F456743

General Info

Members Datasets Scaffolds Average Seq Length
507 278 503 256

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0413143|Ga0496113_0413143_58_996
Length 312
Sequence VLGKTEALPGIQHGERTMVAIAPLAGAPAKQFRDIRPVIDSQEAGPYAALALRRIDLMHDRIVAVPTPAGEMETFVTHPEEGGPFPAVVIYMDFWGVREELFDIARRVGTVGYYCMVPDLYYRQGRVRNEWRNENNEMISMHRLDPERQRQALIPLENLSNAMVIEDTGALIDFLDRGEPVRAGGIGSIGYCMGGRHVLCVAGAYPEHFIAGASLHGTMLVSDRDDSPHLLAHRFRGELYFGFAEHDPHAPPAMVEELGALLAKCPVRYRYELHAGAEHGYALPNRDIYDKRAANRDWELIFAMFRRQIPPP

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 10.26
Rhizosphere 84.22
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003131 3300001976 Unclassified 2183
2 JGI24747J21853_1013704 3300001978 Unclassified 838
3 JGI24743J22301_10008697 3300001991 Unclassified 1786
4 JGI24750J21931_1004677 3300002070 Unclassified 1663
5 JGI24034J26672_10003250 3300002239 Unclassified 2264
6 Ga0070676_10029262 3300005328 Unclassified 3133
7 Ga0070690_100016011 3300005330 Unclassified 4483
8 Ga0070690_100356460 3300005330 Bacteria 1063
9 Ga0070670_100005964 3300005331 Bacteria 10307
10 Ga0070677_10146279 3300005333 Bacteria 1095
11 Ga0070666_10111196 3300005335 Bacteria 1894
12 Ga0070680_100046695 3300005336 Bacteria 3524
13 Ga0070682_100006111 3300005337 Bacteria 6742
14 Ga0070682_100077404 3300005337 Bacteria 2143
15 Ga0070682_100440330 3300005337 Bacteria 995
16 Ga0068868_100014070 3300005338 Bacteria 5889
17 Ga0068868_100027512 3300005338 Bacteria 4339
18 Ga0070689_100032625 3300005340 Unclassified 3962
19 Ga0070689_100039090 3300005340 Bacteria 3632
20 Ga0070689_100426959 3300005340 Bacteria 1124
21 Ga0070687_100094817 3300005343 Bacteria 1658
22 Ga0070687_100210241 3300005343 Unclassified 1185
23 Ga0070687_100304475 3300005343 Bacteria 1012
24 Ga0070692_10286153 3300005345 Bacteria 1001
25 Ga0070668_100031803 3300005347 Unclassified 4015
26 Ga0070669_100122197 3300005353 Bacteria 1988
27 Ga0070669_100224569 3300005353 Bacteria 1486
28 Ga0070675_100051374 3300005354 Unclassified 3387
29 Ga0070675_100051398 3300005354 Bacteria 3387
30 Ga0070675_100098107 3300005354 Bacteria 2464
31 Ga0070671_100030852 3300005355 Unclassified 4424
32 Ga0070671_100059201 3300005355 Bacteria 3188
33 Ga0070671_100068038 3300005355 Bacteria 2970
34 Ga0070671_100507151 3300005355 Unclassified 1038
35 Ga0070674_100025972 3300005356 Bacteria 3819
36 Ga0070674_100029527 3300005356 Unclassified 3613
37 Ga0070674_100030034 3300005356 Bacteria 3588
38 Ga0070673_100431706 3300005364 Bacteria 1182
39 Ga0070688_100009165 3300005365 Bacteria 5399
40 Ga0070688_100050385 3300005365 Unclassified 2594
41 Ga0070659_100036000 3300005366 Bacteria 3857
42 Ga0070659_100144925 3300005366 Bacteria 1935
43 Ga0070667_100079454 3300005367 Unclassified 2804
44 Ga0070667_100350864 3300005367 Unclassified 1336
45 Ga0070709_10013833 3300005434 Unclassified 4548
46 Ga0070709_10053677 3300005434 Unclassified 2539
47 Ga0070714_100054269 3300005435 Unclassified 3423
48 Ga0070713_100033784 3300005436 Unclassified 4101
49 Ga0070713_100060713 3300005436 Unclassified 3161
50 Ga0070710_10121693 3300005437 Unclassified 1581
51 Ga0070710_10166138 3300005437 Bacteria 1372
52 Ga0070711_100116176 3300005439 Bacteria 1971
53 Ga0070705_100138215 3300005440 Unclassified 1600
54 Ga0070700_100066376 3300005441 Bacteria 2290
55 Ga0070700_100296853 3300005441 Bacteria 1178
56 Ga0070694_100107485 3300005444 Bacteria 1983
57 Ga0070708_100176671 3300005445 Bacteria 1995
58 Ga0070663_100012277 3300005455 Bacteria 5413
59 Ga0070678_100019467 3300005456 Bacteria 4426
60 Ga0070662_100186268 3300005457 Bacteria 1639
61 Ga0070662_100706589 3300005457 Unclassified 853
62 Ga0070681_10019517 3300005458 Bacteria 6787
63 Ga0070681_10174241 3300005458 Bacteria 2073
64 Ga0070681_10488844 3300005458 Unclassified 1144
65 Ga0068867_100060641 3300005459 Unclassified 2807
66 Ga0068867_100115108 3300005459 Bacteria 2071
67 Ga0070685_10024929 3300005466 Unclassified 3289
68 Ga0070706_100367550 3300005467 Bacteria 1340
69 Ga0070699_100176629 3300005518 Bacteria 1894
70 Ga0070679_100020665 3300005530 Bacteria 6421
71 Ga0070679_100042330 3300005530 Bacteria 4535
72 Ga0070679_100298905 3300005530 Bacteria 1560
73 Ga0070684_100200479 3300005535 Unclassified 1817
74 Ga0070684_100316342 3300005535 Bacteria 1433
75 Ga0068853_100158660 3300005539 Bacteria 2040
76 Ga0070672_100011224 3300005543 Bacteria 6245
77 Ga0070672_100067605 3300005543 Bacteria 2832
78 Ga0070686_100125414 3300005544 Bacteria 1768
79 Ga0070693_100187767 3300005547 Unclassified 1335
80 Ga0070665_100482708 3300005548 Bacteria 1250
81 Ga0070704_100109415 3300005549 Bacteria 2100
82 Ga0070664_100015431 3300005564 Bacteria 6248
83 Ga0068857_100064190 3300005577 Bacteria 3265
84 Ga0068857_100087294 3300005577 Bacteria 2790
85 Ga0068857_100425960 3300005577 Bacteria 1238
86 Ga0068856_100027813 3300005614 Bacteria 5516
87 Ga0068856_100052366 3300005614 Bacteria 4025
88 Ga0068856_100400813 3300005614 Bacteria 1392
89 Ga0070702_100005376 3300005615 Bacteria 5955
90 Ga0068852_100015410 3300005616 Bacteria 5928
91 Ga0068859_100040094 3300005617 Bacteria 4700
92 Ga0068859_100104548 3300005617 Unclassified 2891
93 Ga0068859_100200591 3300005617 Bacteria 2080
94 Ga0068864_100010293 3300005618 Bacteria 7722
95 Ga0068864_100029129 3300005618 Bacteria 4672
96 Ga0068864_100047455 3300005618 Bacteria 3689
97 Ga0068864_100104110 3300005618 Bacteria 2520
98 Ga0068861_100032570 3300005719 Unclassified 3838
99 Ga0068851_10051514 3300005834 Bacteria 2092
100 Ga0068851_10263033 3300005834 Unclassified 982
101 Ga0068870_10003517 3300005840 Bacteria 6647
102 Ga0068870_10027067 3300005840 Bacteria 2865
103 Ga0068870_10298414 3300005840 Bacteria 1016
104 Ga0068863_100022663 3300005841 Bacteria 5998
105 Ga0068863_100279607 3300005841 Unclassified 1617
106 Ga0068863_100455491 3300005841 Bacteria 1256
107 Ga0068860_100174748 3300005843 Bacteria 2076
108 Ga0081455_10000826 3300005937 Bacteria 39835
109 Ga0081455_10038496 3300005937 Bacteria 4235
110 Ga0081455_10103429 3300005937 Unclassified 2281
111 Ga0081538_10011266 3300005981 Bacteria 7257
112 Ga0081538_10043107 3300005981 Bacteria 2838
113 Ga0081540_1033714 3300005983 Bacteria 2775
114 Ga0070717_10105389 3300006028 Bacteria 2400
115 Ga0070717_10106386 3300006028 Unclassified 2389
116 Ga0070717_10156434 3300006028 Bacteria 1975
117 Ga0070717_10208428 3300006028 Unclassified 1715
118 Ga0075368_10049370 3300006042 Bacteria 1669
119 Ga0075363_100237407 3300006048 Bacteria 1047
120 Ga0075432_10018437 3300006058 Bacteria 2381
121 Ga0075432_10109825 3300006058 Unclassified 1027
122 Ga0070715_10067365 3300006163 Unclassified 1589
123 Ga0070716_100112358 3300006173 Unclassified 1691
124 Ga0070716_100184235 3300006173 Bacteria 1374
125 Ga0070716_100352411 3300006173 Unclassified 1042
126 Ga0070712_100003984 3300006175 Bacteria 9077
127 Ga0070712_100130360 3300006175 Unclassified 1905
128 Ga0075362_10142788 3300006177 Bacteria 1145
129 Ga0075362_10231851 3300006177 Bacteria 904
130 Ga0075367_10290909 3300006178 Bacteria 1028
131 Ga0075369_10021260 3300006186 Bacteria 2664
132 Ga0075427_10010467 3300006194 Bacteria 1389
133 Ga0075366_10009023 3300006195 Bacteria 5562
134 Ga0075366_10041374 3300006195 Bacteria 2728
