F456751

General Info

Members Datasets Scaffolds Average Seq Length
507 280 493 363

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0010177|Ga0501070_0010177_1637_2839
Length 400
Sequence LILAIEEQRFTLRVSGASRSAIFCACRRPDDIGGTALVMKHPDGVTTPVIDASVHIFSKSNKDLRSNFLREPFKSRGFPDYEMDWYGAPGGEYAPKTEGPDRQYPGSDPEIVGGHLFDDRGVDVAILHPMTRGIMPDRHLGTAIAAAHNEMMVSRWLEDNPYAEKFRGTIRVNPDDIAGALRDIEKYADHPRVVQVGVPLQSRELYGKPQYWPLWEAAAEADLPVSVHIEVGAGVQFAPTPSGVPRTYENYVSFMALNYLYHLMNLIVEGVFEKMPSLKFVWADGAADMLTPFIWRMDCFGRPHLEQTPWAPNMPSDYLPGHTFFVQGAMDGPGDTDFAGEWLGFTGKEDMVMFGSSYPHWQLNELKVPASYSPEQRDKLCWRNAAQLYGIDVGAGIKIG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
8 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
9 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
10 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
11 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
12 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.16
Nodule 0.2
Rhizoplane 7.3
Rhizosphere 67.46
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013353 3300001989 Bacteria 2999
2 JGI24750J21931_1002268 3300002070 Bacteria 2328
3 JGI24744J21845_10000180 3300002077 Bacteria 9564
4 JGI24742J22300_10000575 3300002244 Bacteria 5516
5 rootH2_10160637 3300003320 Bacteria 5970
6 Ga0055540_1000003 3300003792 Bacteria 428375
7 Ga0070676_10014608 3300005328 Bacteria 4319
8 Ga0068869_100180708 3300005334 Bacteria 1654
9 Ga0070666_10011677 3300005335 Bacteria 5522
10 Ga0070666_10106181 3300005335 Bacteria 1940
11 Ga0070680_100057860 3300005336 Bacteria 3170
12 Ga0070682_100007655 3300005337 Bacteria 6086
13 Ga0070682_100037772 3300005337 Bacteria 2958
14 Ga0068868_100001175 3300005338 Bacteria 17927
15 Ga0070691_10002313 3300005341 Bacteria 8446
16 Ga0070668_100001742 3300005347 Bacteria 15831
17 Ga0070669_100001809 3300005353 Bacteria 15403
18 Ga0070674_100000563 3300005356 Bacteria 18666
19 Ga0070674_100049353 3300005356 Bacteria 2893
20 Ga0070667_100000073 3300005367 Bacteria 122757
21 Ga0070667_100062030 3300005367 Bacteria 3166
22 Ga0070709_10018712 3300005434 Bacteria 3996
23 Ga0070714_100031650 3300005435 Bacteria 4416
24 Ga0070710_10002470 3300005437 Bacteria 8755
25 Ga0070701_10003417 3300005438 Bacteria 6280
26 Ga0070701_10048857 3300005438 Bacteria 2185
27 Ga0070711_100007402 3300005439 Bacteria 6676
28 Ga0070705_100028093 3300005440 Bacteria 3078
29 Ga0070700_100005048 3300005441 Bacteria 6962
30 Ga0070694_100001137 3300005444 Bacteria 15245
31 Ga0070708_100192915 3300005445 Bacteria 1906
32 Ga0070663_100058991 3300005455 Bacteria 2757
33 Ga0070678_100000818 3300005456 Bacteria 15756
34 Ga0070678_100035775 3300005456 Bacteria 3471
35 Ga0068867_100000117 3300005459 Bacteria 50416
36 Ga0068867_100147539 3300005459 Bacteria 1845
37 Ga0068853_100009645 3300005539 Bacteria 7780
38 Ga0070672_100371458 3300005543 Bacteria 1222
39 Ga0070686_100041787 3300005544 Bacteria 2868
40 Ga0070695_100032255 3300005545 Bacteria 3274
41 Ga0070696_100118571 3300005546 Bacteria 1913
42 Ga0070693_100014078 3300005547 Bacteria 4089
43 Ga0070665_100004662 3300005548 Bacteria 14320
44 Ga0070665_100007819 3300005548 Bacteria 10853
45 Ga0070665_100027864 3300005548 Bacteria 5689
46 Ga0070665_100057588 3300005548 Bacteria 3896
47 Ga0070704_100000959 3300005549 Bacteria 14633
48 Ga0068855_100056941 3300005563 Bacteria 4584
49 Ga0068854_100014007 3300005578 Bacteria 5276
50 Ga0068856_100145730 3300005614 Bacteria 2376
51 Ga0070702_100000286 3300005615 Bacteria 17291
52 Ga0068859_100000223 3300005617 Bacteria 56082
53 Ga0068859_100370634 3300005617 Bacteria 1527
54 Ga0068866_10000573 3300005718 Bacteria 16728
55 Ga0068861_100000507 3300005719 Bacteria 22720
56 Ga0068861_100275739 3300005719 Bacteria 1446
57 Ga0068863_100013142 3300005841 Bacteria 7991
58 Ga0068863_100253354 3300005841 Bacteria 1701
59 Ga0068858_100004229 3300005842 Bacteria 14135
60 Ga0068858_100049003 3300005842 Bacteria 3912
61 Ga0068858_100075530 3300005842 Bacteria 3130
62 Ga0068860_100000127 3300005843 Bacteria 122766
63 Ga0068860_100008369 3300005843 Bacteria 10299
64 Ga0068860_100105074 3300005843 Bacteria 2697
65 Ga0068862_100000052 3300005844 Bacteria 144622
66 Ga0068862_100005541 3300005844 Bacteria 10545
67 Ga0081455_10016795 3300005937 Bacteria 7042
68 Ga0081455_10039911 3300005937 Bacteria 4144
69 Ga0081538_10086601 3300005981 Bacteria 1639
70 Ga0075365_10015394 3300006038 Bacteria 4627
71 Ga0075365_10040188 3300006038 Bacteria 3050
72 Ga0075365_10053414 3300006038 Bacteria 2676
73 Ga0075365_10055595 3300006038 Bacteria 2628
74 Ga0075365_10076948 3300006038 Bacteria 2253
75 Ga0075365_10079041 3300006038 Bacteria 2225
76 Ga0075365_10146342 3300006038 Bacteria 1642
77 Ga0075368_10015566 3300006042 Bacteria 2824
78 Ga0075368_10030902 3300006042 Bacteria 2076
79 Ga0075368_10073154 3300006042 Bacteria 1387
80 Ga0075363_100002313 3300006048 Bacteria 7738
81 Ga0075363_100010782 3300006048 Bacteria 4357
82 Ga0075363_100014427 3300006048 Bacteria 3861
83 Ga0075363_100023969 3300006048 Bacteria 3098
84 Ga0075363_100034064 3300006048 Bacteria 2657
85 Ga0075363_100042785 3300006048 Bacteria 2394
86 Ga0075364_10000962 3300006051 Bacteria 15179
87 Ga0075364_10001660 3300006051 Bacteria 12206
88 Ga0075364_10002949 3300006051 Bacteria 9595
89 Ga0075364_10018915 3300006051 Bacteria 4320
90 Ga0075364_10038825 3300006051 Bacteria 3085
91 Ga0075364_10055791 3300006051 Bacteria 2585
92 Ga0075364_10108537 3300006051 Bacteria 1851
93 Ga0070715_10002319 3300006163 Bacteria 5809
94 Ga0070716_100004074 3300006173 Bacteria 6935
95 Ga0070712_100007624 3300006175 Bacteria 6768
96 Ga0075362_10000670 3300006177 Bacteria 10096
97 Ga0075362_10004906 3300006177 Bacteria 4842
98 Ga0075367_10002030 3300006178 Bacteria 9051
99 Ga0075367_10010474 3300006178 Bacteria 4872
100 Ga0075367_10055848 3300006178 Bacteria 2344
101 Ga0075367_10068700 3300006178 Bacteria 2126
102 Ga0075369_10001469 3300006186 Bacteria 8030
103 Ga0075369_10002827 3300006186 Bacteria 6246
104 Ga0075369_10003742 3300006186 Bacteria 5564
105 Ga0075369_10012879 3300006186 Bacteria 3309
106 Ga0075369_10019335 3300006186 Bacteria 2781
107 Ga0075369_10019835 3300006186 Bacteria 2748
108 Ga0075369_10034016 3300006186 Bacteria 2162
109 Ga0075369_10036567 3300006186 Bacteria 2090
110 Ga0075369_10058209 3300006186 Bacteria 1682
111 Ga0075370_10003723 3300006353 Bacteria 7298
112 Ga0075370_10004100 3300006353 Bacteria 7018
113 Ga0075370_10004505 3300006353 Bacteria 6780
114 Ga0075370_10018937 3300006353 Bacteria 3739
115 Ga0075428_100000149 3300006844 Bacteria 63444
116 Ga0075430_100023965 3300006846 Bacteria 5197
117 Ga0075430_100035595 3300006846 Bacteria 4224
118 Ga0075431_100047161 3300006847 Bacteria 4442
119 Ga0068865_100003324 3300006881 Bacteria 9634
120 Ga0097620_100000223 3300006931 Bacteria 56082
121 Ga0097620_100370601 3300006931 Bacteria 1527
122 Ga0099794_10000303 3300007265 Bacteria 16845
123 Ga0105250_10029416 3300009092 Bacteria 2210
124 Ga0105245_10001561 3300009098 Bacteria 20801
125 Ga0105245_10277084 3300009098 Bacteria 1638
126 Ga0105247_10000066 3300009101 Bacteria 121025
127 Ga0105247_10005316 3300009101 Bacteria 8117
128 Ga0105247_10083984 3300009101 Bacteria 2012
129 Ga0105243_10002003 3300009148 Bacteria 17327
