2789
443 Ga0501036_0029337 3300049572 Bacteria 4650
444 Ga0501040_0248520 3300049576 Bacteria 1268
445 Ga0501041_0071700 3300049577 Bacteria 2127
446 Ga0501042_0009642 3300049578 Bacteria 6447
447 Ga0501042_0259889 3300049578 Bacteria 1253
448 Ga0501046_0376577 3300049580 Bacteria 1028
449 Ga0501048_0208974 3300049582 Bacteria 1384
450 Ga0501070_0280717 3300049586 Bacteria 1359
451 Ga0501071_0016141 3300049587 Bacteria 5134
452 Ga0501072_0014424 3300049588 Bacteria 6056
453 Ga0501072_0072081 3300049588 Bacteria 2730
454 Ga0501073_0228391 3300049589 Bacteria 1286
455 Ga0501074_0197779 3300049590 Bacteria 1433
456 Ga0501075_0005868 3300049591 Bacteria 8396
457 Ga0501076_0029185 3300049592 Bacteria 4288
458 Ga0501076_0313565 3300049592 Bacteria 1286
459 Ga0501077_0008748 3300049593 Bacteria 6283
460 Ga0501077_0107440 3300049593 Bacteria 1768
461 Ga0501079_0010008 3300049741 Bacteria 7197
462 Ga0501079_0043223 3300049741 Bacteria 3478
463 Ga0501080_0051270 3300049742 Bacteria 3840
464 Ga0501080_0288242 3300049742 Bacteria 1491
465 Ga0501081_0123509 3300049743 Bacteria 1846
466 Ga0501045_0008933 3300049824 Bacteria 6998
467 nmdc:mga05p37_177684_c1 3300050507 Bacteria 2593
468 nmdc:mga05p37_191677_c1 3300050507 Bacteria 2481
469 nmdc:mga05p37_21176_c1 3300050507 Bacteria 7872
470 nmdc:mga05p37_221559_c1 3300050507 Bacteria 2283
471 nmdc:mga05p37_36903_c1 3300050507 Bacteria 5994
472 nmdc:mga05p37_483491_c1 3300050507 Bacteria 1425
473 nmdc:mga09592_1501_c1 3300050508 Bacteria 18798
474 nmdc:mga09592_17135_c1 3300050508 Bacteria 5932
475 nmdc:mga09592_9562_c1 3300050508 Bacteria 7878
476 nmdc:mga0qj67_21416_c1 3300050509 Bacteria 4960
477 nmdc:mga0qj67_222213_c1 3300050509 Bacteria 1533
478 nmdc:mga0qj67_301132_c1 3300050509 Bacteria 1299
479 nmdc:mga0n895_1706_c1 3300050512 Bacteria 16597
480 nmdc:mga0n895_194805_c1 3300050512 Bacteria 2058
481 nmdc:mga0n895_234514_c1 3300050512 Bacteria 1862
482 nmdc:mga0n895_315360_c1 3300050512 Bacteria 1585
483 nmdc:mga0n895_3589_c1 3300050512 Bacteria 12542
484 nmdc:mga0n895_54328_c1 3300050512 Bacteria 3940
485 nmdc:mga0n895_692871_c1 3300050512 Bacteria 1015
486 nmdc:mga0n895_8284_c1 3300050512 Bacteria 8991
487 nmdc:mga0n895_8746_c1 3300050512 Bacteria 8801
488 nmdc:mga0rr50_14575_c1 3300050513 Bacteria 5162
489 nmdc:mga0rr50_289377_c1 3300050513 Bacteria 1369
490 nmdc:mga0rr50_28945_c1 3300050513 Bacteria 3900
491 nmdc:mga0rr50_34985_c1 3300050513 Bacteria 3604
492 nmdc:mga0rr50_392422_c1 3300050513 Bacteria 1172
493 nmdc:mga0rr50_474071_c1 3300050513 Bacteria 1063
494 nmdc:mga0rr50_549009_c1 3300050513 Bacteria 984
495 nmdc:mga08x19_109128_c1 3300050514 Bacteria 1844
496 nmdc:mga08x19_12072_c1 3300050514 Bacteria 5198
497 nmdc:mga08x19_15345_c1 3300050514 Bacteria 4661
498 nmdc:mga08x19_311400_c1 3300050514 Bacteria 1095
