F456582

General Info

Members Datasets Scaffolds Average Seq Length
506 249 1012 209

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_1027270|Ga0496114_1027270_58_687
Length 209
Sequence VIRVRLFAGLRERAGWSERELDGIERVADVWSALGLGDEPAGLLYAVNLEYADKDAPLADGDEVALIPPVSGGAFVLTEEPIDPGRVIERVANDAAGGIATFIGTTRAHSRGRTVHYLEYEGYAGMAEKVMAELAEELKQRYDLCEVAIAHRTGRVDIGGISVAIAVSAPHRQDALAACKDAIDRLKEIVPLWKKEVYEGGEEWIGRGS

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 1.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.64
Rhizosphere 86.17
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_1027270 3300048917 Bacteria 708
2 Ga0070658_10033874 3300005327 Bacteria 4110
3 Ga0070683_100008896 3300005329 Bacteria 8555
4 Ga0070683_100536495 3300005329 Bacteria 1118
5 Ga0070680_100002720 3300005336 Bacteria 13110
6 Ga0070680_100055028 3300005336 Bacteria 3251
7 Ga0070680_100363785 3300005336 Bacteria 1230
8 Ga0068868_100233667 3300005338 Bacteria 1543
9 Ga0070660_100001150 3300005339 Bacteria 17854
10 Ga0070660_100090422 3300005339 Bacteria 2413
11 Ga0070661_100081223 3300005344 Bacteria 2393
12 Ga0070671_100037629 3300005355 Bacteria 4013
13 Ga0070688_100007864 3300005365 Bacteria 5762
14 Ga0070714_100011636 3300005435 Bacteria 6986
15 Ga0070714_100395933 3300005435 Bacteria 1304
16 Ga0070713_100064848 3300005436 Bacteria 3066
17 Ga0070710_10012430 3300005437 Bacteria 4229
18 Ga0070711_100004502 3300005439 Bacteria 8235
19 Ga0070700_100320905 3300005441 Unclassified 1138
20 Ga0070663_100154414 3300005455 Bacteria 1763
21 Ga0070663_100180827 3300005455 Archaea 1636
22 Ga0070678_100091487 3300005456 Bacteria 2335
23 Ga0070678_100281560 3300005456 Unclassified 1406
24 Ga0070678_100753873 3300005456 Unclassified 881
25 Ga0070662_100441689 3300005457 Unclassified 1079
26 Ga0070681_10030692 3300005458 Bacteria 5393
27 Ga0070681_10045698 3300005458 Bacteria 4380
28 Ga0070681_10083756 3300005458 Bacteria 3142
29 Ga0070681_10213098 3300005458 Bacteria 1848
30 Ga0068867_100537137 3300005459 Unclassified 1011
31 Ga0070706_100312402 3300005467 Bacteria 1466
32 Ga0070707_100422231 3300005468 Bacteria 1294
33 Ga0070679_100018672 3300005530 Bacteria 6731
34 Ga0070679_100348514 3300005530 Bacteria 1429
35 Ga0070684_100036645 3300005535 Bacteria 4204
36 Ga0070684_100041454 3300005535 Bacteria 3969
37 Ga0070684_100645792 3300005535 Unclassified 985
38 Ga0068853_100040947 3300005539 Bacteria 3955
39 Ga0068853_100170615 3300005539 Bacteria 1968
40 Ga0070686_100072874 3300005544 Bacteria 2253
41 Ga0070696_100061605 3300005546 Bacteria 2625
42 Ga0070693_100276904 3300005547 Bacteria 1122
43 Ga0068855_100269955 3300005563 Bacteria 1892
44 Ga0070664_100033940 3300005564 Bacteria 4278
45 Ga0070664_100383128 3300005564 Bacteria 1284
46 Ga0068857_100010590 3300005577 Bacteria 8017
47 Ga0068857_100393628 3300005577 Bacteria 1288
48 Ga0068856_100069757 3300005614 Bacteria 3476
49 Ga0068856_100074623 3300005614 Bacteria 3358
50 Ga0068856_100149702 3300005614 Bacteria 2342
51 Ga0068856_100368146 3300005614 Bacteria 1456
52 Ga0070702_100005594 3300005615 Bacteria 5876
53 Ga0070702_100227163 3300005615 Unclassified 1252
54 Ga0068852_100417308 3300005616 Bacteria 1323
55 Ga0068858_100126626 3300005842 Bacteria 2392
56 Ga0081455_10006773 3300005937 Bacteria 12226
57 Ga0081455_10009225 3300005937 Bacteria 10166
58 Ga0081455_10253746 3300005937 Bacteria 1285
59 Ga0081538_10020189 3300005981 Bacteria 4918
60 Ga0081538_10028835 3300005981 Bacteria 3807
61 Ga0081538_10063913 3300005981 Bacteria 2085
62 Ga0081540_1000879 3300005983 Bacteria 27145
63 Ga0081539_10006592 3300005985 Bacteria 11029
64 Ga0081539_10014665 3300005985 Bacteria 5770
65 Ga0070717_10014121 3300006028 Bacteria 6139
66 Ga0070717_10133104 3300006028 Bacteria 2140
67 Ga0075432_10078651 3300006058 Bacteria 1193
68 Ga0070712_100344734 3300006175 Bacteria 1217
69 Ga0097621_100009560 3300006237 Bacteria 7046
70 Ga0075433_10005010 3300006852 Bacteria 10376
71 Ga0075434_100001065 3300006871 Bacteria 22406
72 Ga0075434_100229028 3300006871 Bacteria 1878
73 Ga0075429_100279460 3300006880 Bacteria 1462
74 Ga0068865_100570326 3300006881 Bacteria 953
75 Ga0075435_100019833 3300007076 Bacteria 5144
76 Ga0075435_100120927 3300007076 Bacteria 2185
77 Ga0075435_100166781 3300007076 Bacteria 1857
78 Ga0105240_10094239 3300009093 Bacteria 3653
79 Ga0105240_10169129 3300009093 Bacteria 2590
80 Ga0105240_10810277 3300009093 Bacteria 1014
81 Ga0111539_10018561 3300009094 Bacteria 8616
82 Ga0111539_10103358 3300009094 Bacteria 3344
83 Ga0111539_10277177 3300009094 Bacteria 1951
84 Ga0111539_10420157 3300009094 Bacteria 1557
85 Ga0111539_10863251 3300009094 Bacteria 1053
86 Ga0105245_10024054 3300009098 Bacteria 5347
87 Ga0105245_10091925 3300009098 Bacteria 2794