135 Ga0097621_100002404 3300006237 Bacteria 12829
136 Ga0097621_100199980 3300006237 Unclassified 1734
137 Ga0068871_100139880 3300006358 Bacteria 2058
138 Ga0075428_100080485 3300006844 Bacteria 3555
139 Ga0075430_100051530 3300006846 Bacteria 3468
140 Ga0075430_100320264 3300006846 Bacteria 1282
141 Ga0075431_100015558 3300006847 Bacteria 7710
142 Ga0075431_100108862 3300006847 Bacteria 2860
143 Ga0075431_100158443 3300006847 Bacteria 2328
144 Ga0075433_10001521 3300006852 Bacteria 17136
145 Ga0075433_10027382 3300006852 Bacteria 4834
146 Ga0075433_10059378 3300006852 Bacteria 3346
147 Ga0075433_10087234 3300006852 Bacteria 2756
148 Ga0075433_10213523 3300006852 Bacteria 1714
149 Ga0075434_100005005 3300006871 Bacteria 12029
150 Ga0075434_100049097 3300006871 Bacteria 4189
151 Ga0075434_100052586 3300006871 Bacteria 4047
152 Ga0075434_100141805 3300006871 Bacteria 2423
153 Ga0075434_100385915 3300006871 Bacteria 1421
154 Ga0075429_100043286 3300006880 Bacteria 3918
155 Ga0075429_100048010 3300006880 Bacteria 3713
156 Ga0075429_100058662 3300006880 Bacteria 3352
157 Ga0075429_100099370 3300006880 Bacteria 2539
158 Ga0075429_100591847 3300006880 Unclassified 972
159 Ga0068865_100021566 3300006881 Bacteria 4191
160 Ga0068865_100286307 3300006881 Bacteria 1314
161 Ga0075436_100091273 3300006914 Bacteria 2117
162 Ga0075436_100542044 3300006914 Unclassified 854
163 Ga0097620_100040094 3300006931 Bacteria 4700
164 Ga0097620_100104551 3300006931 Unclassified 2891
165 Ga0097620_100200583 3300006931 Bacteria 2080
166 Ga0075435_100016154 3300007076 Bacteria 5624
167 Ga0075435_100028687 3300007076 Bacteria 4366
168 Ga0075435_100202908 3300007076 Unclassified 1680
169 Ga0075435_100365205 3300007076 Bacteria 1239
170 Ga0099794_10142900 3300007265 Bacteria 1212
171 Ga0105250_10079227 3300009092 Bacteria 1331
172 Ga0111539_10006516 3300009094 Bacteria 15039
173 Ga0111539_10443588 3300009094 Bacteria 1511
174 Ga0105245_10015166 3300009098 Bacteria 6713
175 Ga0105245_10779772 3300009098 Bacteria 993
176 Ga0105247_10087082 3300009101 Bacteria 1977
177 Ga0114129_10363565 3300009147 Unclassified 1914
178 Ga0114129_10979402 3300009147 Bacteria 1066
179 Ga0105243_10034984 3300009148 Bacteria 3893
180 Ga0105243_10053872 3300009148 Bacteria 3192
181 Ga0105243_10085928 3300009148 Unclassified 2579
182 Ga0105243_10576151 3300009148 Unclassified 1080
183 Ga0105241_10058161 3300009174 Bacteria 2968
184 Ga0105242_10027677 3300009176 Bacteria 4505
185 Ga0105248_10002542 3300009177 Bacteria 20317
186 Ga0105248_10223915 3300009177 Bacteria 2117
187 Ga0105248_10323450 3300009177 Unclassified 1737
188 Ga0105237_10243581 3300009545 Unclassified 1799
189 Ga0105249_10094926 3300009553 Bacteria 2796
190 Ga0105249_10145198 3300009553 Bacteria 2279
191 Ga0105249_10297225 3300009553 Bacteria 1618
192 Ga0105239_10097104 3300010375 Unclassified 3256
193 Ga0105239_10689256 3300010375 Bacteria 1168
194 Ga0105246_10303697 3300011119 Bacteria 1290
195 Ga0157370_10106998 3300013104 Unclassified 2617
196 Ga0157369_10052271 3300013105 Bacteria 4421
197 Ga0157369_10626661 3300013105 Unclassified 1109
198 Ga0157374_10024235 3300013296 Bacteria 5437
199 Ga0157374_10047294 3300013296 Bacteria 3989
200 Ga0157378_10007151 3300013297 Bacteria 9750
201 Ga0163162_10060500 3300013306 Bacteria 3823
202 Ga0163162_10175499 3300013306 Bacteria 2268
203 Ga0163162_10330741 3300013306 Bacteria 1656
204 Ga0157375_10014517 3300013308 Bacteria 7028
205 Ga0163163_10024432 3300014325 Bacteria 5751
206 Ga0163163_10082792 3300014325 Bacteria 3213
207 Ga0182008_10196458 3300014497 Bacteria 1025
208 Ga0157377_10014579 3300014745 Unclassified 4001
209 Ga0157379_10021456 3300014968 Bacteria 5717
210 Ga0157379_10196956 3300014968 Bacteria 1821
211 Ga0157376_10019505 3300014969 Bacteria 5229
212 Ga0157376_10029846 3300014969 Bacteria 4346
213 Ga0163161_10017095 3300017792 Bacteria 5073
214 Ga0207656_10010031 3300025321 Bacteria 3532
215 Ga0207692_10029495 3300025898 Unclassified 2608
216 Ga0207692_10029919 3300025898 Unclassified 2592
217 Ga0207692_10194718 3300025898 Bacteria 1188
218 Ga0207688_10000881 3300025901 Bacteria 15161
219 Ga0207688_10074773 3300025901 Bacteria 1927
220 Ga0207680_10232296 3300025903 Bacteria 1268
221 Ga0207647_10041651 3300025904 Unclassified 2886
222 Ga0207685_10057894 3300025905 Bacteria 1522
223 Ga0207699_10080211 3300025906 Unclassified 2021
224 Ga0207699_10227651 3300025906 Unclassified 1276
225 Ga0207645_10013403 3300025907 Bacteria 5524
226 Ga0207643_10001548 3300025908 Bacteria 13108
227 Ga0207643_10181834 3300025908 Bacteria 1273
228 Ga0207654_10173766 3300025911 Unclassified 1401
229 Ga0207707_10014191 3300025912 Bacteria 6941
230 Ga0207707_10154414 3300025912 Bacteria 2007
231 Ga0207671_10055634 3300025914 Unclassified 2931
232 Ga0207693_10004992 3300025915 Bacteria 11129
233 Ga0207693_10005426 3300025915 Bacteria 10639
234 Ga0207693_10041668 3300025915 Bacteria 3615
235 Ga0207693_10155688 3300025915 Bacteria 1797
236 Ga0207663_10070325 3300025916 Unclassified 2255
237 Ga0207663_10145246 3300025916 Bacteria 1657
238 Ga0207660_10048303 3300025917 Bacteria 3011
239 Ga0207662_10003149 3300025918 Bacteria 8432
240 Ga0207657_10071327 3300025919 Bacteria 2942
241 Ga0207649_10110875 3300025920 Bacteria 1833
242 Ga0207652_10067747 3300025921 Bacteria 3096
243 Ga0207681_10019366 3300025923 Unclassified 4300
244 Ga0207681_10093423 3300025923 Bacteria 2153
245 Ga0207694_10359649 3300025924 Bacteria 1206
246 Ga0207650_10049943 3300025925 Bacteria 3091
247 Ga0207650_10054564 3300025925 Bacteria 2964
248 Ga0207659_10089605 3300025926 Bacteria 2294
249 Ga0207687_10083372 3300025927 Bacteria 2314
250 Ga0207664_10219468 3300025929 Unclassified 1648
251 Ga0207706_10017453 3300025933 Bacteria 6467
252 Ga0207706_10179238 3300025933 Bacteria 1861
253 Ga0207686_10111273 3300025934 Bacteria 1847
254 Ga0207709_10116573 3300025935 Unclassified 1796
255 Ga0207709_10183914 3300025935 Bacteria 1478
256 Ga0207670_10004557 3300025936 Bacteria 7484
257 Ga0207670_10056568 3300025936 Unclassified 2656
258 Ga0207670_10391179 3300025936 Bacteria 1110
259 Ga0207669_10008611 3300025937 Bacteria 4800
260 Ga0207669_10128652 3300025937 Bacteria 1735
261 Ga0207704_10115160 3300025938 Unclassified 1826
262 Ga0207704_10236927 3300025938 Bacteria 1361
263 Ga0207665_10473509 3300025939 Unclassified 964
264 Ga0207691_10002396 3300025940 Bacteria 18341
265 Ga0207691_10061676 3300025940 Bacteria 3405
266 Ga0207711_10013609 3300025941 Bacteria 6759
267 Ga0207711_10207121 3300025941 Bacteria 1791
268 Ga0207689_10002971 3300025942 Bacteria 15641
269 Ga0207689_10032727 3300025942 Bacteria 4323
270 Ga0207689_10509855 3300025942 Bacteria 1008
271 Ga0207679_10020314 3300025945 Bacteria 4481
272 Ga0207679_10034576 3300025945 Bacteria 3567
273 Ga0207651_10298259 3300025960 Bacteria 1339
274 Ga0207651_10348196 3300025960 Bacteria 1247
275 Ga0207712_10011570 3300025961 Bacteria 5625
276 Ga0207712_10073171 3300025961 Bacteria 2471
277 Ga0207668_10079075 3300025972 Bacteria 2377
278 Ga0207668_10192238 3300025972 Bacteria 1618
279 Ga0207658_10027939 3300025986 Bacteria 3969
280 Ga0207658_10150076 3300025986 Bacteria 1898
281 Ga0207658_10547320 3300025986 Bacteria 1035
282 Ga0207703_10012451 3300026035 Bacteria 6632