499 nmdc:mga08x19_3415_c1 3300050514 Bacteria 9473
500 nmdc:mga08x19_34676_c1 3300050514 Bacteria 3191
501 nmdc:mga08x19_34876_c1 3300050514 Bacteria 3182
502 nmdc:mga0a205_16281_c1 3300050515 Bacteria 6963
503 nmdc:mga0a205_17438_c1 3300050515 Bacteria 6732
504 nmdc:mga0a205_19876_c1 3300050515 Bacteria 6335
505 nmdc:mga0a205_26861_c1 3300050515 Bacteria 5494
506 nmdc:mga0a205_82571_c1 3300050515 Unclassified 3104
507 Ga0501084_0086757 3300054114 Bacteria 2628
508 Ga0501082_0054582 3300060353 Bacteria 3444
509 Ga0501082_0113331 3300060353 Bacteria 2348
510 Ga0070683_100034572
511 Ga0070658_10079597
512 Ga0070658_10289957
513 Ga0070683_100013660
514 Ga0070683_100052302
515 Ga0070683_100168240
516 Ga0070683_100261984
517 Ga0070690_100063199
518 Ga0070690_100157929
519 Ga0070690_100239786
520 Ga0070670_100462579
521 Ga0070666_10068996
522 Ga0070666_10089708
523 Ga0070680_100013270
524 Ga0070680_100044012
525 Ga0070680_100050785
526 Ga0070680_100098631
527 Ga0070680_100105093
528 Ga0070680_100137766
529 Ga0070682_100003163
530 Ga0070682_100004315
531 Ga0070682_100005192
532 Ga0070682_100006459
533 Ga0070682_100185640
534 Ga0068868_100004269
535 Ga0070660_100042260
536 Ga0070660_100073446
537 Ga0070689_100024007
538 Ga0070689_100038155
539 Ga0070691_10067048
540 Ga0070691_10075476
541 Ga0070687_100060660
542 Ga0070661_100062458
543 Ga0070692_10030799
544 Ga0070675_100078703
545 Ga0070675_100324665
546 Ga0070674_100043835
547 Ga0070673_100680440
548 Ga0070688_100050916
549 Ga0070659_100003679
550 Ga0070659_100207279
551 Ga0070703_10000373
552 Ga0070709_10009717
553 Ga0070709_10312199
554 Ga0070701_10004773
555 Ga0070711_100000089
556 Ga0070711_100022103
557 Ga0070711_100077179
558 Ga0070705_100001392
559 Ga0070705_100003811
560 Ga0070705_100013235
561 Ga0070705_100100206
562 Ga0070705_100223540
563 Ga0070705_100229226
564 Ga0070700_100169611
565 Ga0070694_100010396
566 Ga0070694_100034651
567 Ga0070694_100089354
568 Ga0070694_100100818
569 Ga0070708_100000055
570 Ga0070708_100008044
571 Ga0070708_100019161
572 Ga0070708_100047672
573 Ga0070708_100174859
574 Ga0070708_100202273
575 Ga0070708_100242439
576 Ga0070663_100002562
577 Ga0070678_100034428
578 Ga0070662_100001743
579 Ga0070662_100009925
580 Ga0070662_100122452
581 Ga0070681_10000634
582 Ga0070681_10007402
583 Ga0070681_10017448
584 Ga0070681_10021152
585 Ga0070681_10125396
586 Ga0070681_10171965
587 Ga0068867_100049329
588 Ga0068867_100069709
589 Ga0068867_100149106
590 Ga0070706_100025789
591 Ga0070706_100052175
592 Ga0070706_100089844
593 Ga0070706_100108469
594 Ga0070706_100110944
595 Ga0070706_100117386
596 Ga0070706_100166707
597 Ga0070707_100008952
598 Ga0070707_100068118
599 Ga0070707_100101046
600 Ga0070707_100165752
601 Ga0070707_100206775
602 Ga0070707_100258507
603 Ga0070707_100465669
604 Ga0070698_100040922
605 Ga0070698_100078960