88 Ga0105245_10093992 3300009098 Bacteria 2763
89 Ga0105245_10359199 3300009098 Bacteria 1445
90 Ga0105245_10718432 3300009098 Bacteria 1033
91 Ga0105247_10081293 3300009101 Bacteria 2042
92 Ga0114129_10237498 3300009147 Bacteria 2451
93 Ga0114129_10578423 3300009147 Bacteria 1458
94 Ga0105243_10038812 3300009148 Bacteria 3710
95 Ga0105243_10124314 3300009148 Bacteria 2180
96 Ga0105243_10153543 3300009148 Bacteria 1978
97 Ga0105243_10203127 3300009148 Bacteria 1739
98 Ga0105241_10045632 3300009174 Bacteria 3326
99 Ga0105241_10118728 3300009174 Bacteria 2126
100 Ga0105242_10020262 3300009176 Bacteria 5214
101 Ga0105242_10051514 3300009176 Bacteria 3355
102 Ga0105248_10067820 3300009177 Bacteria 4005
103 Ga0105237_10207845 3300009545 Bacteria 1958
104 Ga0105238_10740671 3300009551 Bacteria 996
105 Ga0105249_10020642 3300009553 Bacteria 5890
106 Ga0105239_10113679 3300010375 Bacteria 3002
107 Ga0105239_10161954 3300010375 Bacteria 2500
108 Ga0157370_10047125 3300013104 Bacteria 4132
109 Ga0157370_10156092 3300013104 Bacteria 2123
110 Ga0157369_10012915 3300013105 Bacteria 9465
111 Ga0157369_10807364 3300013105 Unclassified 964
112 Ga0157374_10193310 3300013296 Bacteria 1990
113 Ga0157378_10031822 3300013297 Bacteria 4659
114 Ga0157372_10323837 3300013307 Bacteria 1795
115 Ga0157372_10672855 3300013307 Bacteria 1205
116 Ga0157375_10055098 3300013308 Bacteria 3919
117 Ga0163163_10388897 3300014325 Bacteria 1452
118 Ga0157380_10020550 3300014326 Bacteria 4936
119 Ga0157377_10012085 3300014745 Bacteria 4331
120 Ga0157379_10218800 3300014968 Unclassified 1725
121 Ga0157376_10158266 3300014969 Bacteria 2050
122 Ga0197907_10794321 3300020069 Bacteria 1654
123 Ga0206356_10183902 3300020070 Bacteria 2074
124 Ga0206356_11202354 3300020070 Bacteria 2660
125 Ga0206352_11158438 3300020078 Bacteria 1120
126 Ga0206354_10130829 3300020081 Bacteria 1933
127 Ga0206354_10731355 3300020081 Bacteria 2152
128 Ga0206353_10147248 3300020082 Bacteria 4368
129 Ga0206353_10221561 3300020082 Bacteria 1702
130 Ga0206353_11542379 3300020082 Bacteria 2345
131 Ga0224712_10177801 3300022467 Unclassified 957
132 Ga0207692_10113691 3300025898 Unclassified 1505
133 Ga0207685_10134426 3300025905 Unclassified 1102
134 Ga0207699_10011954 3300025906 Bacteria 4401
135 Ga0207699_10083096 3300025906 Bacteria 1991
136 Ga0207705_10077093 3300025909 Bacteria 2424
137 Ga0207684_10157146 3300025910 Bacteria 1957
138 Ga0207654_10122823 3300025911 Bacteria 1633
139 Ga0207707_10009579 3300025912 Bacteria 8404
140 Ga0207707_10061475 3300025912 Bacteria 3268
141 Ga0207707_10076503 3300025912 Bacteria 2921
142 Ga0207695_10457753 3300025913 Archaea 1159
143 Ga0207695_10495332 3300025913 Bacteria 1104
144 Ga0207693_10274940 3300025915 Bacteria 1320
145 Ga0207663_10067594 3300025916 Bacteria 2292
146 Ga0207663_10116844 3300025916 Bacteria 1819
147 Ga0207663_10604317 3300025916 Bacteria 862
148 Ga0207660_10027263 3300025917 Bacteria 3896
149 Ga0207660_10088123 3300025917 Unclassified 2294
150 Ga0207660_10120206 3300025917 Bacteria 1989
151 Ga0207657_10000073 3300025919 Bacteria 93299
152 Ga0207657_10007410 3300025919 Bacteria 11251
153 Ga0207657_10010451 3300025919 Bacteria 9260
154 Ga0207657_10218050 3300025919 Bacteria 1529
155 Ga0207649_10325142 3300025920 Unclassified 1131
156 Ga0207652_10066272 3300025921 Bacteria 3129
157 Ga0207652_10390190 3300025921 Bacteria 1256
158 Ga0207646_10057432 3300025922 Bacteria 3476
159 Ga0207646_10437051 3300025922 Bacteria 1181
160 Ga0207687_10061671 3300025927 Bacteria 2649
161 Ga0207700_10512340 3300025928 Bacteria 1062
162 Ga0207664_10069715 3300025929 Bacteria 2827
163 Ga0207664_10287059 3300025929 Bacteria 1445
164 Ga0207644_10111892 3300025931 Bacteria 2066
165 Ga0207644_10326016 3300025931 Bacteria 1243
166 Ga0207690_10204945 3300025932 Unclassified 1500
167 Ga0207706_10414453 3300025933 Unclassified 1167
168 Ga0207686_10018205 3300025934 Bacteria 3973
169 Ga0207665_10007017 3300025939 Bacteria 7459
170 Ga0207661_10063894 3300025944 Bacteria 2982
171 Ga0207661_10121149 3300025944 Bacteria 2227
172 Ga0207661_10430392 3300025944 Bacteria 1199
173 Ga0207679_10010622 3300025945 Bacteria 5933
174 Ga0207667_10056660 3300025949 Bacteria 4116
175 Ga0207667_10354009 3300025949 Bacteria 1497
176 Ga0207677_10071366 3300026023 Bacteria 2451
177 Ga0207678_10070235 3300026067 Bacteria 3003
178 Ga0207678_10128258 3300026067 Archaea 2164
179 Ga0207708_10333879 3300026075 Bacteria 1240
180 Ga0207708_10658048 3300026075 Bacteria 892
181 Ga0207702_10028039 3300026078 Bacteria 4679
182 Ga0207702_10058086 3300026078 Bacteria 3291
183 Ga0207702_10267332 3300026078 Bacteria 1612
184 Ga0207702_10370822 3300026078 Bacteria 1374
185 Ga0207702_11155132 3300026078 Bacteria 768
186 Ga0207674_10006120 3300026116 Bacteria 14228