130 Ga0105241_10038409 3300009174 Bacteria 3609
131 Ga0105242_10000979 3300009176 Bacteria 22301
132 Ga0105248_10000613 3300009177 Bacteria 40714
133 Ga0105248_10006306 3300009177 Bacteria 13011
134 Ga0105237_10009594 3300009545 Bacteria 10364
135 Ga0105237_10132757 3300009545 Bacteria 2484
136 Ga0105238_10129573 3300009551 Bacteria 2501
137 Ga0105249_10000093 3300009553 Bacteria 122840
138 Ga0105249_10001158 3300009553 Bacteria 23315
139 Ga0105249_10115490 3300009553 Bacteria 2543
140 Ga0105239_10080472 3300010375 Bacteria 3584
141 Ga0105239_10089083 3300010375 Bacteria 3403
142 Ga0105246_10146180 3300011119 Bacteria 1784
143 Ga0157374_10027347 3300013296 Bacteria 5143
144 Ga0157378_10002180 3300013297 Bacteria 17360
145 Ga0163162_10008719 3300013306 Bacteria 9867
146 Ga0163162_10017001 3300013306 Bacteria 7116
147 Ga0163162_10065636 3300013306 Bacteria 3677
148 Ga0157372_10015293 3300013307 Bacteria 8220
149 Ga0157375_10000151 3300013308 Bacteria 68008
150 Ga0157375_10053182 3300013308 Bacteria 3983
151 Ga0157375_10183666 3300013308 Bacteria 2244
152 Ga0163163_10012823 3300014325 Bacteria 7649
153 Ga0163163_10069042 3300014325 Bacteria 3518
154 Ga0157380_10002064 3300014326 Bacteria 13450
155 Ga0157379_10006897 3300014968 Bacteria 9822
156 Ga0157376_10070053 3300014969 Bacteria 2975
157 Ga0163161_10002439 3300017792 Bacteria 13286
158 Ga0163161_10040431 3300017792 Bacteria 3350
159 Ga0213876_10000674 3300021384 Bacteria 24320
160 Ga0213876_10018017 3300021384 Bacteria 3726
161 Ga0213876_10105288 3300021384 Bacteria 1497
162 Ga0213875_10000343 3300021388 Bacteria 43778
163 Ga0213875_10000662 3300021388 Bacteria 27237
164 Ga0209051_1000011 3300025303 Bacteria 610828
165 Ga0207692_10020690 3300025898 Bacteria 2998
166 Ga0207642_10067890 3300025899 Bacteria 1685
167 Ga0207710_10000090 3300025900 Bacteria 121405
168 Ga0207710_10004078 3300025900 Bacteria 6421
169 Ga0207688_10000025 3300025901 Bacteria 48564
170 Ga0207688_10002628 3300025901 Bacteria 9719
171 Ga0207680_10004479 3300025903 Bacteria 6628
172 Ga0207647_10027565 3300025904 Bacteria 3702
173 Ga0207647_10129397 3300025904 Bacteria 1484
174 Ga0207685_10001272 3300025905 Bacteria 5158
175 Ga0207699_10013198 3300025906 Bacteria 4221
176 Ga0207654_10021827 3300025911 Bacteria 3409
177 Ga0207671_10007814 3300025914 Bacteria 9198
178 Ga0207693_10000123 3300025915 Bacteria 69311
179 Ga0207693_10057967 3300025915 Bacteria 3034
180 Ga0207663_10003682 3300025916 Bacteria 7537
181 Ga0207681_10000925 3300025923 Bacteria 19151
182 Ga0207694_10187397 3300025924 Bacteria 1680
183 Ga0207687_10001927 3300025927 Bacteria 14289
184 Ga0207664_10047136 3300025929 Bacteria 3385
185 Ga0207664_10064198 3300025929 Bacteria 2936
186 Ga0207644_10027020 3300025931 Bacteria 3962
187 Ga0207706_10005323 3300025933 Bacteria 11997
188 Ga0207686_10001243 3300025934 Bacteria 14738
189 Ga0207670_10012335 3300025936 Bacteria 4997
190 Ga0207669_10000400 3300025937 Bacteria 19143
191 Ga0207669_10034672 3300025937 Bacteria 2862
192 Ga0207704_10000325 3300025938 Bacteria 22184
193 Ga0207665_10009980 3300025939 Bacteria 6233
194 Ga0207665_10085366 3300025939 Bacteria 2179
195 Ga0207711_10000183 3300025941 Bacteria 67270
196 Ga0207711_10021248 3300025941 Bacteria 5421
197 Ga0207689_10187813 3300025942 Bacteria 1704
198 Ga0207667_10161488 3300025949 Bacteria 2304
199 Ga0207712_10000073 3300025961 Bacteria 123046
200 Ga0207712_10009651 3300025961 Bacteria 6116
201 Ga0207712_10029629 3300025961 Bacteria 3674
202 Ga0207668_10007261 3300025972 Bacteria 6579
203 Ga0207640_10000582 3300025981 Bacteria 21781
204 Ga0207658_10000304 3300025986 Bacteria 50815
205 Ga0207658_10007427 3300025986 Bacteria 7475
206 Ga0207658_10007945 3300025986 Bacteria 7225
207 Ga0207677_10020279 3300026023 Bacteria 4033
208 Ga0207677_10384402 3300026023 Bacteria 1186
209 Ga0207703_10005604 3300026035 Bacteria 10083
210 Ga0207703_10025031 3300026035 Bacteria 4694
211 Ga0207639_10006443 3300026041 Bacteria 7983
212 Ga0207678_10006722 3300026067 Bacteria 10198
213 Ga0207678_10016116 3300026067 Bacteria 6563
214 Ga0207708_10003189 3300026075 Bacteria 12082
215 Ga0207702_10108904 3300026078 Bacteria 2459
216 Ga0207641_10000413 3300026088 Bacteria 49861
217 Ga0207641_10008652 3300026088 Bacteria 8404
218 Ga0207648_10000381 3300026089 Bacteria 48976
219 Ga0207675_100000406 3300026118 Bacteria 41422
220 Ga0207675_100087516 3300026118 Bacteria 2926
221 Ga0207675_100249396 3300026118 Bacteria 1718
222 Ga0207683_10001482 3300026121 Bacteria 21160
223 Ga0207683_10037569 3300026121 Bacteria 4218
224 Ga0209588_1000042 3300027671 Bacteria 59013
225 Ga0209813_10018918 3300027866 Bacteria 1908
226 Ga0268266_10007875 3300028379 Bacteria 9544
227 Ga0268266_10037098 3300028379 Bacteria 4152
228 Ga0268266_10043785 3300028379 Bacteria 3826
229 Ga0268266_10073545 3300028379 Bacteria 2966
230 Ga0268266_10324998 3300028379 Bacteria 1441
231 Ga0268265_10000063 3300028380 Bacteria 144643
232 Ga0268265_10009020 3300028380 Bacteria 6746
233 Ga0268265_10106804 3300028380 Bacteria 2275
234 Ga0268264_10000007 3300028381 Bacteria 815790
235 Ga0268264_10041265 3300028381 Bacteria 3816
236 Ga0268264_10347265 3300028381 Bacteria 1411
237 Ga0268264_10435899 3300028381 Bacteria 1266
238 Ga0268264_10436140 3300028381 Bacteria 1266
239 Ga0265327_10001674 3300031251 Bacteria 26619
240 Ga0307413_10049747 3300031824 Bacteria 2514
241 Ga0307413_10120846 3300031824 Bacteria 1774
242 Ga0307409_100020812 3300031995 Bacteria 4481
243 Ga0373932_0018165 3300035112 Bacteria 1815
244 Ga0373957_0014718 3300035120 Bacteria 2679
245 Ga0373957_0015510 3300035120 Bacteria 2624
246 Ga0373955_0039937 3300035172 Bacteria 2507
247 Ga0373935_0162369 3300035692 Bacteria 1524
248 Ga0373933_0017097 3300035724 Bacteria 4067
249 Ga0373933_0048072 3300035724 Bacteria 2539
250 Ga0373937_0007287 3300036401 Bacteria 9573
251 Ga0373937_0071814 3300036401 Bacteria 3192
252 Ga0316582_0036483 3300036647 Bacteria 3043
253 Ga0373925_0008507 3300037068 Bacteria 7479
254 Ga0436364_0601748 3300037853 Bacteria 4165
255 Ga0436364_0694490 3300037853 Bacteria 3653
256 Ga0436364_0699238 3300037853 Bacteria 158550
257 Ga0436364_1139754 3300037853 Bacteria 24806
258 Ga0436365_0016980 3300039437 Bacteria 29756
259 Ga0436365_0119240 3300039437 Bacteria 17758
260 Ga0436365_0358457 3300039437 Bacteria 3073
261 Ga0436365_0731445 3300039437 Bacteria 19835
262 Ga0436363_0434666 3300039450 Bacteria 1893
263 Ga0439461_0000107 3300041410 Bacteria 10973
264 Ga0439465_0001090 3300041413 Bacteria 8696
265 Ga0439465_0003041 3300041413 Bacteria 5484
266 Ga0439465_0003488 3300041413 Bacteria 5131
267 Ga0439465_0048605 3300041413 Bacteria 1384
268 Ga0439465_0053781 3300041413 Bacteria 1323
269 Ga0439431_0000641 3300041997 Bacteria 7437
270 Ga0439445_0007068 3300042004 Bacteria 2595
271 Ga0466972_0020727 3300044658 Bacteria 3283
272 Ga0466972_0025007 3300044658 Bacteria 2962
273 Ga0466972_0043477 3300044658 Bacteria 2181
274 Ga0466972_0127049 3300044658 Bacteria 1201
275 Ga0466965_0000284 3300044683 Bacteria 16738
276 Ga0466965_0070156 3300044683 Bacteria 1761
277 Ga0466966_0002603 3300044684 Bacteria 11833
278 Ga0466966_0091999 3300044684 Bacteria 1882