283 Ga0207678_10022688 3300026067 Bacteria 5497
284 Ga0207678_10027943 3300026067 Unclassified 4925
285 Ga0207708_10004441 3300026075 Bacteria 10339
286 Ga0207708_10054233 3300026075 Bacteria 3056
287 Ga0207702_10041340 3300026078 Bacteria 3866
288 Ga0207702_10625259 3300026078 Bacteria 1058
289 Ga0207641_10019811 3300026088 Bacteria 5522
290 Ga0207641_10611415 3300026088 Unclassified 1068
291 Ga0207648_10040760 3300026089 Bacteria 4080
292 Ga0207648_10042771 3300026089 Unclassified 3977
293 Ga0207676_10081972 3300026095 Bacteria 2622
294 Ga0207676_10100791 3300026095 Unclassified 2393
295 Ga0207676_10228658 3300026095 Bacteria 1661
296 Ga0207674_10011694 3300026116 Bacteria 9852
297 Ga0207674_10076143 3300026116 Bacteria 3364
298 Ga0207674_10586078 3300026116 Unclassified 1077
299 Ga0207675_100093136 3300026118 Unclassified 2834
300 Ga0207675_100895410 3300026118 Unclassified 903
301 Ga0207683_10011077 3300026121 Bacteria 7684
302 Ga0207683_10098404 3300026121 Bacteria 2610
303 Ga0207683_10183203 3300026121 Bacteria 1899
304 Ga0207698_10000566 3300026142 Bacteria 21574
305 Ga0207698_10011642 3300026142 Bacteria 5714
306 Ga0209588_1046284 3300027671 Bacteria 1407
307 Ga0209813_10025726 3300027866 Bacteria 1696
308 Ga0207428_10000306 3300027907 Bacteria 65012
309 Ga0207428_10122253 3300027907 Unclassified 1996
310 Ga0268266_10890736 3300028379 Unclassified 860
311 Ga0268265_10013821 3300028380 Bacteria 5494
312 Ga0268264_10096025 3300028381 Bacteria 2566
313 Ga0268264_10125276 3300028381 Bacteria 2270
314 Ga0268264_10169374 3300028381 Unclassified 1974
315 Ga0268264_10220775 3300028381 Bacteria 1745
316 Ga0268264_10766160 3300028381 Bacteria 962
317 Ga0265338_10308713 3300028800 Bacteria 1148
318 Ga0265325_10026487 3300031241 Bacteria 3140
319 Ga0265327_10021816 3300031251 Bacteria 3853
320 Ga0373928_0009609 3300035084 Bacteria 1890
321 Ga0373928_0055974 3300035084 Bacteria 943
322 Ga0373940_0024257 3300035088 Bacteria 1571
323 Ga0373932_0028638 3300035112 Bacteria 1532
324 Ga0373957_0095656 3300035120 Bacteria 1185
325 Ga0373960_0006144 3300035121 Bacteria 2808
326 Ga0373961_0024049 3300035241 Bacteria 1644
327 Ga0373962_0091738 3300035242 Unclassified 936
328 Ga0373931_0005041 3300035691 Bacteria 6075
329 Ga0373931_0015764 3300035691 Bacteria 3709
330 Ga0373931_0076164 3300035691 Bacteria 1842
331 Ga0373933_0014511 3300035724 Bacteria 4385
332 Ga0373947_0147139 3300035725 Unclassified 1515
333 Ga0373937_0001423 3300036401 Bacteria 19994
334 Ga0373937_0010429 3300036401 Bacteria 8115
335 Ga0373925_0061538 3300037068 Bacteria 2820
336 Ga0373925_0108380 3300037068 Bacteria 2143
337 Ga0395898_0602143 3300037466 Bacteria 1042
338 Ga0436364_0675663 3300037853 Bacteria 1526
339 Ga0436365_1726913 3300039437 Bacteria 859
340 Ga0436360_0006704 3300039438 Bacteria 1229
341 Ga0436363_1392304 3300039450 Unclassified 989
342 Ga0436362_0160523 3300039453 Bacteria 932
343 Ga0439453_0003065 3300041408 Bacteria 2369
344 Ga0451577_0024275 3300042876 Bacteria 5517
345 Ga0451576_0366850 3300045051 Bacteria 1508
346 Ga0466967_0578369 3300045976 Bacteria 1107
347 Ga0495627_043596 3300046453 Bacteria 1372
348 Ga0495592_0059535 3300046454 Bacteria 2812
349 Ga0495629_0049860 3300046459 Bacteria 2934
350 Ga0495580_0000672 3300046472 Bacteria 29183
351 Ga0495664_0008747 3300046477 Bacteria 5654
352 Ga0495664_0182630 3300046477 Bacteria 1272
353 Ga0495584_0147585 3300046491 Bacteria 1195
354 Ga0495608_0027798 3300046511 Bacteria 3847
355 Ga0495618_0196997 3300046514 Bacteria 1276
356 Ga0495628_0042547 3300046516 Bacteria 3623
357 Ga0495628_0115543 3300046516 Bacteria 2061
358 Ga0495628_0298147 3300046516 Bacteria 1194
359 Ga0495642_0030920 3300046528 Unclassified 2145
360 Ga0495652_0040259 3300046529 Bacteria 4039
361 Ga0495665_0157868 3300046531 Unclassified 1183
362 Ga0495640_0261315 3300046533 Bacteria 1082
363 Ga0495640_0276322 3300046533 Bacteria 1047
364 Ga0495586_0059038 3300046535 Bacteria 2084
365 Ga0495645_0005511 3300046543 Bacteria 8697
366 Ga0495667_0037898 3300046559 Bacteria 3211
367 Ga0495634_0037813 3300046642 Bacteria 3296
368 Ga0495635_0016606 3300046663 Bacteria 5142
369 Ga0495657_0038057 3300046675 Bacteria 3312
370 Ga0495599_0020321 3300046678 Bacteria 4135
371 Ga0495623_0080099 3300046679 Bacteria 2022
372 Ga0495646_0009094 3300046680 Bacteria 6299
373 Ga0495670_0150897 3300046691 Bacteria 1219
374 Ga0495671_0196047 3300046692 Unclassified 980
375 Ga0495649_0207823 3300046694 Bacteria 1015
376 Ga0495600_0159233 3300046809 Unclassified 1460
377 Ga0495604_0017462 3300047317 Bacteria 5744
378 Ga0495636_0022914 3300047318 Bacteria 2527
379 Ga0495674_0030967 3300047319 Bacteria 4862
380 Ga0495680_0161283 3300047322 Bacteria 1628
381 Ga0495602_0002925 3300048088 Bacteria 17516
382 Ga0496100_0011156 3300048903 Bacteria 5105
383 Ga0496100_0011883 3300048903 Bacteria 4971
384 Ga0496100_0023960 3300048903 Bacteria 3716
385 Ga0496100_0034245 3300048903 Unclassified 3185
386 Ga0496101_0099064 3300048904 Bacteria 2178
387 Ga0496102_0289968 3300048905 Bacteria 1543
388 Ga0496103_0002319 3300048906 Bacteria 12038
389 Ga0496103_0078874 3300048906 Bacteria 2068
390 Ga0496104_0001788 3300048907 Bacteria 18616
391 Ga0496104_0003927 3300048907 Bacteria 12868
392 Ga0496104_0003988 3300048907 Bacteria 12783
393 Ga0496104_0004372 3300048907 Bacteria 12305
394 Ga0496104_0011015 3300048907 Bacteria 8090
395 Ga0496104_0727335 3300048907 Unclassified 900
396 Ga0496105_0009312 3300048908 Bacteria 7675
397 Ga0496105_0015838 3300048908 Bacteria 6014
398 Ga0496105_0019554 3300048908 Bacteria 5464
399 Ga0496105_0074908 3300048908 Bacteria 2796
400 Ga0496105_0145075 3300048908 Bacteria 1952
401 Ga0496106_0013206 3300048909 Bacteria 6094
402 Ga0496106_0091682 3300048909 Bacteria 2346
403 Ga0496107_0000537 3300048910 Bacteria 21180
404 Ga0496107_0070275 3300048910 Bacteria 2542
405 Ga0496108_0000420 3300048911 Bacteria 34749
406 Ga0496108_0016721 3300048911 Bacteria 5992
407 Ga0496109_0022208 3300048912 Bacteria 5618
408 Ga0496109_0080187 3300048912 Bacteria 3007
409 Ga0496109_0536719 3300048912 Bacteria 1104
410 Ga0496110_0057844 3300048913 Bacteria 3414
411 Ga0496110_0111903 3300048913 Bacteria 2454
412 Ga0496110_0241967 3300048913 Bacteria 1642
413 Ga0496110_0432020 3300048913 Bacteria 1200
414 Ga0496111_0000564 3300048914 Bacteria 19300
415 Ga0496111_0000797 3300048914 Bacteria 16881
416 Ga0496111_0414606 3300048914 Bacteria 995
417 Ga0496112_0036763 3300048915 Bacteria 4777
418 Ga0496112_0096202 3300048915 Unclassified 2931
419 Ga0496112_0154072 3300048915 Bacteria 2265
420 Ga0496113_0000230 3300048916 Bacteria 26363
421 Ga0496113_0413143 3300048916 Unclassified 1084
422 Ga0496114_0010741 3300048917 Bacteria 7288
423 Ga0496114_0024340 3300048917 Bacteria 4940
424 Ga0496114_0317558 3300048917 Bacteria 1376
425 Ga0496114_0342907 3300048917 Bacteria 1321
426 Ga0496115_0000759 3300048918 Bacteria 23773
427 Ga0496115_0003181 3300048918 Bacteria 11800
428 Ga0496115_0010559 3300048918 Bacteria 6904
429 Ga0496115_0018847 3300048918 Bacteria 5305
430 Ga0496115_0033840 3300048918 Bacteria 4037
431 Ga0496115_0193840 3300048918 Bacteria 1679
432 Ga0496115_0243018 3300048918 Bacteria 1484
433 Ga0496115_0250400 3300048918 Bacteria 1458