187 Ga0207674_10008345 3300026116 Bacteria 11985
188 Ga0207674_10161216 3300026116 Bacteria 2197
189 Ga0207674_10381212 3300026116 Bacteria 1363
190 Ga0207683_10115547 3300026121 Bacteria 2406
191 Ga0207683_10172074 3300026121 Bacteria 1961
192 Ga0207698_10127411 3300026142 Bacteria 2168
193 Ga0207698_10181670 3300026142 Bacteria 1864
194 Ga0207428_10064774 3300027907 Bacteria 2885
195 Ga0265326_10136423 3300028558 Unclassified 700
196 Ga0265334_10211933 3300028573 Unclassified 671
197 Ga0265318_10051438 3300028577 Bacteria 1547
198 Ga0265322_10001265 3300028654 Bacteria 8532
199 Ga0265322_10079831 3300028654 Bacteria 928
200 Ga0265338_10015400 3300028800 Bacteria 8404
201 Ga0265330_10048874 3300031235 Bacteria 1860
202 Ga0265329_10028077 3300031242 Unclassified 1847
203 Ga0265340_10068546 3300031247 Bacteria 1685
204 Ga0265331_10106898 3300031250 Unclassified 1285
205 Ga0265327_10010339 3300031251 Bacteria 6577
206 Ga0265316_10147941 3300031344 Bacteria 1760
207 Ga0307408_100077502 3300031548 Bacteria 2475
208 Ga0265313_10024153 3300031595 Bacteria 3254
209 Ga0265342_10078432 3300031712 Bacteria 1911
210 Ga0307410_10114946 3300031852 Bacteria 1953
211 Ga0307407_10047218 3300031903 Bacteria 2442
212 Ga0307409_100474054 3300031995 Bacteria 1213
213 Ga0307416_100003506 3300032002 Bacteria 9231
214 Ga0307411_10290756 3300032005 Bacteria 1306
215 Ga0307415_100035286 3300032126 Bacteria 3265
216 Ga0373948_0025574 3300034817 Unclassified 1159
217 Ga0373944_0110368 3300035089 Bacteria 938
218 Ga0373923_0044530 3300035111 Bacteria 1840
219 Ga0373936_0008885 3300035113 Bacteria 3787
220 Ga0373936_0056089 3300035113 Bacteria 1601
221 Ga0373945_0047571 3300035116 Bacteria 1569
222 Ga0373945_0132524 3300035116 Unclassified 999
223 Ga0373953_0115422 3300035117 Bacteria 1138
224 Ga0373957_0025347 3300035120 Bacteria 2136
225 Ga0373943_0236883 3300035170 Bacteria 1021
226 Ga0373946_0018176 3300035171 Bacteria 2697
227 Ga0373946_0081361 3300035171 Bacteria 1419
228 Ga0373955_0022889 3300035172 Bacteria 3176
229 Ga0373935_0036694 3300035692 Bacteria 3066
230 Ga0373947_0001078 3300035725 Bacteria 16728
231 Ga0373947_0009634 3300035725 Bacteria 5545
232 Ga0373947_0056691 3300035725 Bacteria 2369
233 Ga0373937_0052139 3300036401 Bacteria 3750
234 Ga0373925_0033334 3300037068 Bacteria 3796
235 Ga0395899_0001344 3300037312 Bacteria 21142
236 Ga0395899_0001377 3300037312 Bacteria 20868
237 Ga0395899_0004760 3300037312 Bacteria 10583
238 Ga0395899_0010602 3300037312 Bacteria 7063
239 Ga0395899_0010686 3300037312 Bacteria 7036
240 Ga0395899_0012890 3300037312 Bacteria 6400
241 Ga0395899_0022841 3300037312 Bacteria 4739
242 Ga0395899_0087641 3300037312 Unclassified 2259
243 Ga0395899_0100560 3300037312 Bacteria 2088
244 Ga0395899_0135854 3300037312 Bacteria 1753
245 Ga0395899_0192897 3300037312 Bacteria 1425
246 Ga0395899_0208755 3300037312 Bacteria 1358
247 Ga0395899_0247632 3300037312 Bacteria 1224
248 Ga0395899_0416041 3300037312 Bacteria 887
249 Ga0395900_0001062 3300037418 Bacteria 35070
250 Ga0395900_0001957 3300037418 Bacteria 23259
251 Ga0395900_0004227 3300037418 Bacteria 15243
252 Ga0395900_0010355 3300037418 Bacteria 9540
253 Ga0395900_0039199 3300037418 Bacteria 4881
254 Ga0395900_0078523 3300037418 Bacteria 3391
255 Ga0395900_0080483 3300037418 Bacteria 3347
256 Ga0395900_0135943 3300037418 Bacteria 2518
257 Ga0395900_0188076 3300037418 Bacteria 2095
258 Ga0395900_0214666 3300037418 Bacteria 1942
259 Ga0395900_0231970 3300037418 Unclassified 1856
260 Ga0395900_0401281 3300037418 Unclassified 1335
261 Ga0395900_0430976 3300037418 Bacteria 1278
262 Ga0395900_0898479 3300037418 Bacteria 809
263 Ga0395898_0003337 3300037466 Bacteria 18019
264 Ga0395898_0005913 3300037466 Bacteria 13148
265 Ga0395898_0007483 3300037466 Bacteria 11598
266 Ga0395898_0009677 3300037466 Bacteria 10110
267 Ga0395898_0013851 3300037466 Bacteria 8287
268 Ga0395898_0021244 3300037466 Bacteria 6583
269 Ga0395898_0026968 3300037466 Bacteria 5772
270 Ga0395898_0027850 3300037466 Bacteria 5667
271 Ga0395898_0056655 3300037466 Bacteria 3820
272 Ga0395898_0085526 3300037466 Viruses 3039
273 Ga0395898_0108458 3300037466 Bacteria 2662
274 Ga0395898_0109747 3300037466 Bacteria 2644
275 Ga0395898_0115485 3300037466 Bacteria 2572
276 Ga0395898_0115839 3300037466 Bacteria 2568
277 Ga0395898_0153695 3300037466 Bacteria 2202
278 Ga0395898_0172780 3300037466 Bacteria 2066
279 Ga0395898_0217970 3300037466 Bacteria 1820
280 Ga0395898_0812545 3300037466 Bacteria 875
281 Ga0395905_0002461 3300037471 Bacteria 20514
282 Ga0395905_0009906 3300037471 Bacteria 9287
283 Ga0395905_0010445 3300037471 Bacteria 9032
284 Ga0395905_0016491 3300037471 Bacteria 7023
285 Ga0395905_0016950 3300037471 Bacteria 6916