279 Ga0466961_0012955 3300044693 Bacteria 5334
280 Ga0466963_0042681 3300044694 Bacteria 2979
281 Ga0466963_0114017 3300044694 Bacteria 1857
282 Ga0466971_0105090 3300044719 Bacteria 1300
283 Ga0466968_0001326 3300044735 Bacteria 8858
284 Ga0466968_0035224 3300044735 Bacteria 2094
285 Ga0466970_0048442 3300044765 Bacteria 2266
286 Ga0466970_0050179 3300044765 Bacteria 2225
287 Ga0466970_0052219 3300044765 Bacteria 2182
288 Ga0466970_0094258 3300044765 Bacteria 1626
289 Ga0466957_0005427 3300044842 Bacteria 7159
290 Ga0466957_0007638 3300044842 Bacteria 6115
291 Ga0466957_0164217 3300044842 Bacteria 1443
292 Ga0466960_0000392 3300044901 Bacteria 14930
293 Ga0466960_0000796 3300044901 Bacteria 11075
294 Ga0466960_0001519 3300044901 Bacteria 8452
295 Ga0466959_0001756 3300045049 Bacteria 13505
296 Ga0466959_0057757 3300045049 Bacteria 2828
297 Ga0466959_0060609 3300045049 Bacteria 2753
298 Ga0466959_0137792 3300045049 Bacteria 1726
299 Ga0466958_0003235 3300045836 Bacteria 8408
300 Ga0466958_0020386 3300045836 Bacteria 3865
301 Ga0466958_0061117 3300045836 Bacteria 2294
302 Ga0466967_0002447 3300045976 Bacteria 11559
303 Ga0466967_0002855 3300045976 Bacteria 10973
304 Ga0466967_0005640 3300045976 Bacteria 8712
305 Ga0466967_0015951 3300045976 Bacteria 5907
306 Ga0466967_0024162 3300045976 Bacteria 4992
307 Ga0466967_0064489 3300045976 Bacteria 3258
308 Ga0466967_0065526 3300045976 Bacteria 3234
309 Ga0495592_0025999 3300046454 Bacteria 4440
310 Ga0495629_0076104 3300046459 Bacteria 2343
311 Ga0495638_0011379 3300046460 Bacteria 6131
312 Ga0495651_0000590 3300046462 Bacteria 28142
313 Ga0495651_0002735 3300046462 Bacteria 13671
314 Ga0495653_0002652 3300046463 Bacteria 14233
315 Ga0495582_0049667 3300046473 Bacteria 2310
316 Ga0495664_0061790 3300046477 Bacteria 2230
317 Ga0495594_0086148 3300046499 Bacteria 1758
318 Ga0495606_0023526 3300046507 Bacteria 4460
319 Ga0495606_0126080 3300046507 Bacteria 1527
320 Ga0495608_0000880 3300046511 Bacteria 20983
321 Ga0495618_0015417 3300046514 Bacteria 4665
322 Ga0495628_0012608 3300046516 Bacteria 7122
323 Ga0495628_0048026 3300046516 Bacteria 3384
324 Ga0495630_0222475 3300046517 Bacteria 1441
325 Ga0495652_0012547 3300046529 Bacteria 7641
326 Ga0495652_0032982 3300046529 Bacteria 4525
327 Ga0495640_0015166 3300046533 Bacteria 5803
328 Ga0495640_0035922 3300046533 Bacteria 3505
329 Ga0495640_0038891 3300046533 Bacteria 3343
330 Ga0495587_0004817 3300046536 Bacteria 8862
331 Ga0495587_0006296 3300046536 Bacteria 7745
332 Ga0495645_0009087 3300046543 Bacteria 6944
333 Ga0495645_0070099 3300046543 Bacteria 2530
334 Ga0495667_0000622 3300046559 Bacteria 22597
335 Ga0495635_0003023 3300046663 Bacteria 11555
336 Ga0495635_0012790 3300046663 Bacteria 5878
337 Ga0495657_0003443 3300046675 Bacteria 12912
338 Ga0495657_0008425 3300046675 Bacteria 7885
339 Ga0495599_0011987 3300046678 Bacteria 5333
340 Ga0495599_0028985 3300046678 Bacteria 3469
341 Ga0495623_0081957 3300046679 Bacteria 1994
342 Ga0495646_0016193 3300046680 Bacteria 4733
343 Ga0495646_0016439 3300046680 Bacteria 4697
344 Ga0495624_0022680 3300046690 Bacteria 4144
345 Ga0495600_0008639 3300046809 Bacteria 6265
346 Ga0495600_0014161 3300046809 Bacteria 5024
347 Ga0495581_0058146 3300047315 Bacteria 2232
348 Ga0495604_0002605 3300047317 Bacteria 14464
349 Ga0495604_0013413 3300047317 Bacteria 6528
350 Ga0495674_0007557 3300047319 Bacteria 10383
351 Ga0495674_0020275 3300047319 Bacteria 6157
352 Ga0495674_0207443 3300047319 Bacteria 1624
353 Ga0495676_0105524 3300047321 Bacteria 2077
354 Ga0495680_0004645 3300047322 Bacteria 13086
355 Ga0495680_0005837 3300047322 Bacteria 11521
356 Ga0495684_0004201 3300047471 Bacteria 11247
357 Ga0495686_0000940 3300047472 Bacteria 36165
358 Ga0495593_0006029 3300047673 Bacteria 7131
359 Ga0495602_0004450 3300048088 Bacteria 14621
360 Ga0495602_0014755 3300048088 Bacteria 7919
361 Ga0496100_0000402 3300048903 Bacteria 20919
362 Ga0496100_0006024 3300048903 Bacteria 6581
363 Ga0496100_0006694 3300048903 Bacteria 6305
364 Ga0496101_0011673 3300048904 Bacteria 5837
365 Ga0496101_0120804 3300048904 Bacteria 1980
366 Ga0496102_0000168 3300048905 Bacteria 88511
367 Ga0496102_0000864 3300048905 Bacteria 28989
368 Ga0496102_0002086 3300048905 Bacteria 17193
369 Ga0496102_0071212 3300048905 Bacteria 3192
370 Ga0496103_0000991 3300048906 Bacteria 20033
371 Ga0496103_0077152 3300048906 Bacteria 2091
372 Ga0496103_0092173 3300048906 Bacteria 1913
373 Ga0496103_0123123 3300048906 Bacteria 1653
374 Ga0496104_0001086 3300048907 Bacteria 23232
375 Ga0496104_0092470 3300048907 Bacteria 2892
376 Ga0496104_0331599 3300048907 Bacteria 1435
377 Ga0496105_0016435 3300048908 Bacteria 5910
378 Ga0496106_0001129 3300048909 Bacteria 19754
379 Ga0496106_0008362 3300048909 Bacteria 7663
380 Ga0496107_0000495 3300048910 Bacteria 21738
381 Ga0496107_0002465 3300048910 Bacteria 12005
382 Ga0496108_0001316 3300048911 Bacteria 19527
383 Ga0496108_0052180 3300048911 Bacteria 3426
384 Ga0496108_0084331 3300048911 Bacteria 2696
385 Ga0496109_0004469 3300048912 Bacteria 11684
386 Ga0496109_0016007 3300048912 Bacteria 6554
387 Ga0496109_0090243 3300048912 Bacteria 2834
388 Ga0496110_0029838 3300048913 Bacteria 4699
389 Ga0496112_0009696 3300048915 Bacteria 8692
390 Ga0496112_0010535 3300048915 Bacteria 8394
391 Ga0496113_0022204 3300048916 Bacteria 4485
392 Ga0496113_0036159 3300048916 Bacteria 3617
393 Ga0496113_0092681 3300048916 Bacteria 2330
394 Ga0496114_0000419 3300048917 Bacteria 31425
395 Ga0496114_0020778 3300048917 Bacteria 5329
396 Ga0496115_0007528 3300048918 Bacteria 8019
397 Ga0496115_0016628 3300048918 Bacteria 5605
398 Ga0496116_0015907 3300048919 Bacteria 5918
399 Ga0496117_0008185 3300048920 Bacteria 9978
400 Ga0496118_0000171 3300048921 Bacteria 117495
401 Ga0496118_0000185 3300048921 Bacteria 109095
402 Ga0496119_0003283 3300048922 Bacteria 16913
403 Ga0496120_0026953 3300048923 Bacteria 3542
404 Ga0496121_0013914 3300048924 Bacteria 8599
405 Ga0496122_0089837 3300048925 Bacteria 2098
406 Ga0496123_0001928 3300048926 Bacteria 27056
407 Ga0496124_0128677 3300048927 Bacteria 2014
408 Ga0496125_0028692 3300048928 Bacteria 5018
409 Ga0496126_0004133 3300048929 Bacteria 17554
410 Ga0496126_0018436 3300048929 Bacteria 6914
411 Ga0496126_0045573 3300048929 Bacteria 4029
412 Ga0496126_0216833 3300048929 Bacteria 1609
413 Ga0496126_0262115 3300048929 Bacteria 1437
414 Ga0501032_0000510 3300049569 Bacteria 31534
415 Ga0501032_0044287 3300049569 Bacteria 3013
416 Ga0501033_0006101 3300049570 Bacteria 9453
417 Ga0501034_0001987 3300049571 Bacteria 25894
418 Ga0501034_0005475 3300049571 Bacteria 13863
419 Ga0501034_0048527 3300049571 Bacteria 4285
420 Ga0501034_0073381 3300049571 Bacteria 3431
421 Ga0501036_0002002 3300049572 Bacteria 15830
422 Ga0501037_0000677 3300049573 Bacteria 26104
423 Ga0501039_0000157 3300049575 Bacteria 46924
424 Ga0501043_0000971 3300049579 Bacteria 25346
425 Ga0501046_0004078 3300049580 Bacteria 13317
426 Ga0501047_0001180 3300049581 Bacteria 25903
427 Ga0501047_0066724 3300049581 Bacteria 3469
428 Ga0501048_0003008 3300049582 Bacteria 12870
429 Ga0501069_0025801 3300049585 Bacteria 3214
430 Ga0501069_0045024 3300049585 Bacteria 2444