434 Ga0501040_0374764 3300049576 Bacteria 1021
435 Ga0501072_0422382 3300049588 Bacteria 1057
436 Ga0501075_0217088 3300049591 Bacteria 1459
437 Ga0501076_0223267 3300049592 Bacteria 1540
438 Ga0501077_0001383 3300049593 Bacteria 14617
439 Ga0501077_0046035 3300049593 Bacteria 2772
440 Ga0501080_0193166 3300049742 Bacteria 1870
441 Ga0501083_0198519 3300049744 Bacteria 1309
442 nmdc:mga03683_35649_c1 3300050489 Bacteria 2019
443 nmdc:mga03683_61037_c1 3300050489 Unclassified 1593
444 nmdc:mga03n38_34983_c1 3300050490 Bacteria 2149
445 nmdc:mga0yw44_14568_c1 3300050492 Unclassified 4180
446 nmdc:mga0yw44_165164_c1 3300050492 Bacteria 1451
447 nmdc:mga0k408_9044_c1 3300050493 Bacteria 5360
448 nmdc:mga06z11_24881_c1 3300050494 Bacteria 2830
449 nmdc:mga06z11_56603_c1 3300050494 Bacteria 2029
450 nmdc:mga04h51_20422_c1 3300050495 Bacteria 1978
451 nmdc:mga07m45_281250_c1 3300050496 Bacteria 968
452 nmdc:mga07m45_70468_c1 3300050496 Bacteria 1989
453 nmdc:mga07m45_72931_c1 3300050496 Bacteria 1955
454 nmdc:mga05p37_135164_c1 3300050507 Bacteria 3025
455 nmdc:mga05p37_16817_c1 3300050507 Bacteria 8819
456 nmdc:mga05p37_197361_c1 3300050507 Unclassified 2440
457 nmdc:mga05p37_23243_c1 3300050507 Bacteria 7519
458 nmdc:mga05p37_25122_c1 3300050507 Bacteria 7244
459 nmdc:mga05p37_31974_c1 3300050507 Bacteria 6433
460 nmdc:mga05p37_400137_c1 3300050507 Bacteria 1603
461 nmdc:mga05p37_5330_c1 3300050507 Bacteria 15104
462 nmdc:mga05p37_696657_c1 3300050507 Bacteria 1129
463 nmdc:mga09592_138448_c1 3300050508 Bacteria 2097
464 nmdc:mga09592_3299_c1 3300050508 Bacteria 13065
465 nmdc:mga0qj67_143040_c1 3300050509 Bacteria 1939
466 nmdc:mga0qj67_161053_c1 3300050509 Bacteria 1822
467 nmdc:mga0qj67_208932_c1 3300050509 Bacteria 1586
468 nmdc:mga06r32_134447_c1 3300050510 Bacteria 2447
469 nmdc:mga06r32_153537_c1 3300050510 Bacteria 2282
470 nmdc:mga06r32_36257_c2 3300050510 Bacteria 4289
471 nmdc:mga06r32_373250_c1 3300050510 Bacteria 1409
472 nmdc:mga06r32_51365_c1 3300050510 Bacteria 3945
473 nmdc:mga08y16_322331_c1 3300050511 Bacteria 1590
474 nmdc:mga08y16_3500_c1 3300050511 Bacteria 16303
475 nmdc:mga0n895_15101_c1 3300050512 Bacteria 7037
476 nmdc:mga0n895_24489_c1 3300050512 Bacteria 5689
477 nmdc:mga0n895_399948_c1 3300050512 Unclassified 1389
478 nmdc:mga0n895_4900_c1 3300050512 Bacteria 11094
479 nmdc:mga0n895_52690_c1 3300050512 Bacteria 3995
480 nmdc:mga0n895_7432_c1 3300050512 Bacteria 9401
481 nmdc:mga0n895_76045_c1 3300050512 Bacteria 3339
482 nmdc:mga0rr50_120992_c1 3300050513 Bacteria 2084
483 nmdc:mga0rr50_64555_c1 3300050513 Bacteria 2770
484 nmdc:mga08x19_195165_c1 3300050514 Bacteria 1386
485 nmdc:mga0a205_22180_c1 3300050515 Bacteria 6010
486 nmdc:mga0a205_355650_c1 3300050515 Bacteria 1331
487 nmdc:mga0a205_4204_c1 3300050515 Bacteria 12908
488 nmdc:mga0a205_588067_c1 3300050515 Unclassified 967
489 nmdc:mga0a205_62843_c1 3300050515 Bacteria 3587
490 nmdc:mga0sz30_257035_c1 3300050516 Unclassified 778
491 Ga0495601_0004384 3300053077 Bacteria 8152
492 Ga0495612_0001013 3300053078 Bacteria 11549
493 Ga0495595_0049827 3300053084 Bacteria 1938
494 Ga0495595_0094722 3300053084 Unclassified 1436
495 Ga0495619_0290586 3300053085 Bacteria 1132
496 Ga0500641_0048887 3300053096 Bacteria 1733
497 Ga0500595_023475 3300053119 Bacteria 2167
498 Ga0500568_0057478 3300053139 Unclassified 1514
499 Ga0501084_0168886 3300054114 Bacteria 1846
500 Ga0501082_0087162 3300060353 Bacteria 2693
501 Ga0530510_0022046 3300061734 Bacteria 4535
502 Ga0530510_0097914 3300061734 Bacteria 2145
503 Ga0530510_0262497 3300061734 Bacteria 1288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_257035_c1 nmdc:mga0sz30_257035_c1_124_768 213
2 3300048907 Ga0496104_0727335 Ga0496104_0727335_203_862 218
3 3300037853 Ga0436364_0675663 Ga0436364_0675663_820_1509 225
4 3300025939 Ga0207665_10473509 Ga0207665_104735092 236
5 3300006175 Ga0070712_100003984 Ga0070712_1000039842 245
6 3300025915 Ga0207693_10005426 Ga0207693_1000542610 245
7 3300049588 Ga0501072_0422382 Ga0501072_0422382_89_838 246
8 3300049591 Ga0501075_0217088 Ga0501075_0217088_471_1220 246
9 3300049592 Ga0501076_0223267 Ga0501076_0223267_154_903 246
10 3300061734 Ga0530510_0022046 Ga0530510_0022046_3198_3947 246
11 3300031241 Ga0265325_10026487 Ga0265325_100264874 249
12 3300053139 Ga0500568_0057478 Ga0500568_0057478_53_820 251
13 3300005330 Ga0070690_100356460 Ga0070690_1003564601 252
14 3300005333 Ga0070677_10146279 Ga0070677_101462791 252
15 3300005337 Ga0070682_100077404 Ga0070682_1000774042 252
16 3300005340 Ga0070689_100039090 Ga0070689_1000390903 252
17 3300005343 Ga0070687_100094817 Ga0070687_1000948172 252
18 3300005353 Ga0070669_100122197 Ga0070669_1001221972 252
19 3300005353 Ga0070669_100224569 Ga0070669_1002245692 252
20 3300005354 Ga0070675_100098107 Ga0070675_1000981072 252
21 3300005355 Ga0070671_100059201 Ga0070671_1000592012 252
22 3300005355 Ga0070671_100068038 Ga0070671_1000680382 252
23 3300005356 Ga0070674_100025972 Ga0070674_1000259722 252
24 3300005356 Ga0070674_100030034 Ga0070674_1000300342 252
25 3300005365 Ga0070688_100009165 Ga0070688_1000091655 252
26 3300005441 Ga0070700_100296853 Ga0070700_1002968532 252
27 3300005459 Ga0068867_100115108 Ga0068867_1001151082 252
28 3300005614 Ga0068856_100400813 Ga0068856_1004008131 252
29 3300005618 Ga0068864_100047455 Ga0068864_1000474552 252
30 3300006042 Ga0075368_10049370 Ga0075368_100493702 252
31 3300006048 Ga0075363_100237407 Ga0075363_1002374071 252
32 3300006177 Ga0075362_10142788 Ga0075362_101427882 252
33 3300006177 Ga0075362_10231851 Ga0075362_102318512 252
34 3300006186 Ga0075369_10021260 Ga0075369_100212602 252
35 3300009098 Ga0105245_10779772 Ga0105245_107797722 252
36 3300009177 Ga0105248_10002542 Ga0105248_1000254219 252
37 3300009177 Ga0105248_10323450 Ga0105248_103234502 252
38 3300009553 Ga0105249_10094926 Ga0105249_100949262 252
39 3300009553 Ga0105249_10297225 Ga0105249_102972252 252
40 3300013306 Ga0163162_10175499 Ga0163162_101754992 252
41 3300014325 Ga0163163_10024432 Ga0163163_100244322 252
42 3300014497 Ga0182008_10196458 Ga0182008_101964581 252
43 3300014968 Ga0157379_10196956 Ga0157379_101969562 252
44 3300025912 Ga0207707_10154414 Ga0207707_101544142 252
45 3300025923 Ga0207681_10093423 Ga0207681_100934232 252
46 3300025926 Ga0207659_10089605 Ga0207659_100896052 252
47 3300025936 Ga0207670_10004557 Ga0207670_100045576 252
48 3300025937 Ga0207669_10008611 Ga0207669_100086115 252
49 3300025937 Ga0207669_10128652 Ga0207669_101286522 252
50 3300025941 Ga0207711_10013609 Ga0207711_100136092 252
51 3300025941 Ga0207711_10207121 Ga0207711_102071211 252
52 3300025942 Ga0207689_10509855 Ga0207689_105098552 252
53 3300025960 Ga0207651_10348196 Ga0207651_103481961 252
54 3300025986 Ga0207658_10547320 Ga0207658_105473201 252
55 3300026078 Ga0207702_10625259 Ga0207702_106252592 252
56 3300026089 Ga0207648_10040760 Ga0207648_100407604 252
57 3300026095 Ga0207676_10081972 Ga0207676_100819722 252
58 3300026118 Ga0207675_100895410 Ga0207675_1008954101 252
59 3300026121 Ga0207683_10098404 Ga0207683_100984041 252
60 3300026121 Ga0207683_10183203 Ga0207683_101832032 252
61 3300027866 Ga0209813_10025726 Ga0209813_100257262 252
62 3300028381 Ga0268264_10766160 Ga0268264_107661602 252
