F456557

General Info

Members Datasets Scaffolds Average Seq Length
506 193 483 217

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0235534|Ga0436361_0235534_1845_2603
Length 237
Sequence MLPLLPRRALRPLQLLPSLETDIAMAKADLNVKFDLKPMMESLAGQFRGLNERHPGQWPIAPRLLCAVGVMAAVIGLGYFGYWSGQFDEQEEGANKELKLRDEYKIKTSQAVNLDALRVQKVQVDQYVDRLQKQLPSKAEMAALLSDINQAGLGRGLQFELFKPGQVVVKDYYAELPIDIKVTGNYHDIGAFAGDMANLPRIVTLNNMTLNTGKDGTLTLDAVAKTFRYLDPEEVAS

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221570 Acidovorax sp. Root568 Isolate Unclassified
3 2643221596 Acidovorax sp. Root70 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738541357 Duganella sp. GV053 Isolate Unclassified
11 2738543003 Duganella sp. GV066 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2821131069 Duganella sp. 1224 Isolate Unclassified
17 2842711865 Duganella sp. R-73148 Isolate Unclassified
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2857558681 Duganella sp. R-74565 Isolate Unclassified
20 2857564685 Duganella sp. R-74599 Isolate Unclassified
21 2904424332 Duganella sp. 1411 Isolate Rhizosphere
22 2919476304 Duganella sp. 3397 Isolate Unclassified
23 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
81 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
178 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
184 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
185 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
186 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
187 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0.99
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.77
Nodule 0.79
Rhizoplane 1.78
Rhizosphere 69.57
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002311 3300002738 Bacteria 5097
2 JGI25158J39367_1004283 3300002739 Bacteria 2149
3 JGI25158J39367_1009023 3300002739 Unclassified 1374
4 JGI25152J39213_1000224 3300002773 Bacteria 38367
5 JGI25150J39212_1000695 3300002774 Bacteria 12175
6 JGI25150J39212_1003218 3300002774 Bacteria 3864
7 JGI25159J45721_1000892 3300002987 Bacteria 12977
8 JGI25159J45721_1008142 3300002987 Bacteria 2912
9 JGI25159J45721_1008146 3300002987 Bacteria 2912
10 JGI25153J46596_10002862 3300003215 Bacteria 9802
11 JGI25153J46596_10014209 3300003215 Bacteria 3323
12 rootL2_10043261 3300003322 Bacteria 4959
13 rootL2_10117747 3300003322 Bacteria 2951
14 JGI25160J50197_1004010 3300003354 Bacteria 6424
15 JGI25161J50226_1004038 3300003374 Bacteria 3168
16 JGI25161J50226_1004505 3300003374 Bacteria 2904
17 Ga0055529_1000079 3300003763 Bacteria 149370
18 Ga0055526_1000228 3300003771 Bacteria 47559
19 Ga0055526_1000337 3300003771 Bacteria 38516
20 Ga0055526_1000651 3300003771 Bacteria 26844
21 Ga0055526_1009451 3300003771 Bacteria 4684
22 Ga0055526_1025078 3300003771 Bacteria 1925
23 Ga0055537_1000038 3300003773 Bacteria 92762
24 Ga0055537_1008149 3300003773 Bacteria 2447
25 Ga0055537_1009101 3300003773 Bacteria 2224
26 Ga0055524_1000024 3300003775 Bacteria 217953
27 Ga0055524_1001031 3300003775 Bacteria 17211
28 Ga0055524_1013018 3300003775 Bacteria 3162
29 Ga0055524_1024546 3300003775 Bacteria 1909
30 Ga0055534_1000074 3300003784 Bacteria 77272
31 Ga0055534_1001588 3300003784 Bacteria 8816
32 Ga0055534_1010627 3300003784 Bacteria 1914
33 Ga0055528_1000231 3300003790 Bacteria 46568
34 Ga0055528_1001043 3300003790 Bacteria 18281
35 Ga0055530_10012220 3300003791 Bacteria 3010
36 Ga0055530_10012761 3300003791 Bacteria 2909
37 Ga0055530_10012804 3300003791 Bacteria 2903