431 Ga0501070_0001412 3300049586 Bacteria 21509
432 Ga0501070_0001918 3300049586 Bacteria 18362
433 Ga0501070_0010177 3300049586 Bacteria 7962
434 Ga0501072_0084242 3300049588 Bacteria 2521
435 Ga0501077_0058547 3300049593 Bacteria 2446
436 Ga0501080_0110568 3300049742 Bacteria 2547
437 Ga0501080_0149267 3300049742 Bacteria 2161
438 Ga0501035_0000385 3300049822 Bacteria 50730
439 Ga0501035_0006567 3300049822 Bacteria 10901
440 Ga0501035_0069948 3300049822 Bacteria 3110
441 Ga0501044_0003392 3300049823 Bacteria 17949
442 Ga0501044_0012366 3300049823 Bacteria 9239
443 Ga0501044_0043642 3300049823 Bacteria 4657
444 nmdc:mga03683_14619_c1 3300050489 Bacteria 2908
445 nmdc:mga03n38_4954_c1 3300050490 Bacteria 4476
446 nmdc:mga03n38_69919_c1 3300050490 Bacteria 1622
447 nmdc:mga03n38_77469_c1 3300050490 Bacteria 1554
448 nmdc:mga03n38_920_c1 3300050490 Bacteria 7933
449 nmdc:mga00v17_1224_c1 3300050491 Bacteria 13469
450 nmdc:mga00v17_20971_c1 3300050491 Bacteria 3751
451 nmdc:mga00v17_22120_c1 3300050491 Bacteria 3665
452 nmdc:mga00v17_260_c1 3300050491 Bacteria 31041
453 nmdc:mga00v17_32303_c1 3300050491 Bacteria 3093
454 nmdc:mga00v17_5015_c1 3300050491 Bacteria 6949
455 nmdc:mga00v17_5384_c1 3300050491 Bacteria 6739
456 nmdc:mga0yw44_134126_c1 3300050492 Bacteria 1605
457 nmdc:mga0yw44_16098_c1 3300050492 Bacteria 4031
458 nmdc:mga0yw44_6445_c1 3300050492 Bacteria 5675
459 nmdc:mga0yw44_7990_c1 3300050492 Bacteria 5244
460 nmdc:mga0yw44_8485_c1 3300050492 Bacteria 5124
461 nmdc:mga0yw44_9040_c1 3300050492 Bacteria 5009
462 nmdc:mga0k408_127079_c1 3300050493 Bacteria 1512
463 nmdc:mga0k408_31031_c1 3300050493 Bacteria 2717
464 nmdc:mga06z11_17692_c1 3300050494 Bacteria 3241
465 nmdc:mga06z11_1917_c1 3300050494 Bacteria 7843
466 nmdc:mga04h51_39000_c1 3300050495 Bacteria 1541
467 nmdc:mga04h51_7764_c1 3300050495 Bacteria 2845
468 nmdc:mga07m45_2038_c1 3300050496 Bacteria 9377
469 nmdc:mga07m45_26667_c1 3300050496 Bacteria 3177
470 nmdc:mga07m45_31799_c1 3300050496 Bacteria 2924
471 nmdc:mga07m45_3834_c1 3300050496 Bacteria 7283
472 nmdc:mga0qj67_19203_c1 3300050509 Bacteria 5220
473 nmdc:mga0qj67_41870_c1 3300050509 Bacteria 3604
474 nmdc:mga06r32_25270_c1 3300050510 Bacteria 5524
475 nmdc:mga0sz30_1947_c1 3300050516 Bacteria 7377
476 nmdc:mga0sz30_25384_c1 3300050516 Bacteria 2423
477 nmdc:mga0sz30_3718_c1 3300050516 Bacteria 3492
478 nmdc:mga0sz30_43003_c1 3300050516 Bacteria 1901
479 Ga0495601_0088025 3300053077 Bacteria 1997
480 Ga0495601_0092589 3300053077 Bacteria 1947
481 Ga0500610_0044848 3300053079 Bacteria 2295
482 Ga0500635_0041285 3300053080 Bacteria 1542
483 Ga0495655_0001845 3300053083 Bacteria 3301
484 Ga0495595_0012778 3300053084 Bacteria 3539
485 Ga0495619_0009758 3300053085 Bacteria 6052
486 Ga0500643_002159 3300053087 Bacteria 10421
487 Ga0500562_008605 3300053108 Bacteria 2579
488 Ga0500652_027115 3300053131 Bacteria 2212
489 Ga0500616_0010775 3300053153 Bacteria 5451
490 Ga0500616_0012932 3300053153 Bacteria 4864
491 Ga0500616_0036514 3300053153 Bacteria 2666
492 Ga0500627_0048065 3300053158 Bacteria 1852
493 Ga0500645_001921 3300053730 Bacteria 9881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0086148 Ga0495594_0086148_19_969 314
2 3300044683 Ga0466965_0070156 Ga0466965_0070156_23_988 317
3 3300044694 Ga0466963_0114017 Ga0466963_0114017_885_1844 317
4 3300048929 Ga0496126_0262115 Ga0496126_0262115_455_1411 317
5 3300049588 Ga0501072_0084242 Ga0501072_0084242_1485_2462 317
6 3300049742 Ga0501080_0149267 Ga0501080_0149267_55_1032 317
7 3300047321 Ga0495676_0105524 Ga0495676_0105524_23_1015 328
8 3300006048 Ga0075363_100010782 Ga0075363_1000107824 331
9 3300026067 Ga0207678_10016116 Ga0207678_100161166 331
10 3300048907 Ga0496104_0331599 Ga0496104_0331599_204_1202 331
11 3300050492 nmdc:mga0yw44_134126_c1 nmdc:mga0yw44_134126_c1_587_1585 331
12 3300037853 Ga0436364_0699238 Ga0436364_0699238_49658_50755 341
13 3300009098 Ga0105245_10277084 Ga0105245_102770842 345
14 3300046507 Ga0495606_0126080 Ga0495606_0126080_99_1142 345
15 3300048911 Ga0496108_0052180 Ga0496108_0052180_2066_3109 345
16 3300048916 Ga0496113_0036159 Ga0496113_0036159_1880_2923 345
17 3300053083 Ga0495655_0001845 Ga0495655_0001845_410_1453 345
18 3300021388 Ga0213875_10000343 Ga0213875_1000034310 348
19 3300007265 Ga0099794_10000303 Ga0099794_1000030318 349
20 3300027671 Ga0209588_1000042 Ga0209588_100004226 349
21 iso_pu_bacteria 2643221715 2644638167 349
22 3300006038 Ga0075365_10076948 Ga0075365_100769482 350
23 3300006051 Ga0075364_10018915 Ga0075364_100189154 350
24 3300006178 Ga0075367_10055848 Ga0075367_100558482 350
25 3300006186 Ga0075369_10036567 Ga0075369_100365672 350
26 3300044901 Ga0466960_0000392 Ga0466960_0000392_11927_12985 350
27 3300050490 nmdc:mga03n38_4954_c1 nmdc:mga03n38_4954_c1_857_1909 350
28 3300050491 nmdc:mga00v17_5015_c1 nmdc:mga00v17_5015_c1_2264_3316 350
29 3300050492 nmdc:mga0yw44_8485_c1 nmdc:mga0yw44_8485_c1_2017_3069 350
30 3300050493 nmdc:mga0k408_127079_c1 nmdc:mga0k408_127079_c1_365_1417 350
31 3300050496 nmdc:mga07m45_26667_c1 nmdc:mga07m45_26667_c1_984_2036 350
32 3300050516 nmdc:mga0sz30_25384_c1 nmdc:mga0sz30_25384_c1_813_1865 350
33 3300035120 Ga0373957_0014718 Ga0373957_0014718_1495_2586 352
34 3300035120 Ga0373957_0015510 Ga0373957_0015510_1163_2242 352
35 3300035172 Ga0373955_0039937 Ga0373955_0039937_1217_2296 352
36 3300035724 Ga0373933_0017097 Ga0373933_0017097_1241_2320 352
37 3300035724 Ga0373933_0048072 Ga0373933_0048072_923_2014 352
38 3300036401 Ga0373937_0007287 Ga0373937_0007287_2141_3232 352
39 3300036401 Ga0373937_0071814 Ga0373937_0071814_1461_2540 352
40 3300037068 Ga0373925_0008507 Ga0373925_0008507_3555_4646 352
41 3300046454 Ga0495592_0025999 Ga0495592_0025999_651_1730 352
42 3300046462 Ga0495651_0000590 Ga0495651_0000590_26262_27353 352
43 3300046462 Ga0495651_0002735 Ga0495651_0002735_6805_7884 352
44 3300046463 Ga0495653_0002652 Ga0495653_0002652_9132_10223 352
45 3300046477 Ga0495664_0061790 Ga0495664_0061790_1065_2144 352
46 3300046511 Ga0495608_0000880 Ga0495608_0000880_13443_14534 352
47 3300046511 Ga0495608_0000880 Ga0495608_0000880_1825_2904 352
48 3300046514 Ga0495618_0015417 Ga0495618_0015417_25_1104 352
49 3300046516 Ga0495628_0012608 Ga0495628_0012608_3681_4760 352
50 3300046516 Ga0495628_0048026 Ga0495628_0048026_2116_3207 352
51 3300046529 Ga0495652_0012547 Ga0495652_0012547_2342_3421 352
52 3300046529 Ga0495652_0032982 Ga0495652_0032982_2239_3330 352
53 3300046533 Ga0495640_0035922 Ga0495640_0035922_858_1937 352
54 3300046533 Ga0495640_0038891 Ga0495640_0038891_1525_2616 352
55 3300046536 Ga0495587_0004817 Ga0495587_0004817_4973_6064 352
56 3300046536 Ga0495587_0006296 Ga0495587_0006296_969_2048 352
57 3300046543 Ga0495645_0009087 Ga0495645_0009087_4055_5146 352
58 3300046543 Ga0495645_0070099 Ga0495645_0070099_296_1375 352
59 3300046559 Ga0495667_0000622 Ga0495667_0000622_13218_14297 352
60 3300046559 Ga0495667_0000622 Ga0495667_0000622_1588_2679 352
61 3300046663 Ga0495635_0003023 Ga0495635_0003023_2411_3490 352
62 3300046663 Ga0495635_0012790 Ga0495635_0012790_297_1388 352
63 3300046675 Ga0495657_0003443 Ga0495657_0003443_6696_7775 352
64 3300046675 Ga0495657_0008425 Ga0495657_0008425_1308_2399 352