63 3300035084 Ga0373928_0055974 Ga0373928_0055974_57_818 252
64 3300035120 Ga0373957_0095656 Ga0373957_0095656_44_805 252
65 3300035121 Ga0373960_0006144 Ga0373960_0006144_134_895 252
66 3300035241 Ga0373961_0024049 Ga0373961_0024049_368_1129 252
67 3300035691 Ga0373931_0015764 Ga0373931_0015764_2274_3035 252
68 3300035725 Ga0373947_0147139 Ga0373947_0147139_312_1073 252
69 3300036401 Ga0373937_0001423 Ga0373937_0001423_19046_19807 252
70 3300037068 Ga0373925_0108380 Ga0373925_0108380_638_1399 252
71 3300046477 Ga0495664_0182630 Ga0495664_0182630_156_917 252
72 3300046516 Ga0495628_0298147 Ga0495628_0298147_199_960 252
73 3300046533 Ga0495640_0261315 Ga0495640_0261315_238_999 252
74 3300047322 Ga0495680_0161283 Ga0495680_0161283_38_799 252
75 3300048903 Ga0496100_0011156 Ga0496100_0011156_344_1105 252
76 3300048903 Ga0496100_0011883 Ga0496100_0011883_4166_4924 252
77 3300048907 Ga0496104_0011015 Ga0496104_0011015_1073_1831 252
78 3300048908 Ga0496105_0015838 Ga0496105_0015838_172_933 252
79 3300048908 Ga0496105_0074908 Ga0496105_0074908_155_913 252
80 3300048909 Ga0496106_0091682 Ga0496106_0091682_809_1570 252
81 3300048912 Ga0496109_0080187 Ga0496109_0080187_1431_2192 252
82 3300048913 Ga0496110_0057844 Ga0496110_0057844_2577_3377 252
83 3300048913 Ga0496110_0241967 Ga0496110_0241967_383_1141 252
84 3300048913 Ga0496110_0432020 Ga0496110_0432020_242_1003 252
85 3300048915 Ga0496112_0154072 Ga0496112_0154072_1108_1869 252
86 3300048917 Ga0496114_0010741 Ga0496114_0010741_1198_1959 252
87 3300048918 Ga0496115_0018847 Ga0496115_0018847_482_1243 252
88 3300048918 Ga0496115_0033840 Ga0496115_0033840_1875_2633 252
89 3300048918 Ga0496115_0193840 Ga0496115_0193840_199_960 252
90 3300049742 Ga0501080_0193166 Ga0501080_0193166_119_880 252
91 3300050489 nmdc:mga03683_35649_c1 nmdc:mga03683_35649_c1_886_1647 252
92 3300050490 nmdc:mga03n38_34983_c1 nmdc:mga03n38_34983_c1_1233_1994 252
93 3300050494 nmdc:mga06z11_56603_c1 nmdc:mga06z11_56603_c1_632_1393 252
94 3300050495 nmdc:mga04h51_20422_c1 nmdc:mga04h51_20422_c1_280_1041 252
95 3300050496 nmdc:mga07m45_281250_c1 nmdc:mga07m45_281250_c1_87_848 252
96 3300050496 nmdc:mga07m45_70468_c1 nmdc:mga07m45_70468_c1_892_1653 252
97 3300050496 nmdc:mga07m45_72931_c1 nmdc:mga07m45_72931_c1_1062_1823 252
98 3300053084 Ga0495595_0049827 Ga0495595_0049827_1049_1810 252
99 3300053119 Ga0500595_023475 Ga0500595_023475_986_1747 252
100 3300005458 Ga0070681_10174241 Ga0070681_101742412 253
101 3300005458 Ga0070681_10488844 Ga0070681_104888442 253
102 3300005530 Ga0070679_100042330 Ga0070679_1000423303 253
103 3300005530 Ga0070679_100298905 Ga0070679_1002989052 253
104 3300005535 Ga0070684_100316342 Ga0070684_1003163422 253
105 3300005577 Ga0068857_100064190 Ga0068857_1000641904 253
106 3300005937 Ga0081455_10000826 Ga0081455_1000082610 253
107 3300005981 Ga0081538_10011266 Ga0081538_100112665 253
108 3300005981 Ga0081538_10043107 Ga0081538_100431072 253
109 3300005983 Ga0081540_1033714 Ga0081540_10337143 253
110 3300006195 Ga0075366_10041374 Ga0075366_100413742 253
111 3300006844 Ga0075428_100080485 Ga0075428_1000804853 253
112 3300006847 Ga0075431_100108862 Ga0075431_1001088622 253
113 3300006852 Ga0075433_10027382 Ga0075433_100273822 253
114 3300007076 Ga0075435_100365205 Ga0075435_1003652052 253
115 3300009094 Ga0111539_10443588 Ga0111539_104435882 253
116 3300013104 Ga0157370_10106998 Ga0157370_101069982 253
117 3300013105 Ga0157369_10052271 Ga0157369_100522715 253
118 3300026116 Ga0207674_10586078 Ga0207674_105860782 253
119 3300041408 Ga0439453_0003065 Ga0439453_0003065_371_1135 253
120 3300045976 Ga0466967_0578369 Ga0466967_0578369_296_1063 253
121 3300048908 Ga0496105_0145075 Ga0496105_0145075_980_1741 253
122 3300048912 Ga0496109_0536719 Ga0496109_0536719_12_773 253
123 3300048918 Ga0496115_0243018 Ga0496115_0243018_127_888 253
124 3300049576 Ga0501040_0374764 Ga0501040_0374764_63_827 253
125 3300050507 nmdc:mga05p37_31974_c1 nmdc:mga05p37_31974_c1_43_807 253
126 3300050510 nmdc:mga06r32_51365_c1 nmdc:mga06r32_51365_c1_1333_2097 253
127 3300050513 nmdc:mga0rr50_120992_c1 nmdc:mga0rr50_120992_c1_1112_1879 253
128 3300050515 nmdc:mga0a205_62843_c1 nmdc:mga0a205_62843_c1_2300_3067 253
129 3300005340 Ga0070689_100426959 Ga0070689_1004269592 254
130 3300005343 Ga0070687_100210241 Ga0070687_1002102412 254
131 3300005345 Ga0070692_10286153 Ga0070692_102861531 254
132 3300005355 Ga0070671_100507151 Ga0070671_1005071512 254
133 3300005364 Ga0070673_100431706 Ga0070673_1004317062 254
134 3300005366 Ga0070659_100036000 Ga0070659_1000360001 254
135 3300005434 Ga0070709_10013833 Ga0070709_100138332 254
136 3300005435 Ga0070714_100054269 Ga0070714_1000542693 254
137 3300005436 Ga0070713_100060713 Ga0070713_1000607132 254
138 3300005467 Ga0070706_100367550 Ga0070706_1003675502 254
139 3300005530 Ga0070679_100042330 Ga0070679_1000423302 254
140 3300005577 Ga0068857_100064190 Ga0068857_1000641903 254
141 3300005840 Ga0068870_10298414 Ga0068870_102984141 254
142 3300005937 Ga0081455_10038496 Ga0081455_100384966 254
143 3300006028 Ga0070717_10106386 Ga0070717_101063862 254
144 3300006028 Ga0070717_10156434 Ga0070717_101564344 254
145 3300006058 Ga0075432_10109825 Ga0075432_101098252 254
146 3300006173 Ga0070716_100112358 Ga0070716_1001123582 254
147 3300006173 Ga0070716_100352411 Ga0070716_1003524111 254
148 3300006178 Ga0075367_10290909 Ga0075367_102909092 254
149 3300006195 Ga0075366_10009023 Ga0075366_100090234 254
150 3300006846 Ga0075430_100320264 Ga0075430_1003202642 254
151 3300006852 Ga0075433_10213523 Ga0075433_102135232 254
152 3300006871 Ga0075434_100049097 Ga0075434_1000490972 254
153 3300006871 Ga0075434_100385915 Ga0075434_1003859151 254
154 3300006880 Ga0075429_100591847 Ga0075429_1005918471 254
155 3300006914 Ga0075436_100091273 Ga0075436_1000912732 254
156 3300009147 Ga0114129_10363565 Ga0114129_103635652 254
157 3300013104 Ga0157370_10106998 Ga0157370_101069983 254
158 3300013105 Ga0157369_10052271 Ga0157369_100522716 254
159 3300025898 Ga0207692_10029919 Ga0207692_100299192 254
160 3300025906 Ga0207699_10227651 Ga0207699_102276511 254
161 3300025911 Ga0207654_10173766 Ga0207654_101737662 254
162 3300025915 Ga0207693_10155688 Ga0207693_101556881 254
163 3300025916 Ga0207663_10070325 Ga0207663_100703251 254
164 3300025934 Ga0207686_10111273 Ga0207686_101112732 254
165 3300025936 Ga0207670_10391179 Ga0207670_103911792 254
166 3300025972 Ga0207668_10192238 Ga0207668_101922382 254
167 3300028379 Ga0268266_10890736 Ga0268266_108907361 254
168 3300028381 Ga0268264_10096025 Ga0268264_100960252 254
169 3300031251 Ga0265327_10021816 Ga0265327_100218162 254
170 3300035112 Ga0373932_0028638 Ga0373932_0028638_243_1016 254
171 3300035691 Ga0373931_0005041 Ga0373931_0005041_466_1239 254
172 3300037466 Ga0395898_0602143 Ga0395898_0602143_229_996 254
173 3300046453 Ga0495627_043596 Ga0495627_043596_492_1277 254
174 3300046691 Ga0495670_0150897 Ga0495670_0150897_414_1199 254
175 3300046692 Ga0495671_0196047 Ga0495671_0196047_125_910 254
176 3300046694 Ga0495649_0207823 Ga0495649_0207823_220_1005 254
177 3300049593 Ga0501077_0001383 Ga0501077_0001383_888_1661 254
178 3300050489 nmdc:mga03683_61037_c1 nmdc:mga03683_61037_c1_539_1303 254