606 Ga0070698_100111339
607 Ga0070699_100000137
608 Ga0070699_100001366
609 Ga0070699_100001496
610 Ga0070699_100056752
611 Ga0070699_100071976
612 Ga0070699_100097930
613 Ga0070699_100140129
614 Ga0070699_100166114
615 Ga0070699_100258464
616 Ga0070699_100272054
617 Ga0070699_100489171
618 Ga0070679_100001705
619 Ga0070679_100002881
620 Ga0070679_100044881
621 Ga0070679_100046462
622 Ga0070679_100072418
623 Ga0070684_100031579
624 Ga0070684_100054138
625 Ga0070684_100350586
626 Ga0070697_100007511
627 Ga0070697_100015142
628 Ga0070697_100039623
629 Ga0070697_100044016
630 Ga0070697_100094606
631 Ga0070697_100126176
632 Ga0070697_100130400
633 Ga0070697_100168040
634 Ga0070697_100199464
635 Ga0070697_100301371
636 Ga0068853_100135471
637 Ga0070686_100009768
638 Ga0070695_100002334
639 Ga0070695_100002365
640 Ga0070695_100004618
641 Ga0070695_100014235
642 Ga0070695_100051797
643 Ga0070695_100062931
644 Ga0070695_100084175
645 Ga0070696_100002396
646 Ga0070696_100005732
647 Ga0070696_100007389
648 Ga0070696_100010050
649 Ga0070696_100127103
650 Ga0070696_100256158
651 Ga0070693_100115398
652 Ga0070704_100000848
653 Ga0070704_100002888
654 Ga0070704_100008689
655 Ga0070704_100012655
656 Ga0070704_100015731
657 Ga0070704_100016036
658 Ga0070704_100040066
659 Ga0070704_100083729
660 Ga0070704_100161203
661 Ga0070704_100181590
662 Ga0068855_100000786
663 Ga0068855_100003477
664 Ga0068855_100067328
665 Ga0068855_100698770
666 Ga0070664_100013174
667 Ga0070664_100053003
668 Ga0070664_100287380
669 Ga0068857_100138392
670 Ga0068854_100006431
671 Ga0068854_100047402
672 Ga0068856_100041524
673 Ga0070702_100074739
674 Ga0070702_100129337
675 Ga0068852_100051453
676 Ga0068852_100606880
677 Ga0068859_100005326
678 Ga0068859_100005825
679 Ga0068859_100017152
680 Ga0068859_100101593
681 Ga0068864_100079520
682 Ga0068864_100238187
683 Ga0068864_100372057
684 Ga0068866_10023028
685 Ga0068861_100145353
686 Ga0068870_10011340
687 Ga0068862_100032501
688 Ga0070717_10015630
689 Ga0070716_100056975
690 Ga0075428_100030365
691 Ga0075428_100055185
692 Ga0075428_100065512
693 Ga0075428_100094485
694 Ga0075428_100136790
695 Ga0075430_100126080
696 Ga0075430_100312162
697 Ga0075431_100035770
698 Ga0075431_100120582
699 Ga0075431_100363798
700 Ga0075433_10010046
701 Ga0075433_10031402
702 Ga0075433_10034762
703 Ga0075433_10077103
704 Ga0075433_10177224
705 Ga0075434_100001322
706 Ga0075434_100005383
707 Ga0075434_100007083
708 Ga0075434_100038124
709 Ga0075434_100042407
710 Ga0075434_100064478
711 Ga0075434_100156174
712 Ga0075434_100209115
713 Ga0075434_100220317
714 Ga0075429_100000353
715 Ga0075429_100002919
716 Ga0075429_100006191
717 Ga0068865_100006477
718 Ga0075436_100006079
719 Ga0075436_100006115
720 Ga0075436_100009852
721 Ga0075436_100014344
722 Ga0075436_100026582
723 Ga0075436_100060017