65 3300046678 Ga0495599_0011987 Ga0495599_0011987_568_1659 352
66 3300046678 Ga0495599_0028985 Ga0495599_0028985_1614_2693 352
67 3300046679 Ga0495623_0081957 Ga0495623_0081957_408_1499 352
68 3300046680 Ga0495646_0016193 Ga0495646_0016193_2050_3129 352
69 3300046680 Ga0495646_0016439 Ga0495646_0016439_805_1896 352
70 3300046809 Ga0495600_0008639 Ga0495600_0008639_4338_5429 352
71 3300046809 Ga0495600_0014161 Ga0495600_0014161_2530_3609 352
72 3300047317 Ga0495604_0002605 Ga0495604_0002605_8851_9930 352
73 3300047317 Ga0495604_0013413 Ga0495604_0013413_1650_2741 352
74 3300047319 Ga0495674_0007557 Ga0495674_0007557_5561_6652 352
75 3300047319 Ga0495674_0207443 Ga0495674_0207443_296_1375 352
76 3300047322 Ga0495680_0004645 Ga0495680_0004645_8346_9437 352
77 3300047322 Ga0495680_0005837 Ga0495680_0005837_8255_9334 352
78 3300047471 Ga0495684_0004201 Ga0495684_0004201_5684_6775 352
79 3300048088 Ga0495602_0004450 Ga0495602_0004450_9280_10371 352
80 3300048088 Ga0495602_0014755 Ga0495602_0014755_4296_5375 352
81 3300053077 Ga0495601_0088025 Ga0495601_0088025_264_1355 352
82 3300053077 Ga0495601_0092589 Ga0495601_0092589_460_1539 352
83 3300053084 Ga0495595_0012778 Ga0495595_0012778_2262_3341 352
84 3300053085 Ga0495619_0009758 Ga0495619_0009758_3061_4140 352
85 3300021388 Ga0213875_10000662 Ga0213875_1000066210 353
86 3300037853 Ga0436364_1139754 Ga0436364_1139754_8291_9370 353
87 3300041413 Ga0439465_0053781 Ga0439465_0053781_31_1107 353
88 3300048905 Ga0496102_0000864 Ga0496102_0000864_27216_28298 353
89 3300053153 Ga0500616_0010775 Ga0500616_0010775_987_2147 354
90 iso_pu_bacteria 2738541264 2738666913 354
91 iso_pu_bacteria 2738541356 2739145757 354
92 3300025915 Ga0207693_10057967 Ga0207693_100579673 355
93 3300046459 Ga0495629_0076104 Ga0495629_0076104_1106_2188 355
94 3300046473 Ga0495582_0049667 Ga0495582_0049667_1057_2139 355
95 3300046533 Ga0495640_0015166 Ga0495640_0015166_1131_2213 355
96 3300046690 Ga0495624_0022680 Ga0495624_0022680_2509_3591 355
97 3300047315 Ga0495581_0058146 Ga0495581_0058146_1124_2206 355
98 3300047319 Ga0495674_0020275 Ga0495674_0020275_2627_3709 355
99 iso_pu_bacteria 2929212328 2929216746 355
100 3300035692 Ga0373935_0162369 Ga0373935_0162369_75_1160 356
101 3300044658 Ga0466972_0127049 Ga0466972_0127049_92_1168 356
102 3300045976 Ga0466967_0002447 Ga0466967_0002447_10044_11120 356
103 3300046517 Ga0495630_0222475 Ga0495630_0222475_195_1280 356
104 3300047673 Ga0495593_0006029 Ga0495593_0006029_5641_6726 356
105 3300003792 Ga0055540_1000003 Ga0055540_1000003192 357
106 3300009545 Ga0105237_10009594 Ga0105237_100095948 357
107 3300025303 Ga0209051_1000011 Ga0209051_1000011404 357
108 3300025914 Ga0207671_10007814 Ga0207671_100078145 357
109 3300031251 Ga0265327_10001674 Ga0265327_1000167419 357
110 iso_pu_bacteria 2547132424 2548696423 357
111 iso_pu_bacteria 2738541274 2738707883 357
112 iso_pu_bacteria 2738543028 2739334222 357
113 iso_pu_bacteria 2842134933 2842140105 357
114 iso_pu_bacteria 2902799365 2902802052 357
115 iso_pu_bacteria 2902810491 2902812043 357
116 iso_pu_bacteria 2919713450 2919713678 357
117 iso_pu_bacteria 2939582691 2939588802 357
118 3300021384 Ga0213876_10105288 Ga0213876_101052881 358
119 3300039437 Ga0436365_0358457 Ga0436365_0358457_1932_3014 358
120 3300003320 rootH2_10160637 rootH2_101606377 359
121 3300005445 Ga0070708_100192915 Ga0070708_1001929152 359
122 3300006038 Ga0075365_10079041 Ga0075365_100790412 359
123 3300006048 Ga0075363_100042785 Ga0075363_1000427852 359
124 3300046507 Ga0495606_0023526 Ga0495606_0023526_2378_3538 359
125 3300050490 nmdc:mga03n38_69919_c1 nmdc:mga03n38_69919_c1_293_1405 359
126 3300050491 nmdc:mga00v17_20971_c1 nmdc:mga00v17_20971_c1_467_1555 359
127 3300053079 Ga0500610_0044848 Ga0500610_0044848_76_1191 359
128 3300053087 Ga0500643_002159 Ga0500643_002159_6208_7395 359
129 3300053108 Ga0500562_008605 Ga0500562_008605_668_1828 359
130 3300053153 Ga0500616_0012932 Ga0500616_0012932_3258_4373 359
131 3300053153 Ga0500616_0036514 Ga0500616_0036514_641_1837 359
132 3300001989 JGI24739J22299_10013353 JGI24739J22299_100133532 360
133 3300002070 JGI24750J21931_1002268 JGI24750J21931_10022682 360
134 3300002077 JGI24744J21845_10000180 JGI24744J21845_100001807 360
135 3300002244 JGI24742J22300_10000575 JGI24742J22300_100005754 360
136 3300005328 Ga0070676_10014608 Ga0070676_100146085 360
137 3300005334 Ga0068869_100180708 Ga0068869_1001807082 360
138 3300005335 Ga0070666_10011677 Ga0070666_100116775 360
139 3300005335 Ga0070666_10106181 Ga0070666_101061812 360
140 3300005336 Ga0070680_100057860 Ga0070680_1000578602 360
141 3300005337 Ga0070682_100007655 Ga0070682_1000076553 360
142 3300005337 Ga0070682_100037772 Ga0070682_1000377722 360
143 3300005338 Ga0068868_100001175 Ga0068868_1000011751 360
144 3300005341 Ga0070691_10002313 Ga0070691_100023139 360
145 3300005347 Ga0070668_100001742 Ga0070668_10000174212 360
146 3300005353 Ga0070669_100001809 Ga0070669_1000018092 360
147 3300005356 Ga0070674_100000563 Ga0070674_10000056315 360
148 3300005356 Ga0070674_100049353 Ga0070674_1000493531 360
149 3300005367 Ga0070667_100000073 Ga0070667_10000007341 360
150 3300005367 Ga0070667_100062030 Ga0070667_1000620302 360
151 3300005434 Ga0070709_10018712 Ga0070709_100187123 360
152 3300005435 Ga0070714_100031650 Ga0070714_1000316503 360
153 3300005437 Ga0070710_10002470 Ga0070710_100024703 360
154 3300005438 Ga0070701_10003417 Ga0070701_100034177 360
155 3300005438 Ga0070701_10048857 Ga0070701_100488572 360
156 3300005439 Ga0070711_100007402 Ga0070711_1000074022 360
157 3300005440 Ga0070705_100028093 Ga0070705_1000280933 360
158 3300005441 Ga0070700_100005048 Ga0070700_1000050482 360
159 3300005444 Ga0070694_100001137 Ga0070694_10000113710 360
160 3300005455 Ga0070663_100058991 Ga0070663_1000589911 360
161 3300005456 Ga0070678_100000818 Ga0070678_10000081811 360
162 3300005456 Ga0070678_100035775 Ga0070678_1000357754 360
163 3300005459 Ga0068867_100000117 Ga0068867_10000011743 360
164 3300005459 Ga0068867_100147539 Ga0068867_1001475392 360
165 3300005539 Ga0068853_100009645 Ga0068853_1000096452 360
166 3300005543 Ga0070672_100371458 Ga0070672_1003714582 360
167 3300005544 Ga0070686_100041787 Ga0070686_1000417872 360
168 3300005545 Ga0070695_100032255 Ga0070695_1000322552 360
169 3300005546 Ga0070696_100118571 Ga0070696_1001185711 360
170 3300005547 Ga0070693_100014078 Ga0070693_1000140782 360
171 3300005548 Ga0070665_100004662 Ga0070665_1000046625 360
172 3300005548 Ga0070665_100007819 Ga0070665_10000781910 360
173 3300005548 Ga0070665_100027864 Ga0070665_1000278644 360
174 3300005548 Ga0070665_100057588 Ga0070665_1000575884 360
175 3300005549 Ga0070704_100000959 Ga0070704_1000009595 360
176 3300005563 Ga0068855_100056941 Ga0068855_1000569413 360
177 3300005578 Ga0068854_100014007 Ga0068854_1000140072 360
178 3300005614 Ga0068856_100145730 Ga0068856_1001457302 360
179 3300005615 Ga0070702_100000286 Ga0070702_1000002869 360
180 3300005617 Ga0068859_100000223 Ga0068859_10000022339 360
181 3300005617 Ga0068859_100370634 Ga0068859_1003706342 360
182 3300005718 Ga0068866_10000573 Ga0068866_100005736 360
183 3300005719 Ga0068861_100000507 Ga0068861_10000050717 360
184 3300005719 Ga0068861_100275739 Ga0068861_1002757392 360