179 3300050492 nmdc:mga0yw44_14568_c1 nmdc:mga0yw44_14568_c1_1236_2000 254
180 3300050493 nmdc:mga0k408_9044_c1 nmdc:mga0k408_9044_c1_2835_3623 254
181 3300050494 nmdc:mga06z11_24881_c1 nmdc:mga06z11_24881_c1_1936_2724 254
182 3300050507 nmdc:mga05p37_197361_c1 nmdc:mga05p37_197361_c1_271_1044 254
183 3300050507 nmdc:mga05p37_23243_c1 nmdc:mga05p37_23243_c1_467_1240 254
184 3300050507 nmdc:mga05p37_25122_c1 nmdc:mga05p37_25122_c1_5553_6326 254
185 3300050508 nmdc:mga09592_138448_c1 nmdc:mga09592_138448_c1_704_1477 254
186 3300050509 nmdc:mga0qj67_143040_c1 nmdc:mga0qj67_143040_c1_743_1567 254
187 3300050512 nmdc:mga0n895_399948_c1 nmdc:mga0n895_399948_c1_214_978 254
188 3300050512 nmdc:mga0n895_52690_c1 nmdc:mga0n895_52690_c1_543_1313 254
189 3300050515 nmdc:mga0a205_355650_c1 nmdc:mga0a205_355650_c1_261_1034 254
190 3300001976 JGI24752J21851_1003131 JGI24752J21851_10031312 255
191 3300001978 JGI24747J21853_1013704 JGI24747J21853_10137041 255
192 3300001991 JGI24743J22301_10008697 JGI24743J22301_100086972 255
193 3300002070 JGI24750J21931_1004677 JGI24750J21931_10046772 255
194 3300002239 JGI24034J26672_10003250 JGI24034J26672_100032502 255
195 3300005328 Ga0070676_10029262 Ga0070676_100292623 255
196 3300005330 Ga0070690_100016011 Ga0070690_1000160113 255
197 3300005331 Ga0070670_100005964 Ga0070670_1000059642 255
198 3300005335 Ga0070666_10111196 Ga0070666_101111961 255
199 3300005336 Ga0070680_100046695 Ga0070680_1000466953 255
200 3300005337 Ga0070682_100006111 Ga0070682_1000061114 255
201 3300005337 Ga0070682_100440330 Ga0070682_1004403301 255
202 3300005338 Ga0068868_100014070 Ga0068868_1000140702 255
203 3300005338 Ga0068868_100027512 Ga0068868_1000275122 255
204 3300005340 Ga0070689_100032625 Ga0070689_1000326253 255
205 3300005343 Ga0070687_100304475 Ga0070687_1003044751 255
206 3300005347 Ga0070668_100031803 Ga0070668_1000318033 255
207 3300005354 Ga0070675_100051374 Ga0070675_1000513743 255
208 3300005354 Ga0070675_100051398 Ga0070675_1000513982 255
209 3300005355 Ga0070671_100030852 Ga0070671_1000308522 255
210 3300005356 Ga0070674_100029527 Ga0070674_1000295273 255
211 3300005365 Ga0070688_100050385 Ga0070688_1000503852 255
212 3300005366 Ga0070659_100144925 Ga0070659_1001449252 255
213 3300005367 Ga0070667_100079454 Ga0070667_1000794542 255
214 3300005367 Ga0070667_100350864 Ga0070667_1003508642 255
215 3300005434 Ga0070709_10053677 Ga0070709_100536771 255
216 3300005436 Ga0070713_100033784 Ga0070713_1000337844 255
217 3300005437 Ga0070710_10121693 Ga0070710_101216932 255
218 3300005437 Ga0070710_10166138 Ga0070710_101661382 255
219 3300005439 Ga0070711_100116176 Ga0070711_1001161761 255
220 3300005440 Ga0070705_100138215 Ga0070705_1001382151 255
221 3300005441 Ga0070700_100066376 Ga0070700_1000663763 255
222 3300005444 Ga0070694_100107485 Ga0070694_1001074851 255
223 3300005445 Ga0070708_100176671 Ga0070708_1001766712 255
224 3300005455 Ga0070663_100012277 Ga0070663_1000122774 255
225 3300005456 Ga0070678_100019467 Ga0070678_1000194673 255
226 3300005457 Ga0070662_100186268 Ga0070662_1001862682 255
227 3300005457 Ga0070662_100706589 Ga0070662_1007065891 255
228 3300005458 Ga0070681_10019517 Ga0070681_100195173 255
229 3300005459 Ga0068867_100060641 Ga0068867_1000606412 255
230 3300005466 Ga0070685_10024929 Ga0070685_100249292 255
231 3300005518 Ga0070699_100176629 Ga0070699_1001766291 255
232 3300005530 Ga0070679_100020665 Ga0070679_1000206653 255
233 3300005535 Ga0070684_100200479 Ga0070684_1002004792 255
234 3300005539 Ga0068853_100158660 Ga0068853_1001586602 255
235 3300005543 Ga0070672_100011224 Ga0070672_1000112243 255
236 3300005543 Ga0070672_100067605 Ga0070672_1000676053 255
237 3300005544 Ga0070686_100125414 Ga0070686_1001254142 255
238 3300005547 Ga0070693_100187767 Ga0070693_1001877671 255
239 3300005548 Ga0070665_100482708 Ga0070665_1004827082 255
240 3300005549 Ga0070704_100109415 Ga0070704_1001094152 255
241 3300005564 Ga0070664_100015431 Ga0070664_1000154317 255
242 3300005577 Ga0068857_100087294 Ga0068857_1000872942 255
243 3300005577 Ga0068857_100425960 Ga0068857_1004259602 255
244 3300005614 Ga0068856_100027813 Ga0068856_1000278133 255
245 3300005614 Ga0068856_100052366 Ga0068856_1000523663 255
246 3300005615 Ga0070702_100005376 Ga0070702_1000053766 255
247 3300005616 Ga0068852_100015410 Ga0068852_1000154105 255
248 3300005617 Ga0068859_100040094 Ga0068859_1000400945 255
249 3300005617 Ga0068859_100104548 Ga0068859_1001045482 255
250 3300005617 Ga0068859_100200591 Ga0068859_1002005913 255
251 3300005618 Ga0068864_100010293 Ga0068864_1000102932 255
252 3300005618 Ga0068864_100029129 Ga0068864_1000291292 255
253 3300005618 Ga0068864_100104110 Ga0068864_1001041102 255
254 3300005719 Ga0068861_100032570 Ga0068861_1000325703 255
255 3300005834 Ga0068851_10051514 Ga0068851_100515142 255
256 3300005834 Ga0068851_10263033 Ga0068851_102630332 255
257 3300005840 Ga0068870_10003517 Ga0068870_100035176 255
258 3300005840 Ga0068870_10027067 Ga0068870_100270672 255
259 3300005841 Ga0068863_100022663 Ga0068863_1000226633 255
260 3300005841 Ga0068863_100279607 Ga0068863_1002796072 255
261 3300005841 Ga0068863_100455491 Ga0068863_1004554911 255
262 3300005843 Ga0068860_100174748 Ga0068860_1001747482 255
263 3300005937 Ga0081455_10103429 Ga0081455_101034291 255
264 3300006028 Ga0070717_10105389 Ga0070717_101053892 255
265 3300006028 Ga0070717_10208428 Ga0070717_102084281 255
266 3300006058 Ga0075432_10018437 Ga0075432_100184372 255
267 3300006163 Ga0070715_10067365 Ga0070715_100673652 255
268 3300006173 Ga0070716_100184235 Ga0070716_1001842352 255
269 3300006175 Ga0070712_100130360 Ga0070712_1001303602 255
270 3300006194 Ga0075427_10010467 Ga0075427_100104672 255
271 3300006237 Ga0097621_100002404 Ga0097621_1000024042 255
272 3300006237 Ga0097621_100199980 Ga0097621_1001999802 255
273 3300006358 Ga0068871_100139880 Ga0068871_1001398802 255
274 3300006846 Ga0075430_100051530 Ga0075430_1000515303 255
275 3300006847 Ga0075431_100015558 Ga0075431_1000155586 255
276 3300006847 Ga0075431_100158443 Ga0075431_1001584432 255
277 3300006852 Ga0075433_10001521 Ga0075433_1000152117 255
278 3300006852 Ga0075433_10059378 Ga0075433_100593784 255
279 3300006852 Ga0075433_10087234 Ga0075433_100872342 255
280 3300006871 Ga0075434_100005005 Ga0075434_1000050053 255
281 3300006871 Ga0075434_100052586 Ga0075434_1000525862 255
282 3300006871 Ga0075434_100141805 Ga0075434_1001418052 255
283 3300006880 Ga0075429_100043286 Ga0075429_1000432865 255
284 3300006880 Ga0075429_100048010 Ga0075429_1000480102 255
285 3300006880 Ga0075429_100058662 Ga0075429_1000586622 255
286 3300006880 Ga0075429_100099370 Ga0075429_1000993702 255
287 3300006881 Ga0068865_100021566 Ga0068865_1000215664 255
288 3300006881 Ga0068865_100286307 Ga0068865_1002863072 255
289 3300006914 Ga0075436_100542044 Ga0075436_1005420441 255
290 3300006931 Ga0097620_100040094 Ga0097620_1000400945 255
291 3300006931 Ga0097620_100104551 Ga0097620_1001045512 255
292 3300006931 Ga0097620_100200583 Ga0097620_1002005833 255
293 3300007076 Ga0075435_100016154 Ga0075435_1000161546 255
294 3300007076 Ga0075435_100028687 Ga0075435_1000286876 255
295 3300007076 Ga0075435_100202908 Ga0075435_1002029082 255
296 3300007265 Ga0099794_10142900 Ga0099794_101429001 255