724 Ga0075436_100083479
725 Ga0075436_100102194
726 Ga0075436_100103428
727 Ga0075436_100144182
728 Ga0075436_100371894
729 Ga0097620_100005326
730 Ga0097620_100005825
731 Ga0097620_100017152
732 Ga0097620_100101595
733 Ga0075435_100026795
734 Ga0075435_100062572
735 Ga0075435_100113782
736 Ga0075435_100205868
737 Ga0075435_100243205
738 Ga0099794_10000615
739 Ga0099794_10007109
740 Ga0099794_10020964
741 Ga0105240_10234727
742 Ga0105240_10921754
743 Ga0111539_10204803
744 Ga0111539_10541847
745 Ga0111539_10863521
746 Ga0105245_10014135
747 Ga0105245_10082570
748 Ga0114129_10037448
749 Ga0114129_10058707
750 Ga0114129_10086161
751 Ga0114129_10108572
752 Ga0114129_10129254
753 Ga0114129_10141227
754 Ga0105241_10000078
755 Ga0105241_10002144
756 Ga0105248_10007232
757 Ga0105248_10109809
758 Ga0105237_10054620
759 Ga0105237_10197902
760 Ga0105239_10046745
761 Ga0105239_10389074
762 Ga0105246_10000770
763 Ga0157373_10002111
764 Ga0157373_10006988
765 Ga0157371_10005022
766 Ga0157371_10036234
767 Ga0157370_10029530
768 Ga0157370_10030079
769 Ga0157370_10139969
770 Ga0157370_10284132
771 Ga0157369_10006429
772 Ga0157374_10133465
773 Ga0157378_10003409
774 Ga0157378_10006588
775 Ga0157378_10087533
776 Ga0163162_10635676
777 Ga0157372_10028699
778 Ga0157372_10031475
779 Ga0157372_10053419
780 Ga0157372_10062451
781 Ga0157372_10089814
782 Ga0157372_10096711
783 Ga0157372_10737141
784 Ga0157375_10095291
785 Ga0157375_10148553
786 Ga0163163_10020735
787 Ga0163163_10023230
788 Ga0157376_10032780
789 Ga0224712_10080388
790 Ga0207653_10000085
791 Ga0207653_10001267
792 Ga0207642_10014080
793 Ga0207680_10121858
794 Ga0207699_10013562
795 Ga0207645_10036570
796 Ga0207643_10049964
797 Ga0207705_10055760
798 Ga0207705_10136946
799 Ga0207684_10004698
800 Ga0207684_10077984
801 Ga0207684_10118051
802 Ga0207684_10126150
803 Ga0207684_10194015
804 Ga0207684_10394699
805 Ga0207654_10000050
806 Ga0207707_10001688
807 Ga0207707_10001801
808 Ga0207707_10015861
809 Ga0207707_10030233
810 Ga0207707_10206666
811 Ga0207695_10002651
812 Ga0207695_10005926
813 Ga0207695_10069957
814 Ga0207695_10243616
815 Ga0207695_10493355
816 Ga0207693_10228327
817 Ga0207663_10000069
818 Ga0207660_10003263
819 Ga0207660_10014701
820 Ga0207660_10017897
821 Ga0207660_10023403
822 Ga0207660_10024836
823 Ga0207660_10037193
824 Ga0207660_10038689
825 Ga0207660_10175511
826 Ga0207662_10063631
827 Ga0207662_10114424
828 Ga0207657_10000525
829 Ga0207657_10210408
830 Ga0207657_10305968
831 Ga0207649_10005217
832 Ga0207649_10068374
833 Ga0207652_10000949
834 Ga0207652_10048876
835 Ga0207652_10065379
836 Ga0207652_10120380
837 Ga0207652_10371780
838 Ga0207646_10000092
839 Ga0207646_10001041
840 Ga0207646_10015945
841 Ga0207646_10036110
842 Ga0207646_10041846
843 Ga0207646_10090529
844 Ga0207646_10141259
845 Ga0207646_10185519