286 Ga0395905_0019036 3300037471 Bacteria 6512
287 Ga0395905_0035585 3300037471 Bacteria 4676
288 Ga0395905_0044766 3300037471 Bacteria 4152
289 Ga0395905_0063717 3300037471 Bacteria 3449
290 Ga0395905_0081900 3300037471 Bacteria 3024
291 Ga0395905_0231787 3300037471 Bacteria 1727
292 Ga0395905_0273772 3300037471 Bacteria 1574
293 Ga0436364_0516905 3300037853 Unclassified 2049
294 Ga0395901_0007137 3300038443 Bacteria 11279
295 Ga0395901_0014134 3300038443 Bacteria 8127
296 Ga0395901_0015599 3300038443 Bacteria 7738
297 Ga0395901_0016351 3300038443 Bacteria 7555
298 Ga0395901_0020747 3300038443 Bacteria 6726
299 Ga0395901_0057607 3300038443 Bacteria 4041
300 Ga0395901_0061064 3300038443 Bacteria 3922
301 Ga0395901_0103483 3300038443 Bacteria 2987
302 Ga0395901_0127645 3300038443 Bacteria 2673
303 Ga0395901_0135311 3300038443 Bacteria 2590
304 Ga0395901_0151084 3300038443 Bacteria 2440
305 Ga0395901_0292069 3300038443 Bacteria 1691
306 Ga0395901_0618912 3300038443 Unclassified 1090
307 Ga0395901_0645526 3300038443 Unclassified 1062
308 Ga0395901_0753904 3300038443 Unclassified 966
309 Ga0439448_0007262 3300042005 Bacteria 3206
310 Ga0439440_0028559 3300042993 Bacteria 1303
311 Ga0466966_0053881 3300044684 Bacteria 2551
312 Ga0466966_0335698 3300044684 Bacteria 908
313 Ga0466966_0359480 3300044684 Bacteria 875
314 Ga0466966_0396981 3300044684 Bacteria 829
315 Ga0466961_0040835 3300044693 Bacteria 2974
316 Ga0466961_0136647 3300044693 Bacteria 1536
317 Ga0466963_0036511 3300044694 Bacteria 3206
318 Ga0466963_0075181 3300044694 Bacteria 2279
319 Ga0466963_0264736 3300044694 Bacteria 1207
320 Ga0466964_0013381 3300044706 Bacteria 3113
321 Ga0466968_0006069 3300044735 Bacteria 4537
322 Ga0466970_0096261 3300044765 Bacteria 1610
323 Ga0466960_0056249 3300044901 Bacteria 1915
324 Ga0466959_0123919 3300045049 Bacteria 1835
325 Ga0466959_0149020 3300045049 Bacteria 1650
326 Ga0466958_0014777 3300045836 Bacteria 4461
327 Ga0466967_0184290 3300045976 Bacteria 1970
328 Ga0466967_0350152 3300045976 Unclassified 1429
329 Ga0466967_0450654 3300045976 Bacteria 1257
330 Ga0466967_0727603 3300045976 Bacteria 983
331 Ga0466967_0935263 3300045976 Unclassified 862
332 Ga0495592_0176559 3300046454 Bacteria 1458
333 Ga0495603_0000530 3300046455 Bacteria 21149
334 Ga0495629_0084605 3300046459 Unclassified 2213
335 Ga0495629_0160789 3300046459 Unclassified 1560
336 Ga0495629_0411122 3300046459 Unclassified 919
337 Ga0495641_0000685 3300046461 Bacteria 28551
338 Ga0495641_0051231 3300046461 Unclassified 1886
339 Ga0495641_0153151 3300046461 Bacteria 1031
340 Ga0495651_0008427 3300046462 Bacteria 7901
341 Ga0495651_0013329 3300046462 Bacteria 6359
342 Ga0495653_0044000 3300046463 Bacteria 3468
343 Ga0495653_0063750 3300046463 Bacteria 2779
344 Ga0495582_0025794 3300046473 Bacteria 3220
345 Ga0495582_0352776 3300046473 Unclassified 847
346 Ga0495605_0220448 3300046474 Bacteria 820
347 Ga0495639_0281266 3300046475 Unclassified 827
348 Ga0495664_0043175 3300046477 Bacteria 2671
349 Ga0495584_0142545 3300046491 Bacteria 1217
350 Ga0495585_0375845 3300046492 Bacteria 687
351 Ga0495594_0001295 3300046499 Bacteria 13051
352 Ga0495608_0026725 3300046511 Bacteria 3933
353 Ga0495608_0059544 3300046511 Bacteria 2515
354 Ga0495628_0102544 3300046516 Bacteria 2207
355 Ga0495630_0000487 3300046517 Bacteria 29460
356 Ga0495630_0034154 3300046517 Bacteria 3796
357 Ga0495630_0165586 3300046517 Unclassified 1683
358 Ga0495663_0049594 3300046525 Bacteria 1297
359 Ga0495666_0276777 3300046526 Bacteria 761
360 Ga0495652_0136662 3300046529 Bacteria 1933
361 Ga0495665_0035500 3300046531 Bacteria 2663
362 Ga0495640_0042820 3300046533 Bacteria 3156
363 Ga0495587_0092350 3300046536 Bacteria 1748
364 Ga0495634_0013923 3300046642 Bacteria 5813
365 Ga0495635_0043331 3300046663 Bacteria 3106
366 Ga0495635_0049968 3300046663 Bacteria 2883
367 Ga0495661_0224300 3300046665 Bacteria 972
368 Ga0495588_0007467 3300046674 Bacteria 4977
369 Ga0495657_0104103 3300046675 Unclassified 1805
370 Ga0495657_0174207 3300046675 Unclassified 1323
371 Ga0495657_0271467 3300046675 Unclassified 1017
372 Ga0495599_0052563 3300046678 Bacteria 2552
373 Ga0495599_0192855 3300046678 Archaea 1253
374 Ga0495623_0020005 3300046679 Bacteria 4327
375 Ga0495646_0119141 3300046680 Unclassified 1495
376 Ga0495646_0146380 3300046680 Bacteria 1317
377 Ga0495647_0121665 3300046681 Unclassified 1098
378 Ga0495658_0043100 3300046683 Archaea 2522
379 Ga0495658_0080912 3300046683 Bacteria 1906
380 Ga0495613_0056022 3300046689 Bacteria 2895
381 Ga0495613_0189497 3300046689 Unclassified 1454
382 Ga0495624_0255897 3300046690 Bacteria 1059
383 Ga0495600_0072662 3300046809 Bacteria 2246
384 Ga0495581_0009975 3300047315 Bacteria 5493
385 Ga0495674_0016943 3300047319 Bacteria 6792