297 3300009092 Ga0105250_10079227 Ga0105250_100792272 255
298 3300009094 Ga0111539_10006516 Ga0111539_100065165 255
299 3300009098 Ga0105245_10015166 Ga0105245_100151666 255
300 3300009101 Ga0105247_10087082 Ga0105247_100870822 255
301 3300009147 Ga0114129_10979402 Ga0114129_109794021 255
302 3300009148 Ga0105243_10034984 Ga0105243_100349844 255
303 3300009148 Ga0105243_10053872 Ga0105243_100538724 255
304 3300009148 Ga0105243_10085928 Ga0105243_100859283 255
305 3300009148 Ga0105243_10576151 Ga0105243_105761512 255
306 3300009174 Ga0105241_10058161 Ga0105241_100581613 255
307 3300009176 Ga0105242_10027677 Ga0105242_100276774 255
308 3300009177 Ga0105248_10223915 Ga0105248_102239152 255
309 3300009545 Ga0105237_10243581 Ga0105237_102435811 255
310 3300009553 Ga0105249_10145198 Ga0105249_101451982 255
311 3300010375 Ga0105239_10097104 Ga0105239_100971043 255
312 3300010375 Ga0105239_10689256 Ga0105239_106892562 255
313 3300011119 Ga0105246_10303697 Ga0105246_103036972 255
314 3300013105 Ga0157369_10626661 Ga0157369_106266612 255
315 3300013296 Ga0157374_10024235 Ga0157374_100242356 255
316 3300013296 Ga0157374_10047294 Ga0157374_100472942 255
317 3300013297 Ga0157378_10007151 Ga0157378_100071517 255
318 3300013306 Ga0163162_10060500 Ga0163162_100605004 255
319 3300013306 Ga0163162_10330741 Ga0163162_103307412 255
320 3300013308 Ga0157375_10014517 Ga0157375_100145176 255
321 3300014325 Ga0163163_10082792 Ga0163163_100827923 255
322 3300014745 Ga0157377_10014579 Ga0157377_100145793 255
323 3300014968 Ga0157379_10021456 Ga0157379_100214565 255
324 3300014969 Ga0157376_10019505 Ga0157376_100195056 255
325 3300014969 Ga0157376_10029846 Ga0157376_100298463 255
326 3300017792 Ga0163161_10017095 Ga0163161_100170953 255
327 3300025321 Ga0207656_10010031 Ga0207656_100100312 255
328 3300025898 Ga0207692_10029495 Ga0207692_100294952 255
329 3300025898 Ga0207692_10194718 Ga0207692_101947182 255
330 3300025901 Ga0207688_10000881 Ga0207688_100008813 255
331 3300025901 Ga0207688_10074773 Ga0207688_100747732 255
332 3300025903 Ga0207680_10232296 Ga0207680_102322962 255
333 3300025904 Ga0207647_10041651 Ga0207647_100416512 255
334 3300025905 Ga0207685_10057894 Ga0207685_100578942 255
335 3300025906 Ga0207699_10080211 Ga0207699_100802113 255
336 3300025907 Ga0207645_10013403 Ga0207645_100134036 255
337 3300025908 Ga0207643_10001548 Ga0207643_100015483 255
338 3300025908 Ga0207643_10181834 Ga0207643_101818342 255
339 3300025912 Ga0207707_10014191 Ga0207707_100141917 255
340 3300025914 Ga0207671_10055634 Ga0207671_100556342 255
341 3300025915 Ga0207693_10004992 Ga0207693_100049929 255
342 3300025915 Ga0207693_10041668 Ga0207693_100416682 255
343 3300025916 Ga0207663_10145246 Ga0207663_101452462 255
344 3300025917 Ga0207660_10048303 Ga0207660_100483033 255
345 3300025918 Ga0207662_10003149 Ga0207662_100031499 255
346 3300025919 Ga0207657_10071327 Ga0207657_100713272 255
347 3300025920 Ga0207649_10110875 Ga0207649_101108752 255
348 3300025921 Ga0207652_10067747 Ga0207652_100677473 255
349 3300025923 Ga0207681_10019366 Ga0207681_100193663 255
350 3300025924 Ga0207694_10359649 Ga0207694_103596492 255
351 3300025925 Ga0207650_10049943 Ga0207650_100499433 255
352 3300025925 Ga0207650_10054564 Ga0207650_100545643 255
353 3300025927 Ga0207687_10083372 Ga0207687_100833721 255
354 3300025929 Ga0207664_10219468 Ga0207664_102194682 255
355 3300025933 Ga0207706_10017453 Ga0207706_100174532 255
356 3300025933 Ga0207706_10179238 Ga0207706_101792381 255
357 3300025935 Ga0207709_10116573 Ga0207709_101165732 255
358 3300025935 Ga0207709_10183914 Ga0207709_101839142 255
359 3300025936 Ga0207670_10056568 Ga0207670_100565683 255
360 3300025938 Ga0207704_10115160 Ga0207704_101151602 255
361 3300025938 Ga0207704_10236927 Ga0207704_102369271 255
362 3300025940 Ga0207691_10002396 Ga0207691_1000239619 255
363 3300025940 Ga0207691_10061676 Ga0207691_100616762 255
364 3300025942 Ga0207689_10002971 Ga0207689_100029713 255
365 3300025942 Ga0207689_10032727 Ga0207689_100327274 255
366 3300025945 Ga0207679_10020314 Ga0207679_100203144 255
367 3300025945 Ga0207679_10034576 Ga0207679_100345762 255
368 3300025960 Ga0207651_10298259 Ga0207651_102982592 255
369 3300025961 Ga0207712_10011570 Ga0207712_100115704 255
370 3300025961 Ga0207712_10073171 Ga0207712_100731713 255
371 3300025972 Ga0207668_10079075 Ga0207668_100790753 255
372 3300025986 Ga0207658_10027939 Ga0207658_100279394 255
373 3300025986 Ga0207658_10150076 Ga0207658_101500762 255
374 3300026035 Ga0207703_10012451 Ga0207703_100124516 255
375 3300026067 Ga0207678_10022688 Ga0207678_100226883 255
376 3300026067 Ga0207678_10027943 Ga0207678_100279433 255
377 3300026075 Ga0207708_10004441 Ga0207708_100044413 255
378 3300026075 Ga0207708_10054233 Ga0207708_100542333 255
379 3300026078 Ga0207702_10041340 Ga0207702_100413402 255
380 3300026088 Ga0207641_10019811 Ga0207641_100198112 255
381 3300026088 Ga0207641_10611415 Ga0207641_106114152 255
382 3300026089 Ga0207648_10042771 Ga0207648_100427712 255
383 3300026095 Ga0207676_10100791 Ga0207676_101007912 255
384 3300026095 Ga0207676_10228658 Ga0207676_102286582 255
385 3300026116 Ga0207674_10011694 Ga0207674_100116947 255
386 3300026116 Ga0207674_10076143 Ga0207674_100761433 255
387 3300026118 Ga0207675_100093136 Ga0207675_1000931363 255
388 3300026121 Ga0207683_10011077 Ga0207683_100110773 255
389 3300026142 Ga0207698_10000566 Ga0207698_100005661 255
390 3300026142 Ga0207698_10011642 Ga0207698_100116423 255
391 3300027671 Ga0209588_1046284 Ga0209588_10462841 255
392 3300027907 Ga0207428_10000306 Ga0207428_100003065 255
393 3300027907 Ga0207428_10122253 Ga0207428_101222532 255
394 3300028380 Ga0268265_10013821 Ga0268265_100138212 255
395 3300028381 Ga0268264_10125276 Ga0268264_101252763 255
396 3300028381 Ga0268264_10169374 Ga0268264_101693742 255
397 3300028381 Ga0268264_10220775 Ga0268264_102207752 255
398 3300028800 Ga0265338_10308713 Ga0265338_103087132 255
399 3300035084 Ga0373928_0009609 Ga0373928_0009609_922_1695 255
400 3300035088 Ga0373940_0024257 Ga0373940_0024257_640_1413 255
401 3300035242 Ga0373962_0091738 Ga0373962_0091738_58_831 255
402 3300035691 Ga0373931_0076164 Ga0373931_0076164_141_914 255
403 3300035724 Ga0373933_0014511 Ga0373933_0014511_1015_1782 255
404 3300036401 Ga0373937_0010429 Ga0373937_0010429_2711_3478 255
405 3300037068 Ga0373925_0061538 Ga0373925_0061538_102_890 255
406 3300039437 Ga0436365_1726913 Ga0436365_1726913_35_814 255
407 3300039438 Ga0436360_0006704 Ga0436360_0006704_74_853 255
408 3300039450 Ga0436363_1392304 Ga0436363_1392304_94_900 255
409 3300039453 Ga0436362_0160523 Ga0436362_0160523_65_844 255
410 3300042876 Ga0451577_0024275 Ga0451577_0024275_4255_5028 255
411 3300045051 Ga0451576_0366850 Ga0451576_0366850_344_1117 255
412 3300046454 Ga0495592_0059535 Ga0495592_0059535_1986_2753 255
413 3300046459 Ga0495629_0049860 Ga0495629_0049860_619_1407 255
414 3300046472 Ga0495580_0000672 Ga0495580_0000672_9213_9986 255
415 3300046477 Ga0495664_0008747 Ga0495664_0008747_1139_1906 255
416 3300046491 Ga0495584_0147585 Ga0495584_0147585_348_1115 255
417 3300046511 Ga0495608_0027798 Ga0495608_0027798_1309_2076 255
418 3300046514 Ga0495618_0196997 Ga0495618_0196997_397_1164 255
419 3300046516 Ga0495628_0042547 Ga0495628_0042547_341_1108 255