846 Ga0207681_10012740
847 Ga0207694_10195621
848 Ga0207700_10072725
849 Ga0207664_10025032
850 Ga0207690_10004796
851 Ga0207706_10001304
852 Ga0207706_10096242
853 Ga0207709_10173208
854 Ga0207670_10099278
855 Ga0207670_10159456
856 Ga0207669_10037569
857 Ga0207669_10103980
858 Ga0207704_10002003
859 Ga0207665_10020222
860 Ga0207711_10018651
861 Ga0207711_10035832
862 Ga0207689_10003112
863 Ga0207661_10003608
864 Ga0207661_10020676
865 Ga0207661_10039436
866 Ga0207661_10386912
867 Ga0207679_10019453
868 Ga0207679_10192426
869 Ga0207667_10004021
870 Ga0207667_10014209
871 Ga0207667_10127487
872 Ga0207667_10159398
873 Ga0207667_10418092
874 Ga0207651_10065196
875 Ga0207651_10135476
876 Ga0207712_10490545
877 Ga0207640_10005759
878 Ga0207640_10011054
879 Ga0207640_10315462
880 Ga0207703_10029133
881 Ga0207639_10170643
882 Ga0207678_10001153
883 Ga0207678_10120882
884 Ga0207708_10056540
885 Ga0207702_10044861
886 Ga0207641_10108351
887 Ga0207648_10009916
888 Ga0207648_10020561
889 Ga0207648_10190717
890 Ga0207648_10373235
891 Ga0207676_10040707
892 Ga0207674_10005719
893 Ga0207674_10128041
894 Ga0207675_100277979
895 Ga0207683_10003189
896 Ga0209588_1000237
897 Ga0209588_1001639
898 Ga0209588_1016499
899 Ga0268265_10367546
900 Ga0268264_10008641
901 Ga0307408_100023448
902 Ga0307408_100070326
903 Ga0307405_10123786
904 Ga0307412_10211905
905 Ga0307412_10235474
906 Ga0307416_100026061
907 Ga0307416_100199196
908 Ga0373941_0073897
909 Ga0373960_0042279
910 Ga0373931_0004972
911 Ga0395905_0227685
912 Ga0242420_007058
913 Ga0439460_0041541
914 Ga0451577_0301199
915 Ga0453683_0001876
916 Ga0453683_0015156
917 Ga0453683_0047857
918 Ga0466966_0007526
919 Ga0466966_0078511
920 Ga0466961_0148256
921 Ga0466959_0019968
922 Ga0466959_0021443
923 Ga0451576_0003493
924 Ga0451576_0041594
925 Ga0451576_0102987
926 Ga0451576_0322677
927 Ga0495629_0022185
928 Ga0495582_0034316
929 Ga0495645_0261621
930 Ga0495588_0094913
931 Ga0495677_0081954
932 Ga0496101_0202146
933 Ga0496102_0080226
934 Ga0496102_0138907
935 Ga0496103_0262883
936 Ga0496104_0025331
937 Ga0496104_0564061
938 Ga0496106_0106314
939 Ga0496107_0023553
940 Ga0496109_0002802
941 Ga0496109_0005855
942 Ga0496109_0021525
943 Ga0496109_0452434
944 Ga0496112_0006901
945 Ga0496112_0012381
946 Ga0496112_0399758
947 Ga0496113_0007287
948 Ga0496113_0015175
949 Ga0496114_0127498
950 Ga0496114_0491335
951 Ga0501031_0047811
952 Ga0501036_0029337
953 Ga0501040_0248520
954 Ga0501041_0071700
955 Ga0501042_0009642
956 Ga0501042_0259889
957 Ga0501046_0376577
958 Ga0501048_0208974
959 Ga0501070_0280717
960 Ga0501071_0016141
961 Ga0501072_0014424
962 Ga0501072_0072081
963 Ga0501073_0228391
964 Ga0501074_0197779
965 Ga0501075_0005868
966 Ga0501076_0029185
967 Ga0501076_0313565
968 Ga0501077_0008748
969 Ga0501077_0107440
970 Ga0501079_0010008