185 3300005841 Ga0068863_100013142 Ga0068863_1000131423 360
186 3300005841 Ga0068863_100253354 Ga0068863_1002533542 360
187 3300005842 Ga0068858_100004229 Ga0068858_10000422916 360
188 3300005842 Ga0068858_100049003 Ga0068858_1000490031 360
189 3300005842 Ga0068858_100075530 Ga0068858_1000755302 360
190 3300005843 Ga0068860_100000127 Ga0068860_10000012742 360
191 3300005843 Ga0068860_100008369 Ga0068860_10000836911 360
192 3300005843 Ga0068860_100105074 Ga0068860_1001050743 360
193 3300005844 Ga0068862_100000052 Ga0068862_10000005299 360
194 3300005844 Ga0068862_100005541 Ga0068862_10000554111 360
195 3300005937 Ga0081455_10016795 Ga0081455_100167953 360
196 3300005937 Ga0081455_10039911 Ga0081455_100399112 360
197 3300005981 Ga0081538_10086601 Ga0081538_100866012 360
198 3300006038 Ga0075365_10015394 Ga0075365_100153944 360
199 3300006038 Ga0075365_10040188 Ga0075365_100401884 360
200 3300006038 Ga0075365_10053414 Ga0075365_100534141 360
201 3300006038 Ga0075365_10055595 Ga0075365_100555952 360
202 3300006038 Ga0075365_10146342 Ga0075365_101463421 360
203 3300006042 Ga0075368_10015566 Ga0075368_100155663 360
204 3300006042 Ga0075368_10030902 Ga0075368_100309022 360
205 3300006042 Ga0075368_10073154 Ga0075368_100731541 360
206 3300006048 Ga0075363_100002313 Ga0075363_1000023134 360
207 3300006048 Ga0075363_100014427 Ga0075363_1000144272 360
208 3300006048 Ga0075363_100023969 Ga0075363_1000239692 360
209 3300006048 Ga0075363_100034064 Ga0075363_1000340642 360
210 3300006051 Ga0075364_10000962 Ga0075364_100009622 360
211 3300006051 Ga0075364_10001660 Ga0075364_1000166012 360
212 3300006051 Ga0075364_10002949 Ga0075364_100029496 360
213 3300006051 Ga0075364_10038825 Ga0075364_100388252 360
214 3300006051 Ga0075364_10055791 Ga0075364_100557912 360
215 3300006051 Ga0075364_10108537 Ga0075364_101085372 360
216 3300006163 Ga0070715_10002319 Ga0070715_100023195 360
217 3300006173 Ga0070716_100004074 Ga0070716_1000040745 360
218 3300006175 Ga0070712_100007624 Ga0070712_1000076242 360
219 3300006177 Ga0075362_10000670 Ga0075362_1000067011 360
220 3300006177 Ga0075362_10004906 Ga0075362_100049063 360
221 3300006178 Ga0075367_10002030 Ga0075367_100020306 360
222 3300006178 Ga0075367_10010474 Ga0075367_100104744 360
223 3300006178 Ga0075367_10068700 Ga0075367_100687002 360
224 3300006186 Ga0075369_10001469 Ga0075369_100014692 360
225 3300006186 Ga0075369_10002827 Ga0075369_100028275 360
226 3300006186 Ga0075369_10003742 Ga0075369_100037422 360
227 3300006186 Ga0075369_10012879 Ga0075369_100128792 360
228 3300006186 Ga0075369_10019335 Ga0075369_100193352 360
229 3300006186 Ga0075369_10019835 Ga0075369_100198351 360
230 3300006186 Ga0075369_10034016 Ga0075369_100340162 360
231 3300006186 Ga0075369_10058209 Ga0075369_100582092 360
232 3300006353 Ga0075370_10003723 Ga0075370_100037236 360
233 3300006353 Ga0075370_10004100 Ga0075370_100041004 360
234 3300006353 Ga0075370_10004505 Ga0075370_100045055 360
235 3300006353 Ga0075370_10018937 Ga0075370_100189373 360
236 3300006844 Ga0075428_100000149 Ga0075428_10000014921 360
237 3300006846 Ga0075430_100023965 Ga0075430_1000239651 360
238 3300006846 Ga0075430_100035595 Ga0075430_1000355952 360
239 3300006847 Ga0075431_100047161 Ga0075431_1000471612 360
240 3300006881 Ga0068865_100003324 Ga0068865_1000033244 360
241 3300006931 Ga0097620_100000223 Ga0097620_10000022339 360
242 3300006931 Ga0097620_100370601 Ga0097620_1003706012 360
243 3300009092 Ga0105250_10029416 Ga0105250_100294161 360
244 3300009098 Ga0105245_10001561 Ga0105245_1000156124 360
245 3300009101 Ga0105247_10000066 Ga0105247_1000006673 360
246 3300009101 Ga0105247_10005316 Ga0105247_100053166 360
247 3300009101 Ga0105247_10083984 Ga0105247_100839841 360
248 3300009148 Ga0105243_10002003 Ga0105243_1000200313 360
249 3300009174 Ga0105241_10038409 Ga0105241_100384092 360
250 3300009176 Ga0105242_10000979 Ga0105242_1000097910 360
251 3300009177 Ga0105248_10000613 Ga0105248_1000061342 360
252 3300009177 Ga0105248_10006306 Ga0105248_1000630611 360
253 3300009545 Ga0105237_10132757 Ga0105237_101327572 360
254 3300009551 Ga0105238_10129573 Ga0105238_101295732 360
255 3300009553 Ga0105249_10000093 Ga0105249_1000009374 360
256 3300009553 Ga0105249_10001158 Ga0105249_1000115817 360
257 3300009553 Ga0105249_10115490 Ga0105249_101154901 360
258 3300010375 Ga0105239_10080472 Ga0105239_100804723 360
259 3300010375 Ga0105239_10089083 Ga0105239_100890833 360
260 3300011119 Ga0105246_10146180 Ga0105246_101461802 360
261 3300013296 Ga0157374_10027347 Ga0157374_100273472 360
262 3300013297 Ga0157378_10002180 Ga0157378_1000218011 360
263 3300013306 Ga0163162_10008719 Ga0163162_100087193 360
264 3300013306 Ga0163162_10017001 Ga0163162_100170011 360
265 3300013306 Ga0163162_10065636 Ga0163162_100656363 360
266 3300013307 Ga0157372_10015293 Ga0157372_100152932 360
267 3300013308 Ga0157375_10000151 Ga0157375_1000015164 360
268 3300013308 Ga0157375_10053182 Ga0157375_100531823 360
269 3300013308 Ga0157375_10183666 Ga0157375_101836662 360
270 3300014325 Ga0163163_10012823 Ga0163163_100128233 360
271 3300014325 Ga0163163_10069042 Ga0163163_100690423 360
272 3300014326 Ga0157380_10002064 Ga0157380_100020642 360
273 3300014968 Ga0157379_10006897 Ga0157379_100068973 360
274 3300014969 Ga0157376_10070053 Ga0157376_100700532 360
275 3300017792 Ga0163161_10002439 Ga0163161_100024397 360
276 3300017792 Ga0163161_10040431 Ga0163161_100404313 360
277 3300021384 Ga0213876_10000674 Ga0213876_1000067410 360
278 3300021384 Ga0213876_10018017 Ga0213876_100180172 360
279 3300025898 Ga0207692_10020690 Ga0207692_100206903 360
280 3300025899 Ga0207642_10067890 Ga0207642_100678902 360
281 3300025900 Ga0207710_10000090 Ga0207710_1000009073 360
282 3300025900 Ga0207710_10004078 Ga0207710_100040784 360
283 3300025901 Ga0207688_10000025 Ga0207688_1000002543 360
284 3300025901 Ga0207688_10002628 Ga0207688_100026286 360
285 3300025903 Ga0207680_10004479 Ga0207680_100044795 360
286 3300025904 Ga0207647_10027565 Ga0207647_100275653 360
287 3300025904 Ga0207647_10129397 Ga0207647_101293971 360
288 3300025905 Ga0207685_10001272 Ga0207685_100012724 360
289 3300025906 Ga0207699_10013198 Ga0207699_100131983 360
290 3300025911 Ga0207654_10021827 Ga0207654_100218273 360
291 3300025915 Ga0207693_10000123 Ga0207693_1000012347 360
292 3300025916 Ga0207663_10003682 Ga0207663_100036822 360
293 3300025923 Ga0207681_10000925 Ga0207681_1000092518 360
294 3300025924 Ga0207694_10187397 Ga0207694_101873972 360
295 3300025927 Ga0207687_10001927 Ga0207687_1000192711 360
296 3300025929 Ga0207664_10047136 Ga0207664_100471361 360
297 3300025929 Ga0207664_10064198 Ga0207664_100641982 360
298 3300025931 Ga0207644_10027020 Ga0207644_100270203 360
299 3300025933 Ga0207706_10005323 Ga0207706_100053237 360
300 3300025934 Ga0207686_10001243 Ga0207686_100012434 360
301 3300025936 Ga0207670_10012335 Ga0207670_100123354 360
302 3300025937 Ga0207669_10000400 Ga0207669_100004006 360
303 3300025937 Ga0207669_10034672 Ga0207669_100346721 360
304 3300025938 Ga0207704_10000325 Ga0207704_1000032512 360
305 3300025939 Ga0207665_10009980 Ga0207665_100099802 360
306 3300025939 Ga0207665_10085366 Ga0207665_100853662 360