386 Ga0495676_0083533 3300047321 Unclassified 2413
387 Ga0495676_0313152 3300047321 Bacteria 1056
388 Ga0495680_0002804 3300047322 Bacteria 17542
389 Ga0495680_0053126 3300047322 Bacteria 3155
390 Ga0495675_0058995 3300047444 Bacteria 2433
391 Ga0495684_0029328 3300047471 Bacteria 4223
392 Ga0495684_0208095 3300047471 Unclassified 1440
393 Ga0496100_0496306 3300048903 Bacteria 940
394 Ga0496101_0027467 3300048904 Bacteria 3965
395 Ga0496101_0081788 3300048904 Bacteria 2390
396 Ga0496101_0143192 3300048904 Unclassified 1824
397 Ga0496101_0348766 3300048904 Bacteria 1163
398 Ga0496101_0570787 3300048904 Bacteria 894
399 Ga0496102_0031120 3300048905 Bacteria 4784
400 Ga0496102_0122490 3300048905 Unclassified 2429
401 Ga0496102_0257507 3300048905 Unclassified 1645
402 Ga0496102_0279917 3300048905 Bacteria 1572
403 Ga0496103_0039221 3300048906 Bacteria 2910
404 Ga0496103_0052578 3300048906 Bacteria 2523
405 Ga0496103_0379005 3300048906 Bacteria 909
406 Ga0496103_0514576 3300048906 Unclassified 765
407 Ga0496104_0007978 3300048907 Bacteria 9390
408 Ga0496104_0066935 3300048907 Bacteria 3411
409 Ga0496104_0380359 3300048907 Bacteria 1324
410 Ga0496104_0485660 3300048907 Bacteria 1146
411 Ga0496105_0053524 3300048908 Bacteria 3333
412 Ga0496105_0068165 3300048908 Bacteria 2938
413 Ga0496105_0237312 3300048908 Bacteria 1480
414 Ga0496105_0746629 3300048908 Bacteria 748
415 Ga0496106_0051609 3300048909 Bacteria 3101
416 Ga0496106_0079177 3300048909 Bacteria 2523
417 Ga0496106_0089749 3300048909 Bacteria 2371
418 Ga0496106_0236600 3300048909 Bacteria 1459
419 Ga0496106_0437239 3300048909 Bacteria 1051
420 Ga0496107_0003366 3300048910 Bacteria 10686
421 Ga0496107_0149002 3300048910 Bacteria 1730
422 Ga0496107_0299128 3300048910 Bacteria 1198
423 Ga0496108_0018030 3300048911 Bacteria 5775
424 Ga0496109_0096811 3300048912 Bacteria 2734
425 Ga0496109_0175516 3300048912 Bacteria 2011
426 Ga0496110_0007848 3300048913 Bacteria 8550
427 Ga0496110_0080254 3300048913 Bacteria 2906
428 Ga0496110_0188428 3300048913 Bacteria 1873
429 Ga0496110_0381062 3300048913 Bacteria 1285
430 Ga0496110_0732223 3300048913 Unclassified 891
431 Ga0496110_0795542 3300048913 Unclassified 850
432 Ga0496111_0063714 3300048914 Bacteria 2673
433 Ga0496111_0079362 3300048914 Bacteria 2394
434 Ga0496111_0328978 3300048914 Bacteria 1131
435 Ga0496111_0576374 3300048914 Unclassified 825
436 Ga0496111_0674605 3300048914 Unclassified 753
437 Ga0496111_0707059 3300048914 Bacteria 733
438 Ga0496112_0003369 3300048915 Bacteria 13195
439 Ga0496112_0010589 3300048915 Bacteria 8377
440 Ga0496112_0069678 3300048915 Bacteria 3474
441 Ga0496112_0081005 3300048915 Bacteria 3210
442 Ga0496112_0086397 3300048915 Bacteria 3103
443 Ga0496112_0220818 3300048915 Bacteria 1851
444 Ga0496112_0318971 3300048915 Bacteria 1498
445 Ga0496112_0475456 3300048915 Bacteria 1186
446 Ga0496112_0533296 3300048915 Unclassified 1108
447 Ga0496113_0091490 3300048916 Bacteria 2345
448 Ga0496113_0447728 3300048916 Bacteria 1037
449 Ga0496113_0575899 3300048916 Bacteria 902
450 Ga0496114_0048408 3300048917 Bacteria 3536
451 Ga0496114_0339979 3300048917 Bacteria 1327
452 Ga0496114_0371088 3300048917 Bacteria 1266
453 Ga0496114_0502692 3300048917 Bacteria 1072
454 Ga0496114_0767262 3300048917 Unclassified 842
455 Ga0496115_0035761 3300048918 Bacteria 3931
456 Ga0496115_0091034 3300048918 Bacteria 2492
457 Ga0496115_0122702 3300048918 Bacteria 2138
458 Ga0496115_0223800 3300048918 Bacteria 1553
459 Ga0496115_0295158 3300048918 Bacteria 1329
460 Ga0496115_0357440 3300048918 Bacteria 1190
461 Ga0501033_0038712 3300049570 Bacteria 3562
462 Ga0501038_0036403 3300049574 Bacteria 4319
463 Ga0501039_0068655 3300049575 Bacteria 2751
464 Ga0501040_0081060 3300049576 Bacteria 2248
465 Ga0501040_0227411 3300049576 Bacteria 1328
466 Ga0501042_0082105 3300049578 Bacteria 2311
467 Ga0501042_0167016 3300049578 Bacteria 1588
468 Ga0501043_0026719 3300049579 Bacteria 4528
469 Ga0501048_0024861 3300049582 Bacteria 4368
470 Ga0501067_0092169 3300049583 Bacteria 1682
471 Ga0501068_0006768 3300049584 Bacteria 6332
472 Ga0501069_0004710 3300049585 Bacteria 7050
473 Ga0501069_0261288 3300049585 Bacteria 1011
474 Ga0501070_0001858 3300049586 Bacteria 18636
475 Ga0501070_0098658 3300049586 Bacteria 2416
476 Ga0501070_0266838 3300049586 Bacteria 1398
477 Ga0501072_0030621 3300049588 Bacteria 4209
478 Ga0501073_0010594 3300049589 Bacteria 6745
479 Ga0501074_0072260 3300049590 Bacteria 2478
480 Ga0501075_0017968 3300049591 Bacteria 5110
481 Ga0501076_0050768 3300049592 Bacteria 3282
482 Ga0501077_0113282 3300049593 Unclassified 1719
483 Ga0501080_0034302 3300049742 Bacteria 4736
484 Ga0501080_0193239 3300049742 Bacteria 1870
485 Ga0501080_0273374 3300049742 Bacteria 1537