420 3300046516 Ga0495628_0115543 Ga0495628_0115543_1269_2036 255
421 3300046528 Ga0495642_0030920 Ga0495642_0030920_738_1511 255
422 3300046529 Ga0495652_0040259 Ga0495652_0040259_1151_1918 255
423 3300046531 Ga0495665_0157868 Ga0495665_0157868_212_979 255
424 3300046533 Ga0495640_0276322 Ga0495640_0276322_22_789 255
425 3300046535 Ga0495586_0059038 Ga0495586_0059038_1227_1994 255
426 3300046543 Ga0495645_0005511 Ga0495645_0005511_951_1718 255
427 3300046559 Ga0495667_0037898 Ga0495667_0037898_543_1310 255
428 3300046642 Ga0495634_0037813 Ga0495634_0037813_58_825 255
429 3300046663 Ga0495635_0016606 Ga0495635_0016606_3816_4583 255
430 3300046675 Ga0495657_0038057 Ga0495657_0038057_2316_3083 255
431 3300046678 Ga0495599_0020321 Ga0495599_0020321_2932_3699 255
432 3300046679 Ga0495623_0080099 Ga0495623_0080099_93_860 255
433 3300046680 Ga0495646_0009094 Ga0495646_0009094_910_1677 255
434 3300046809 Ga0495600_0159233 Ga0495600_0159233_559_1326 255
435 3300047317 Ga0495604_0017462 Ga0495604_0017462_4525_5292 255
436 3300047318 Ga0495636_0022914 Ga0495636_0022914_1264_2049 255
437 3300047319 Ga0495674_0030967 Ga0495674_0030967_3041_3808 255
438 3300048088 Ga0495602_0002925 Ga0495602_0002925_6142_6909 255
439 3300048903 Ga0496100_0023960 Ga0496100_0023960_2158_2934 255
440 3300048903 Ga0496100_0034245 Ga0496100_0034245_384_1172 255
441 3300048904 Ga0496101_0099064 Ga0496101_0099064_1135_1923 255
442 3300048905 Ga0496102_0289968 Ga0496102_0289968_577_1350 255
443 3300048906 Ga0496103_0002319 Ga0496103_0002319_10066_10833 255
444 3300048906 Ga0496103_0078874 Ga0496103_0078874_465_1253 255
445 3300048907 Ga0496104_0001788 Ga0496104_0001788_2312_3085 255
446 3300048907 Ga0496104_0003927 Ga0496104_0003927_10429_11217 255
447 3300048907 Ga0496104_0003988 Ga0496104_0003988_10822_11649 255
448 3300048907 Ga0496104_0004372 Ga0496104_0004372_3920_4693 255
449 3300048908 Ga0496105_0009312 Ga0496105_0009312_6042_6830 255
450 3300048908 Ga0496105_0019554 Ga0496105_0019554_4047_4820 255
451 3300048909 Ga0496106_0013206 Ga0496106_0013206_637_1413 255
452 3300048910 Ga0496107_0000537 Ga0496107_0000537_20180_20968 255
453 3300048910 Ga0496107_0070275 Ga0496107_0070275_522_1298 255
454 3300048911 Ga0496108_0000420 Ga0496108_0000420_15414_16202 255
455 3300048911 Ga0496108_0016721 Ga0496108_0016721_1657_2445 255
456 3300048912 Ga0496109_0022208 Ga0496109_0022208_188_976 255
457 3300048913 Ga0496110_0111903 Ga0496110_0111903_138_926 255
458 3300048914 Ga0496111_0000564 Ga0496111_0000564_11592_12380 255
459 3300048914 Ga0496111_0000797 Ga0496111_0000797_13453_14241 255
460 3300048914 Ga0496111_0414606 Ga0496111_0414606_207_980 255
461 3300048915 Ga0496112_0036763 Ga0496112_0036763_1150_1938 255
462 3300048915 Ga0496112_0096202 Ga0496112_0096202_489_1277 255
463 3300048916 Ga0496113_0000230 Ga0496113_0000230_5367_6155 255
464 3300048916 Ga0496113_0413143 Ga0496113_0413143_58_996 255
465 3300048917 Ga0496114_0024340 Ga0496114_0024340_415_1203 255
466 3300048917 Ga0496114_0317558 Ga0496114_0317558_489_1262 255
467 3300048917 Ga0496114_0342907 Ga0496114_0342907_501_1277 255
468 3300048918 Ga0496115_0000759 Ga0496115_0000759_7430_8206 255
469 3300048918 Ga0496115_0003181 Ga0496115_0003181_1352_2125 255
470 3300048918 Ga0496115_0010559 Ga0496115_0010559_1020_1793 255
471 3300048918 Ga0496115_0250400 Ga0496115_0250400_256_1044 255
472 3300049593 Ga0501077_0046035 Ga0501077_0046035_36_809 255
473 3300049744 Ga0501083_0198519 Ga0501083_0198519_519_1292 255
474 3300050492 nmdc:mga0yw44_165164_c1 nmdc:mga0yw44_165164_c1_451_1218 255
475 3300050507 nmdc:mga05p37_135164_c1 nmdc:mga05p37_135164_c1_901_1674 255
476 3300050507 nmdc:mga05p37_16817_c1 nmdc:mga05p37_16817_c1_7504_8277 255
477 3300050507 nmdc:mga05p37_400137_c1 nmdc:mga05p37_400137_c1_383_1156 255
478 3300050507 nmdc:mga05p37_5330_c1 nmdc:mga05p37_5330_c1_2967_3755 255
479 3300050507 nmdc:mga05p37_696657_c1 nmdc:mga05p37_696657_c1_230_1003 255
480 3300050508 nmdc:mga09592_3299_c1 nmdc:mga09592_3299_c1_3483_4256 255
481 3300050509 nmdc:mga0qj67_161053_c1 nmdc:mga0qj67_161053_c1_548_1321 255
482 3300050509 nmdc:mga0qj67_208932_c1 nmdc:mga0qj67_208932_c1_699_1472 255
483 3300050510 nmdc:mga06r32_134447_c1 nmdc:mga06r32_134447_c1_234_1007 255
484 3300050510 nmdc:mga06r32_153537_c1 nmdc:mga06r32_153537_c1_811_1584 255
485 3300050510 nmdc:mga06r32_36257_c2 nmdc:mga06r32_36257_c2_807_1595 255
486 3300050510 nmdc:mga06r32_373250_c1 nmdc:mga06r32_373250_c1_409_1182 255
487 3300050511 nmdc:mga08y16_322331_c1 nmdc:mga08y16_322331_c1_210_983 255
488 3300050511 nmdc:mga08y16_3500_c1 nmdc:mga08y16_3500_c1_2701_3474 255
489 3300050512 nmdc:mga0n895_15101_c1 nmdc:mga0n895_15101_c1_5409_6182 255
490 3300050512 nmdc:mga0n895_24489_c1 nmdc:mga0n895_24489_c1_3253_4041 255
491 3300050512 nmdc:mga0n895_4900_c1 nmdc:mga0n895_4900_c1_835_1608 255
492 3300050512 nmdc:mga0n895_7432_c1 nmdc:mga0n895_7432_c1_7639_8412 255
493 3300050512 nmdc:mga0n895_76045_c1 nmdc:mga0n895_76045_c1_2475_3248 255
494 3300050513 nmdc:mga0rr50_64555_c1 nmdc:mga0rr50_64555_c1_926_1699 255
495 3300050514 nmdc:mga08x19_195165_c1 nmdc:mga08x19_195165_c1_353_1126 255
496 3300050515 nmdc:mga0a205_22180_c1 nmdc:mga0a205_22180_c1_2194_2967 255
497 3300050515 nmdc:mga0a205_4204_c1 nmdc:mga0a205_4204_c1_10284_11057 255
498 3300050515 nmdc:mga0a205_588067_c1 nmdc:mga0a205_588067_c1_28_801 255
499 3300053077 Ga0495601_0004384 Ga0495601_0004384_3758_4525 255
500 3300053078 Ga0495612_0001013 Ga0495612_0001013_3842_4609 255
501 3300053084 Ga0495595_0094722 Ga0495595_0094722_487_1254 255
502 3300053085 Ga0495619_0290586 Ga0495619_0290586_211_978 255
503 3300053096 Ga0500641_0048887 Ga0500641_0048887_59_835 255
504 3300054114 Ga0501084_0168886 Ga0501084_0168886_174_947 255
505 3300060353 Ga0501082_0087162 Ga0501082_0087162_882_1655 255
506 3300061734 Ga0530510_0097914 Ga0530510_0097914_130_903 255
507 3300061734 Ga0530510_0262497 Ga0530510_0262497_80_853 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

72

309

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8875 7 250
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.8858 7 249
4u2e-assembly1.cif.gz_A crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution 0.8824 7 249
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.8808 7 249
1ziy-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a 0.8805 7 249
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9345 1 247 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9269 1 247 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8651 7 249 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8643 2 250 3.40.50.1820
af_A0A0P0Y160_2_157_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8597 107 249 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V6XMQ1-F1-model_v4 Hydrolase 0.9912 1 135 GO:0016787
AF-A0A2D8PPN1-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9867 1 250 GO:0016787
AF-A0A2E8XQ64-F1-model_v4 Hydrolase 0.986 1 249 GO:0016787
AF-A0A2V7CP41-F1-model_v4 Hydrolase 0.984 1 254 GO:0016787
AF-A0A2E7QY26-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9832 1 251 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.13 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map