307 3300025941 Ga0207711_10000183 Ga0207711_1000018342 360
308 3300025941 Ga0207711_10021248 Ga0207711_100212481 360
309 3300025942 Ga0207689_10187813 Ga0207689_101878132 360
310 3300025949 Ga0207667_10161488 Ga0207667_101614882 360
311 3300025961 Ga0207712_10000073 Ga0207712_1000007374 360
312 3300025961 Ga0207712_10009651 Ga0207712_100096513 360
313 3300025961 Ga0207712_10029629 Ga0207712_100296294 360
314 3300025972 Ga0207668_10007261 Ga0207668_100072616 360
315 3300025981 Ga0207640_10000582 Ga0207640_1000058215 360
316 3300025986 Ga0207658_10000304 Ga0207658_1000030443 360
317 3300025986 Ga0207658_10007427 Ga0207658_100074271 360
318 3300025986 Ga0207658_10007945 Ga0207658_100079454 360
319 3300026023 Ga0207677_10020279 Ga0207677_100202792 360
320 3300026023 Ga0207677_10384402 Ga0207677_103844021 360
321 3300026035 Ga0207703_10005604 Ga0207703_100056045 360
322 3300026035 Ga0207703_10025031 Ga0207703_100250314 360
323 3300026041 Ga0207639_10006443 Ga0207639_100064432 360
324 3300026067 Ga0207678_10006722 Ga0207678_100067222 360
325 3300026075 Ga0207708_10003189 Ga0207708_100031894 360
326 3300026078 Ga0207702_10108904 Ga0207702_101089043 360
327 3300026088 Ga0207641_10000413 Ga0207641_1000041327 360
328 3300026088 Ga0207641_10008652 Ga0207641_100086523 360
329 3300026089 Ga0207648_10000381 Ga0207648_1000038112 360
330 3300026118 Ga0207675_100000406 Ga0207675_1000004063 360
331 3300026118 Ga0207675_100087516 Ga0207675_1000875163 360
332 3300026118 Ga0207675_100249396 Ga0207675_1002493962 360
333 3300026121 Ga0207683_10001482 Ga0207683_1000148215 360
334 3300026121 Ga0207683_10037569 Ga0207683_100375692 360
335 3300027866 Ga0209813_10018918 Ga0209813_100189181 360
336 3300028379 Ga0268266_10007875 Ga0268266_100078752 360
337 3300028379 Ga0268266_10037098 Ga0268266_100370982 360
338 3300028379 Ga0268266_10043785 Ga0268266_100437854 360
339 3300028379 Ga0268266_10073545 Ga0268266_100735453 360
340 3300028379 Ga0268266_10324998 Ga0268266_103249981 360
341 3300028380 Ga0268265_10000063 Ga0268265_1000006399 360
342 3300028380 Ga0268265_10009020 Ga0268265_100090202 360
343 3300028380 Ga0268265_10106804 Ga0268265_101068042 360
344 3300028381 Ga0268264_10000007 Ga0268264_1000000742 360
345 3300028381 Ga0268264_10041265 Ga0268264_100412654 360
346 3300028381 Ga0268264_10347265 Ga0268264_103472651 360
347 3300028381 Ga0268264_10435899 Ga0268264_104358991 360
348 3300028381 Ga0268264_10436140 Ga0268264_104361401 360
349 3300031824 Ga0307413_10049747 Ga0307413_100497471 360
350 3300031824 Ga0307413_10120846 Ga0307413_101208462 360
351 3300031995 Ga0307409_100020812 Ga0307409_1000208124 360
352 3300035112 Ga0373932_0018165 Ga0373932_0018165_516_1598 360
353 3300036647 Ga0316582_0036483 Ga0316582_0036483_1828_2976 360
354 3300037853 Ga0436364_0601748 Ga0436364_0601748_1302_2393 360
355 3300037853 Ga0436364_0694490 Ga0436364_0694490_2476_3567 360
356 3300039437 Ga0436365_0016980 Ga0436365_0016980_14351_15451 360
357 3300039437 Ga0436365_0119240 Ga0436365_0119240_2464_3555 360
358 3300039437 Ga0436365_0731445 Ga0436365_0731445_6943_8034 360
359 3300039450 Ga0436363_0434666 Ga0436363_0434666_265_1356 360
360 3300041410 Ga0439461_0000107 Ga0439461_0000107_4415_5581 360
361 3300041413 Ga0439465_0001090 Ga0439465_0001090_210_1319 360
362 3300041413 Ga0439465_0003041 Ga0439465_0003041_440_1525 360
363 3300041413 Ga0439465_0003488 Ga0439465_0003488_2568_3734 360
364 3300041413 Ga0439465_0048605 Ga0439465_0048605_146_1231 360
365 3300041997 Ga0439431_0000641 Ga0439431_0000641_2518_3684 360
366 3300042004 Ga0439445_0007068 Ga0439445_0007068_1283_2449 360
367 3300044658 Ga0466972_0020727 Ga0466972_0020727_100_1209 360
368 3300044658 Ga0466972_0025007 Ga0466972_0025007_1676_2794 360
369 3300044658 Ga0466972_0043477 Ga0466972_0043477_206_1291 360
370 3300044683 Ga0466965_0000284 Ga0466965_0000284_15538_16647 360
371 3300044684 Ga0466966_0002603 Ga0466966_0002603_244_1332 360
372 3300044684 Ga0466966_0091999 Ga0466966_0091999_517_1602 360
373 3300044693 Ga0466961_0012955 Ga0466961_0012955_3828_4913 360
374 3300044694 Ga0466963_0042681 Ga0466963_0042681_1179_2279 360
375 3300044719 Ga0466971_0105090 Ga0466971_0105090_70_1161 360
376 3300044735 Ga0466968_0001326 Ga0466968_0001326_5221_6330 360
377 3300044735 Ga0466968_0035224 Ga0466968_0035224_271_1362 360
378 3300044765 Ga0466970_0048442 Ga0466970_0048442_366_1457 360
379 3300044765 Ga0466970_0050179 Ga0466970_0050179_716_1801 360
380 3300044765 Ga0466970_0052219 Ga0466970_0052219_31_1113 360
381 3300044765 Ga0466970_0094258 Ga0466970_0094258_425_1534 360
382 3300044842 Ga0466957_0005427 Ga0466957_0005427_1324_2433 360
383 3300044842 Ga0466957_0007638 Ga0466957_0007638_1937_3037 360
384 3300044842 Ga0466957_0164217 Ga0466957_0164217_131_1219 360
385 3300044901 Ga0466960_0000796 Ga0466960_0000796_1676_2794 360
386 3300044901 Ga0466960_0001519 Ga0466960_0001519_5893_7002 360
387 3300045049 Ga0466959_0001756 Ga0466959_0001756_10125_11234 360
388 3300045049 Ga0466959_0057757 Ga0466959_0057757_12_1094 360
389 3300045049 Ga0466959_0060609 Ga0466959_0060609_205_1296 360
390 3300045049 Ga0466959_0137792 Ga0466959_0137792_205_1290 360
391 3300045836 Ga0466958_0003235 Ga0466958_0003235_389_1480 360
392 3300045836 Ga0466958_0020386 Ga0466958_0020386_993_2093 360
393 3300045836 Ga0466958_0061117 Ga0466958_0061117_1093_2202 360
394 3300045976 Ga0466967_0002855 Ga0466967_0002855_689_1777 360
395 3300045976 Ga0466967_0005640 Ga0466967_0005640_7389_8489 360
396 3300045976 Ga0466967_0015951 Ga0466967_0015951_1555_2664 360
397 3300045976 Ga0466967_0024162 Ga0466967_0024162_1144_2244 360
398 3300045976 Ga0466967_0064489 Ga0466967_0064489_1652_2743 360
399 3300045976 Ga0466967_0065526 Ga0466967_0065526_1383_2477 360
400 3300046460 Ga0495638_0011379 Ga0495638_0011379_846_1946 360
401 3300047472 Ga0495686_0000940 Ga0495686_0000940_14821_15924 360
402 3300048903 Ga0496100_0000402 Ga0496100_0000402_11345_12448 360
403 3300048903 Ga0496100_0006024 Ga0496100_0006024_4906_5988 360
404 3300048903 Ga0496100_0006694 Ga0496100_0006694_495_1607 360
405 3300048904 Ga0496101_0011673 Ga0496101_0011673_2942_4024 360
406 3300048904 Ga0496101_0120804 Ga0496101_0120804_601_1695 360
407 3300048905 Ga0496102_0000168 Ga0496102_0000168_35182_36294 360
408 3300048905 Ga0496102_0002086 Ga0496102_0002086_7146_8228 360
409 3300048905 Ga0496102_0071212 Ga0496102_0071212_1281_2375 360
410 3300048906 Ga0496103_0000991 Ga0496103_0000991_5549_6631 360
411 3300048906 Ga0496103_0077152 Ga0496103_0077152_465_1559 360
412 3300048906 Ga0496103_0092173 Ga0496103_0092173_726_1838 360
413 3300048906 Ga0496103_0123123 Ga0496103_0123123_175_1296 360
414 3300048907 Ga0496104_0001086 Ga0496104_0001086_6050_7153 360
415 3300048907 Ga0496104_0092470 Ga0496104_0092470_932_2026 360
416 3300048908 Ga0496105_0016435 Ga0496105_0016435_4128_5231 360
417 3300048909 Ga0496106_0001129 Ga0496106_0001129_4906_5988 360
418 3300048909 Ga0496106_0008362 Ga0496106_0008362_6030_7133 360
419 3300048910 Ga0496107_0000495 Ga0496107_0000495_4458_5540 360
420 3300048910 Ga0496107_0002465 Ga0496107_0002465_10493_11596 360
421 3300048911 Ga0496108_0001316 Ga0496108_0001316_10602_11687 360
422 3300048911 Ga0496108_0084331 Ga0496108_0084331_853_1938 360