486 Ga0501083_0000504 3300049744 Bacteria 24936
487 Ga0501035_0004918 3300049822 Bacteria 12674
488 Ga0501044_0202040 3300049823 Unclassified 1945
489 nmdc:mga05p37_103024_c1 3300050507 Bacteria 3514
490 nmdc:mga05p37_499152_c1 3300050507 Unclassified 1397
491 nmdc:mga08y16_195375_c1 3300050511 Bacteria 2097
492 nmdc:mga08y16_27317_c1 3300050511 Bacteria 6012
493 nmdc:mga0n895_14068_c1 3300050512 Bacteria 7253
494 nmdc:mga0n895_590801_c1 3300050512 Bacteria 1113
495 nmdc:mga0n895_671651_c1 3300050512 Bacteria 1033
496 nmdc:mga0n895_95944_c1 3300050512 Bacteria 2970
497 nmdc:mga0rr50_14669_c1 3300050513 Bacteria 5147
498 nmdc:mga0rr50_348976_c1 3300050513 Bacteria 1244
499 nmdc:mga0rr50_9412_c1 3300050513 Bacteria 6140
500 nmdc:mga0a205_3140_c1 3300050515 Bacteria 14650
501 Ga0495595_0004330 3300053084 Bacteria 5713
502 Ga0495619_0064977 3300053085 Bacteria 2433
503 Ga0501084_0091573 3300054114 Bacteria 2552
504 Ga0501084_0303215 3300054114 Bacteria 1349
505 Ga0501082_0084113 3300060353 Bacteria 2744
506 Ga0501082_0379310 3300060353 Unclassified 1234
507 Ga0496114_1027270
508 Ga0070658_10033874
509 Ga0070683_100008896
510 Ga0070683_100536495
511 Ga0070680_100002720
512 Ga0070680_100055028
513 Ga0070680_100363785
514 Ga0068868_100233667
515 Ga0070660_100001150
516 Ga0070660_100090422
517 Ga0070661_100081223
518 Ga0070671_100037629
519 Ga0070688_100007864
520 Ga0070714_100011636
521 Ga0070714_100395933
522 Ga0070713_100064848
523 Ga0070710_10012430
524 Ga0070711_100004502
525 Ga0070700_100320905
526 Ga0070663_100154414
527 Ga0070663_100180827
528 Ga0070678_100091487
529 Ga0070678_100281560
530 Ga0070678_100753873
531 Ga0070662_100441689
532 Ga0070681_10030692
533 Ga0070681_10045698
534 Ga0070681_10083756
535 Ga0070681_10213098
536 Ga0068867_100537137
537 Ga0070706_100312402
538 Ga0070707_100422231
539 Ga0070679_100018672
540 Ga0070679_100348514
541 Ga0070684_100036645
542 Ga0070684_100041454
543 Ga0070684_100645792
544 Ga0068853_100040947
545 Ga0068853_100170615
546 Ga0070686_100072874
547 Ga0070696_100061605
548 Ga0070693_100276904
549 Ga0068855_100269955
550 Ga0070664_100033940
551 Ga0070664_100383128
552 Ga0068857_100010590
553 Ga0068857_100393628
554 Ga0068856_100069757
555 Ga0068856_100074623
556 Ga0068856_100149702
557 Ga0068856_100368146
558 Ga0070702_100005594
559 Ga0070702_100227163
560 Ga0068852_100417308
561 Ga0068858_100126626
562 Ga0081455_10006773
563 Ga0081455_10009225
564 Ga0081455_10253746
565 Ga0081538_10020189
566 Ga0081538_10028835
567 Ga0081538_10063913
568 Ga0081540_1000879
569 Ga0081539_10006592
570 Ga0081539_10014665
571 Ga0070717_10014121
572 Ga0070717_10133104
573 Ga0075432_10078651
574 Ga0070712_100344734
575 Ga0097621_100009560
576 Ga0075433_10005010
577 Ga0075434_100001065
578 Ga0075434_100229028
579 Ga0075429_100279460
580 Ga0068865_100570326
581 Ga0075435_100019833
582 Ga0075435_100120927
583 Ga0075435_100166781
584 Ga0105240_10094239
585 Ga0105240_10169129
586 Ga0105240_10810277
587 Ga0111539_10018561
588 Ga0111539_10103358
589 Ga0111539_10277177
590 Ga0111539_10420157
591 Ga0111539_10863251
592 Ga0105245_10024054
593 Ga0105245_10091925
594 Ga0105245_10093992
595 Ga0105245_10359199
596 Ga0105245_10718432
597 Ga0105247_10081293
598 Ga0114129_10237498
599 Ga0114129_10578423
600 Ga0105243_10038812
601 Ga0105243_10124314
602 Ga0105243_10153543
603 Ga0105243_10203127
604 Ga0105241_10045632
605 Ga0105241_10118728
606 Ga0105242_10020262
607 Ga0105242_10051514
608 Ga0105248_10067820
609 Ga0105237_10207845
610 Ga0105238_10740671
611 Ga0105249_10020642
612 Ga0105239_10113679
613 Ga0105239_10161954
614 Ga0157370_10047125
615 Ga0157370_10156092
616 Ga0157369_10012915
617 Ga0157369_10807364
618 Ga0157374_10193310
619 Ga0157378_10031822
620 Ga0157372_10323837
621 Ga0157372_10672855
622 Ga0157375_10055098
623 Ga0163163_10388897
624 Ga0157380_10020550
625 Ga0157377_10012085
626 Ga0157379_10218800
627 Ga0157376_10158266
628 Ga0197907_10794321
629 Ga0206356_10183902
630 Ga0206356_11202354
631 Ga0206352_11158438
632 Ga0206354_10130829
633 Ga0206354_10731355
634 Ga0206353_10147248
635 Ga0206353_10221561
636 Ga0206353_11542379
637 Ga0224712_10177801
638 Ga0207692_10113691
639 Ga0207685_10134426
640 Ga0207699_10011954
641 Ga0207699_10083096
642 Ga0207705_10077093
643 Ga0207684_10157146
644 Ga0207654_10122823
645 Ga0207707_10009579
646 Ga0207707_10061475
647 Ga0207707_10076503
648 Ga0207695_10457753
649 Ga0207695_10495332
650 Ga0207693_10274940
651 Ga0207663_10067594
652 Ga0207663_10116844
653 Ga0207663_10604317
654 Ga0207660_10027263
655 Ga0207660_10088123
656 Ga0207660_10120206
657 Ga0207657_10000073
658 Ga0207657_10007410
659 Ga0207657_10010451
660 Ga0207657_10218050
661 Ga0207649_10325142
662 Ga0207652_10066272
663 Ga0207652_10390190