971 Ga0501079_0043223
972 Ga0501080_0051270
973 Ga0501080_0288242
974 Ga0501081_0123509
975 Ga0501045_0008933
976 nmdc:mga05p37_177684_c1
977 nmdc:mga05p37_191677_c1
978 nmdc:mga05p37_21176_c1
979 nmdc:mga05p37_221559_c1
980 nmdc:mga05p37_36903_c1
981 nmdc:mga05p37_483491_c1
982 nmdc:mga09592_1501_c1
983 nmdc:mga09592_17135_c1
984 nmdc:mga09592_9562_c1
985 nmdc:mga0qj67_21416_c1
986 nmdc:mga0qj67_222213_c1
987 nmdc:mga0qj67_301132_c1
988 nmdc:mga0n895_1706_c1
989 nmdc:mga0n895_194805_c1
990 nmdc:mga0n895_234514_c1
991 nmdc:mga0n895_315360_c1
992 nmdc:mga0n895_3589_c1
993 nmdc:mga0n895_54328_c1
994 nmdc:mga0n895_692871_c1
995 nmdc:mga0n895_8284_c1
996 nmdc:mga0n895_8746_c1
997 nmdc:mga0rr50_14575_c1
998 nmdc:mga0rr50_289377_c1
999 nmdc:mga0rr50_28945_c1
1000 nmdc:mga0rr50_34985_c1
1001 nmdc:mga0rr50_392422_c1
1002 nmdc:mga0rr50_474071_c1
1003 nmdc:mga0rr50_549009_c1
1004 nmdc:mga08x19_109128_c1
1005 nmdc:mga08x19_12072_c1
1006 nmdc:mga08x19_15345_c1
1007 nmdc:mga08x19_311400_c1
1008 nmdc:mga08x19_3415_c1
1009 nmdc:mga08x19_34676_c1
1010 nmdc:mga08x19_34876_c1
1011 nmdc:mga0a205_16281_c1
1012 nmdc:mga0a205_17438_c1
1013 nmdc:mga0a205_19876_c1
1014 nmdc:mga0a205_26861_c1
1015 nmdc:mga0a205_82571_c1
1016 Ga0501084_0086757
1017 Ga0501082_0054582
1018 Ga0501082_0113331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

162

0.97

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

167

287

0.94

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

96

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c79-assembly1.cif.gz_B crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph 0.8802 2 269
6vpb-assembly1.cif.gz_B-2 a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) 0.8769 2 287
2p4q-assembly1.cif.gz_A-2 crystal structure analysis of gnd1 in saccharomyces cerevisiae 0.8732 2 271
7cb2-assembly1.cif.gz_A the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus 0.8694 2 271
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.8674 1 284
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9279 2 164 3.40.50.720
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9271 2 163 3.40.50.720
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9264 2 158 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9253 2 133 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.922 2 168 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0L0LZ89-F1-model_v4 deleted 0.9874 2 111
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9874 2 111 GO:0004616
GO:0050661
AF-A0A7W0X915-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9731 2 130 GO:0004616
GO:0050661
AF-A0A2V9N3X7-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9707 1 184 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A521XLA1-F1-model_v4 6-phosphogluconate dehydrogenase 0.9699 1 139 GO:0004616
GO:0050661

Map