423 3300048912 Ga0496109_0004469 Ga0496109_0004469_4585_5670 360
424 3300048912 Ga0496109_0016007 Ga0496109_0016007_1533_2618 360
425 3300048912 Ga0496109_0090243 Ga0496109_0090243_17_1138 360
426 3300048913 Ga0496110_0029838 Ga0496110_0029838_454_1548 360
427 3300048915 Ga0496112_0009696 Ga0496112_0009696_1565_2650 360
428 3300048915 Ga0496112_0010535 Ga0496112_0010535_4138_5247 360
429 3300048916 Ga0496113_0022204 Ga0496113_0022204_1596_2681 360
430 3300048916 Ga0496113_0092681 Ga0496113_0092681_1077_2186 360
431 3300048917 Ga0496114_0000419 Ga0496114_0000419_349_1431 360
432 3300048917 Ga0496114_0020778 Ga0496114_0020778_2509_3612 360
433 3300048918 Ga0496115_0007528 Ga0496115_0007528_6817_7920 360
434 3300048918 Ga0496115_0016628 Ga0496115_0016628_892_1974 360
435 3300048919 Ga0496116_0015907 Ga0496116_0015907_3086_4198 360
436 3300048920 Ga0496117_0008185 Ga0496117_0008185_3086_4198 360
437 3300048921 Ga0496118_0000171 Ga0496118_0000171_17730_18842 360
438 3300048921 Ga0496118_0000185 Ga0496118_0000185_27427_28518 360
439 3300048922 Ga0496119_0003283 Ga0496119_0003283_11742_12854 360
440 3300048923 Ga0496120_0026953 Ga0496120_0026953_1649_2749 360
441 3300048924 Ga0496121_0013914 Ga0496121_0013914_2377_3489 360
442 3300048925 Ga0496122_0089837 Ga0496122_0089837_301_1410 360
443 3300048926 Ga0496123_0001928 Ga0496123_0001928_1156_2265 360
444 3300048927 Ga0496124_0128677 Ga0496124_0128677_208_1320 360
445 3300048928 Ga0496125_0028692 Ga0496125_0028692_3561_4673 360
446 3300048929 Ga0496126_0004133 Ga0496126_0004133_9004_10104 360
447 3300048929 Ga0496126_0018436 Ga0496126_0018436_346_1458 360
448 3300048929 Ga0496126_0045573 Ga0496126_0045573_2293_3402 360
449 3300048929 Ga0496126_0216833 Ga0496126_0216833_51_1151 360
450 3300049569 Ga0501032_0000510 Ga0501032_0000510_24936_26033 360
451 3300049569 Ga0501032_0044287 Ga0501032_0044287_1527_2618 360
452 3300049570 Ga0501033_0006101 Ga0501033_0006101_6886_7977 360
453 3300049571 Ga0501034_0001987 Ga0501034_0001987_8103_9203 360
454 3300049571 Ga0501034_0005475 Ga0501034_0005475_7469_8566 360
455 3300049571 Ga0501034_0048527 Ga0501034_0048527_1295_2380 360
456 3300049571 Ga0501034_0073381 Ga0501034_0073381_547_1638 360
457 3300049572 Ga0501036_0002002 Ga0501036_0002002_249_1346 360
458 3300049573 Ga0501037_0000677 Ga0501037_0000677_19474_20571 360
459 3300049575 Ga0501039_0000157 Ga0501039_0000157_25996_27093 360
460 3300049579 Ga0501043_0000971 Ga0501043_0000971_21287_22384 360
461 3300049580 Ga0501046_0004078 Ga0501046_0004078_267_1367 360
462 3300049581 Ga0501047_0001180 Ga0501047_0001180_10979_12079 360
463 3300049581 Ga0501047_0066724 Ga0501047_0066724_2338_3435 360
464 3300049582 Ga0501048_0003008 Ga0501048_0003008_8366_9466 360
465 3300049585 Ga0501069_0025801 Ga0501069_0025801_94_1185 360
466 3300049585 Ga0501069_0045024 Ga0501069_0045024_763_1854 360
467 3300049586 Ga0501070_0001412 Ga0501070_0001412_19565_20662 360
468 3300049586 Ga0501070_0001918 Ga0501070_0001918_10322_11422 360
469 3300049586 Ga0501070_0010177 Ga0501070_0010177_1637_2839 360
470 3300049593 Ga0501077_0058547 Ga0501077_0058547_648_1745 360
471 3300049742 Ga0501080_0110568 Ga0501080_0110568_444_1607 360
472 3300049822 Ga0501035_0000385 Ga0501035_0000385_8571_9662 360
473 3300049822 Ga0501035_0006567 Ga0501035_0006567_2014_3114 360
474 3300049822 Ga0501035_0069948 Ga0501035_0069948_1069_2169 360
475 3300049823 Ga0501044_0003392 Ga0501044_0003392_1728_2819 360
476 3300049823 Ga0501044_0012366 Ga0501044_0012366_7108_8205 360
477 3300049823 Ga0501044_0043642 Ga0501044_0043642_832_1932 360
478 3300050489 nmdc:mga03683_14619_c1 nmdc:mga03683_14619_c1_537_1622 360
479 3300050490 nmdc:mga03n38_77469_c1 nmdc:mga03n38_77469_c1_50_1135 360
480 3300050490 nmdc:mga03n38_920_c1 nmdc:mga03n38_920_c1_1502_2668 360
481 3300050491 nmdc:mga00v17_1224_c1 nmdc:mga00v17_1224_c1_5386_6486 360
482 3300050491 nmdc:mga00v17_22120_c1 nmdc:mga00v17_22120_c1_213_1298 360
483 3300050491 nmdc:mga00v17_260_c1 nmdc:mga00v17_260_c1_1702_2826 360
484 3300050491 nmdc:mga00v17_32303_c1 nmdc:mga00v17_32303_c1_1799_2911 360
485 3300050491 nmdc:mga00v17_5384_c1 nmdc:mga00v17_5384_c1_1174_2268 360
486 3300050492 nmdc:mga0yw44_16098_c1 nmdc:mga0yw44_16098_c1_880_2046 360
487 3300050492 nmdc:mga0yw44_6445_c1 nmdc:mga0yw44_6445_c1_2211_3305 360
488 3300050492 nmdc:mga0yw44_7990_c1 nmdc:mga0yw44_7990_c1_1081_2214 360
489 3300050492 nmdc:mga0yw44_9040_c1 nmdc:mga0yw44_9040_c1_3180_4265 360
490 3300050493 nmdc:mga0k408_31031_c1 nmdc:mga0k408_31031_c1_1284_2378 360
491 3300050494 nmdc:mga06z11_17692_c1 nmdc:mga06z11_17692_c1_991_2085 360
492 3300050494 nmdc:mga06z11_1917_c1 nmdc:mga06z11_1917_c1_2566_3732 360
493 3300050495 nmdc:mga04h51_39000_c1 nmdc:mga04h51_39000_c1_227_1321 360
494 3300050495 nmdc:mga04h51_7764_c1 nmdc:mga04h51_7764_c1_1564_2730 360
495 3300050496 nmdc:mga07m45_2038_c1 nmdc:mga07m45_2038_c1_5633_6799 360
496 3300050496 nmdc:mga07m45_31799_c1 nmdc:mga07m45_31799_c1_1328_2449 360
497 3300050496 nmdc:mga07m45_3834_c1 nmdc:mga07m45_3834_c1_3129_4229 360
498 3300050509 nmdc:mga0qj67_19203_c1 nmdc:mga0qj67_19203_c1_3889_4974 360
499 3300050509 nmdc:mga0qj67_41870_c1 nmdc:mga0qj67_41870_c1_1823_2911 360
500 3300050510 nmdc:mga06r32_25270_c1 nmdc:mga06r32_25270_c1_2140_3225 360
501 3300050516 nmdc:mga0sz30_1947_c1 nmdc:mga0sz30_1947_c1_4616_5701 360
502 3300050516 nmdc:mga0sz30_3718_c1 nmdc:mga0sz30_3718_c1_223_1389 360
503 3300050516 nmdc:mga0sz30_43003_c1 nmdc:mga0sz30_43003_c1_163_1257 360
504 3300053080 Ga0500635_0041285 Ga0500635_0041285_66_1166 360
505 3300053131 Ga0500652_027115 Ga0500652_027115_923_2023 360
506 3300053158 Ga0500627_0048065 Ga0500627_0048065_190_1290 360
507 3300053730 Ga0500645_001921 Ga0500645_001921_1017_2117 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

50

391

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m1w-assembly1.cif.gz_A structure of the 2-aminoisobutyric acid monooxygenase hydroxylase 0.749 8 353
6m1w-assembly1.cif.gz_B-2 structure of the 2-aminoisobutyric acid monooxygenase hydroxylase 0.7384 7 352
8fun-assembly1.cif.gz_D enzymatically active, mn/fe metallated form of aibh1h2 0.7367 7 352
6m1w-assembly1.cif.gz_A structure of the 2-aminoisobutyric acid monooxygenase hydroxylase 0.7319 8 353
6m2i-assembly1.cif.gz_B-2 structure of the 2-aminoisobutyric acid monooxygenase hydroxylase 0.7269 7 352
ID Description Score Start End Superfamily
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6795 11 351 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6754 11 351 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6707 8 352 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6695 8 351 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6689 8 352 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A527G2G5-F1-model_v4 Amidohydrolase 0.9024 93 200 GO:0016787
AF-A0A6M6JQ74-F1-model_v4 Amidohydrolase family protein 0.878 54 175 GO:0016787
AF-A0A2S8M7J4-F1-model_v4 deleted 0.865 3 166
AF-A0A527G2G5-F1-model_v4 Amidohydrolase 0.8634 93 200 GO:0016787
AF-A0A1E8Q377-F1-model_v4 Amidohydrolase 0.8429 7 360 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
78.91 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map