664 Ga0207646_10057432
665 Ga0207646_10437051
666 Ga0207687_10061671
667 Ga0207700_10512340
668 Ga0207664_10069715
669 Ga0207664_10287059
670 Ga0207644_10111892
671 Ga0207644_10326016
672 Ga0207690_10204945
673 Ga0207706_10414453
674 Ga0207686_10018205
675 Ga0207665_10007017
676 Ga0207661_10063894
677 Ga0207661_10121149
678 Ga0207661_10430392
679 Ga0207679_10010622
680 Ga0207667_10056660
681 Ga0207667_10354009
682 Ga0207677_10071366
683 Ga0207678_10070235
684 Ga0207678_10128258
685 Ga0207708_10333879
686 Ga0207708_10658048
687 Ga0207702_10028039
688 Ga0207702_10058086
689 Ga0207702_10267332
690 Ga0207702_10370822
691 Ga0207702_11155132
692 Ga0207674_10006120
693 Ga0207674_10008345
694 Ga0207674_10161216
695 Ga0207674_10381212
696 Ga0207683_10115547
697 Ga0207683_10172074
698 Ga0207698_10127411
699 Ga0207698_10181670
700 Ga0207428_10064774
701 Ga0265326_10136423
702 Ga0265334_10211933
703 Ga0265318_10051438
704 Ga0265322_10001265
705 Ga0265322_10079831
706 Ga0265338_10015400
707 Ga0265330_10048874
708 Ga0265329_10028077
709 Ga0265340_10068546
710 Ga0265331_10106898
711 Ga0265327_10010339
712 Ga0265316_10147941
713 Ga0307408_100077502
714 Ga0265313_10024153
715 Ga0265342_10078432
716 Ga0307410_10114946
717 Ga0307407_10047218
718 Ga0307409_100474054
719 Ga0307416_100003506
720 Ga0307411_10290756
721 Ga0307415_100035286
722 Ga0373948_0025574
723 Ga0373944_0110368
724 Ga0373923_0044530
725 Ga0373936_0008885
726 Ga0373936_0056089
727 Ga0373945_0047571
728 Ga0373945_0132524
729 Ga0373953_0115422
730 Ga0373957_0025347
731 Ga0373943_0236883
732 Ga0373946_0018176
733 Ga0373946_0081361
734 Ga0373955_0022889
735 Ga0373935_0036694
736 Ga0373947_0001078
737 Ga0373947_0009634
738 Ga0373947_0056691
739 Ga0373937_0052139
740 Ga0373925_0033334
741 Ga0395899_0001344
742 Ga0395899_0001377
743 Ga0395899_0004760
744 Ga0395899_0010602
745 Ga0395899_0010686
746 Ga0395899_0012890
747 Ga0395899_0022841
748 Ga0395899_0087641
749 Ga0395899_0100560
750 Ga0395899_0135854
751 Ga0395899_0192897
752 Ga0395899_0208755
753 Ga0395899_0247632
754 Ga0395899_0416041
755 Ga0395900_0001062
756 Ga0395900_0001957
757 Ga0395900_0004227
758 Ga0395900_0010355
759 Ga0395900_0039199
760 Ga0395900_0078523
761 Ga0395900_0080483
762 Ga0395900_0135943
763 Ga0395900_0188076
764 Ga0395900_0214666
765 Ga0395900_0231970
766 Ga0395900_0401281
767 Ga0395900_0430976
768 Ga0395900_0898479
769 Ga0395898_0003337
770 Ga0395898_0005913
771 Ga0395898_0007483
772 Ga0395898_0009677
773 Ga0395898_0013851
774 Ga0395898_0021244
775 Ga0395898_0026968
776 Ga0395898_0027850
777 Ga0395898_0056655
778 Ga0395898_0085526
779 Ga0395898_0108458
780 Ga0395898_0109747
781 Ga0395898_0115485
782 Ga0395898_0115839
783 Ga0395898_0153695
784 Ga0395898_0172780
785 Ga0395898_0217970
786 Ga0395898_0812545
787 Ga0395905_0002461
788 Ga0395905_0009906
789 Ga0395905_0010445
790 Ga0395905_0016491
791 Ga0395905_0016950
792 Ga0395905_0019036
793 Ga0395905_0035585
794 Ga0395905_0044766
795 Ga0395905_0063717
796 Ga0395905_0081900
797 Ga0395905_0231787
798 Ga0395905_0273772
799 Ga0436364_0516905
800 Ga0395901_0007137
801 Ga0395901_0014134
802 Ga0395901_0015599
803 Ga0395901_0016351
804 Ga0395901_0020747
805 Ga0395901_0057607
806 Ga0395901_0061064
807 Ga0395901_0103483
808 Ga0395901_0127645
809 Ga0395901_0135311
810 Ga0395901_0151084
811 Ga0395901_0292069
812 Ga0395901_0618912
813 Ga0395901_0645526
814 Ga0395901_0753904
815 Ga0439448_0007262
816 Ga0439440_0028559
817 Ga0466966_0053881
818 Ga0466966_0335698
819 Ga0466966_0359480
820 Ga0466966_0396981
821 Ga0466961_0040835
822 Ga0466961_0136647
823 Ga0466963_0036511
824 Ga0466963_0075181
825 Ga0466963_0264736
826 Ga0466964_0013381
827 Ga0466968_0006069
828 Ga0466970_0096261
829 Ga0466960_0056249
830 Ga0466959_0123919
831 Ga0466959_0149020
832 Ga0466958_0014777
833 Ga0466967_0184290
834 Ga0466967_0350152
835 Ga0466967_0450654
836 Ga0466967_0727603
837 Ga0466967_0935263
838 Ga0495592_0176559
839 Ga0495603_0000530
840 Ga0495629_0084605
841 Ga0495629_0160789
842 Ga0495629_0411122
843 Ga0495641_0000685
844 Ga0495641_0051231
845 Ga0495641_0153151
846 Ga0495651_0008427
847 Ga0495651_0013329
848 Ga0495653_0044000
849 Ga0495653_0063750
850 Ga0495582_0025794
851 Ga0495582_0352776
852 Ga0495605_0220448
853 Ga0495639_0281266
854 Ga0495664_0043175
855 Ga0495584_0142545
856 Ga0495585_0375845
857 Ga0495594_0001295
858 Ga0495608_0026725
859 Ga0495608_0059544
860 Ga0495628_0102544
861 Ga0495630_0000487
862 Ga0495630_0034154
863 Ga0495630_0165586
864 Ga0495663_0049594
865 Ga0495666_0276777
866 Ga0495652_0136662
867 Ga0495665_0035500
868 Ga0495640_0042820
869 Ga0495587_0092350
870 Ga0495634_0013923
871 Ga0495635_0043331
872 Ga0495635_0049968
873 Ga0495661_0224300
874 Ga0495588_0007467
875 Ga0495657_0104103
876 Ga0495657_0174207
877 Ga0495657_0271467
878 Ga0495599_0052563
879 Ga0495599_0192855
880 Ga0495623_0020005
881 Ga0495646_0119141
882 Ga0495646_0146380
883 Ga0495647_0121665
884 Ga0495658_0043100
885 Ga0495658_0080912
886 Ga0495613_0056022
887 Ga0495613_0189497
888 Ga0495624_0255897
889 Ga0495600_0072662
890 Ga0495581_0009975
891 Ga0495674_0016943
892 Ga0495676_0083533
893 Ga0495676_0313152
894 Ga0495680_0002804
895 Ga0495680_0053126
896 Ga0495675_0058995
897 Ga0495684_0029328
898 Ga0495684_0208095
899 Ga0496100_0496306
900 Ga0496101_0027467
901 Ga0496101_0081788
902 Ga0496101_0143192
903 Ga0496101_0348766
904 Ga0496101_0570787
905 Ga0496102_0031120
906 Ga0496102_0122490
907 Ga0496102_0257507
908 Ga0496102_0279917
909 Ga0496103_0039221
910 Ga0496103_0052578
911 Ga0496103_0379005
912 Ga0496103_0514576
913 Ga0496104_0007978
914 Ga0496104_0066935
915 Ga0496104_0380359
916 Ga0496104_0485660
917 Ga0496105_0053524
918 Ga0496105_0068165
919 Ga0496105_0237312
920 Ga0496105_0746629
921 Ga0496106_0051609
922 Ga0496106_0079177
923 Ga0496106_0089749
924 Ga0496106_0236600
925 Ga0496106_0437239
926 Ga0496107_0003366
927 Ga0496107_0149002
928 Ga0496107_0299128
929 Ga0496108_0018030
930 Ga0496109_0096811
931 Ga0496109_0175516
932 Ga0496110_0007848
933 Ga0496110_0080254
934 Ga0496110_0188428
935 Ga0496110_0381062
936 Ga0496110_0732223
937 Ga0496110_0795542
938 Ga0496111_0063714
939 Ga0496111_0079362
940 Ga0496111_0328978
941 Ga0496111_0576374
942 Ga0496111_0674605
943 Ga0496111_0707059
944 Ga0496112_0003369
945 Ga0496112_0010589
946 Ga0496112_0069678
947 Ga0496112_0081005
948 Ga0496112_0086397
949 Ga0496112_0220818
950 Ga0496112_0318971
951 Ga0496112_0475456
952 Ga0496112_0533296
953 Ga0496113_0091490
954 Ga0496113_0447728
955 Ga0496113_0575899
956 Ga0496114_0048408
957 Ga0496114_0339979
958 Ga0496114_0371088
959 Ga0496114_0502692
960 Ga0496114_0767262
961 Ga0496115_0035761
962 Ga0496115_0091034
963 Ga0496115_0122702
964 Ga0496115_0223800
965 Ga0496115_0295158
966 Ga0496115_0357440
967 Ga0501033_0038712
968 Ga0501038_0036403
969 Ga0501039_0068655
970 Ga0501040_0081060
971 Ga0501040_0227411
972 Ga0501042_0082105
973 Ga0501042_0167016
974 Ga0501043_0026719
975 Ga0501048_0024861
976 Ga0501067_0092169
977 Ga0501068_0006768
978 Ga0501069_0004710
979 Ga0501069_0261288
980 Ga0501070_0001858
981 Ga0501070_0098658
982 Ga0501070_0266838
983 Ga0501072_0030621
984 Ga0501073_0010594
985 Ga0501074_0072260
986 Ga0501075_0017968
987 Ga0501076_0050768
988 Ga0501077_0113282
989 Ga0501080_0034302
990 Ga0501080_0193239
991 Ga0501080_0273374
992 Ga0501083_0000504
993 Ga0501035_0004918
994 Ga0501044_0202040
995 nmdc:mga05p37_103024_c1
996 nmdc:mga05p37_499152_c1
997 nmdc:mga08y16_195375_c1
998 nmdc:mga08y16_27317_c1
999 nmdc:mga0n895_14068_c1
1000 nmdc:mga0n895_590801_c1
1001 nmdc:mga0n895_671651_c1
1002 nmdc:mga0n895_95944_c1
1003 nmdc:mga0rr50_14669_c1
1004 nmdc:mga0rr50_348976_c1
1005 nmdc:mga0rr50_9412_c1
1006 nmdc:mga0a205_3140_c1
1007 Ga0495595_0004330
1008 Ga0495619_0064977
1009 Ga0501084_0091573
1010 Ga0501084_0303215
1011 Ga0501082_0084113
1012 Ga0501082_0379310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

77

189

0.98

PF02597

ThiS

ThiS family

4

73

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9705 76 199
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.9672 74 206
8hlg-assembly1.cif.gz_B crystal structure of moae 0.9486 77 208
2wp4-assembly1.cif.gz_A crystal structure of rv3119 from mycobacterium tuberculosis 0.9414 73 199
2qie-assembly2.cif.gz_H staphylococcus aureus molybdopterin synthase in complex with precursor z 0.937 74 200
ID Description Score Start End Superfamily
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9733 76 207 3.90.1170.40
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9714 76 199 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9585 75 208 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9485 74 208 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9293 76 206 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A495ZJE1-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9855 77 206 GO:0006777
AF-A0A2C5WZK1-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Common component for nitrate reductase and xanthine dehydrogenase protein H) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.985 76 207 GO:0006777
GO:0030366
GO:1990140
AF-A0A0F4ZKS1-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Common component for nitrate reductase and xanthine dehydrogenase protein H) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9847 76 207 GO:0006777
GO:0030366
GO:1990140
AF-A0A3N5F992-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9839 75 206 GO:0006777
AF-A0A1Y2FJU2-F1-model_v4 Molybdopterin biosynthesis MoaE 0.9834 76 207 GO:0006777

Map