38 Ga0055531_10017652 3300003794 Bacteria 2998
39 Ga0055531_10026594 3300003794 Bacteria 2057
40 Ga0055543_1006140 3300004625 Bacteria 2950
41 Ga0055543_1006902 3300004625 Bacteria 2686
42 Ga0065165_1000504 3300005262 Bacteria 60378
43 Ga0065165_1015177 3300005262 Bacteria 2950
44 Ga0065715_10030871 3300005293 Bacteria 1725
45 Ga0068853_100039191 3300005539 Bacteria 4041
46 Ga0070717_10005399 3300006028 Bacteria 9333
47 Ga0075366_10000393 3300006195 Bacteria 20298
48 Ga0079104_1016105 3300006946 Bacteria 2195
49 Ga0099826_10000010 3300006948 Bacteria 314346
50 Ga0105244_10000158 3300009036 Bacteria 70253
51 Ga0105244_10003379 3300009036 Bacteria 11424
52 Ga0105242_10004610 3300009176 Bacteria 10684
53 Ga0157371_10000018 3300013102 Bacteria 310522
54 Ga0182008_10011838 3300014497 Bacteria 4627
55 Ga0182006_1000141 3300015261 Bacteria 77478
56 Ga0182006_1013039 3300015261 Bacteria 3619
57 Ga0182007_10048524 3300015262 Bacteria 1403
58 Ga0182005_1000016 3300015265 Bacteria 346889
59 Ga0213872_10000005 3300021361 Bacteria 290165
60 Ga0213872_10000541 3300021361 Bacteria 29407
61 Ga0213872_10002380 3300021361 Bacteria 11120
62 Ga0213872_10044866 3300021361 Bacteria 2011
63 Ga0213872_10121531 3300021361 Bacteria 1154
64 Ga0209436_100928 3300025208 Bacteria 11575
65 Ga0209436_111640 3300025208 Bacteria 1534
66 Ga0209437_103534 3300025233 Bacteria 2818
67 Ga0209437_105622 3300025233 Bacteria 2126
68 Ga0207425_1000021 3300025245 Bacteria 367537
69 Ga0207425_1000223 3300025245 Bacteria 44555
70 Ga0207425_1000640 3300025245 Bacteria 19664
71 Ga0207425_1012715 3300025245 Bacteria 1963
72 Ga0209646_1000068 3300025246 Bacteria 233765
73 Ga0209129_1000020 3300025258 Bacteria 457053
74 Ga0209129_1004870 3300025258 Bacteria 5021
75 Ga0209565_1000123 3300025263 Bacteria 111069
76 Ga0209565_1001882 3300025263 Bacteria 8324
77 Ga0209565_1006129 3300025263 Bacteria 3413
78 Ga0209565_1006737 3300025263 Bacteria 3185
79 Ga0209565_1007111 3300025263 Bacteria 3054
80 Ga0209565_1007877 3300025263 Bacteria 2828
81 Ga0209565_1031904 3300025263 Bacteria 1021
82 Ga0209565_1042551 3300025263 Bacteria 841
83 Ga0209455_1000070 3300025272 Bacteria 307867
84 Ga0209673_1000040 3300025273 Bacteria 312633
85 Ga0209673_1002575 3300025273 Bacteria 12297
86 Ga0209130_1000290 3300025284 Bacteria 61271
87 Ga0209130_1007638 3300025284 Bacteria 3307
88 Ga0209675_1000117 3300025291 Bacteria 111087
89 Ga0209675_1000650 3300025291 Bacteria 24546
90 Ga0209675_1003691 3300025291 Bacteria 7143
91 Ga0209025_1058436 3300025294 Bacteria 1465
92 Ga0209564_1000027 3300025295 Bacteria 518458
93 Ga0209564_1000047 3300025295 Bacteria 368031
94 Ga0209564_1000121 3300025295 Bacteria 204081
95 Ga0209564_1000780 3300025295 Bacteria 44199
96 Ga0209564_1006698 3300025295 Bacteria 6124
97 Ga0209564_1011409 3300025295 Bacteria 3984
98 Ga0209758_1000077 3300025297 Bacteria 268195
99 Ga0209758_1000322 3300025297 Bacteria 92458
100 Ga0209050_1000050 3300025298 Bacteria 362578
101 Ga0209050_1000795 3300025298 Bacteria 44648
102 Ga0209256_1000054 3300025299 Bacteria 298431
103 Ga0209256_1000288 3300025299 Bacteria 88470
104 Ga0209256_1000674 3300025299 Bacteria 46225
105 Ga0209256_1001001 3300025299 Bacteria 33573
106 Ga0209256_1002870 3300025299 Bacteria 13096
107 Ga0207426_1004227 3300025302 Bacteria 7136
108 Ga0209051_1025401 3300025303 Bacteria 2412
109 Ga0209257_1000075 3300025304 Bacteria 324855
110 Ga0207655_1000710 3300025728 Bacteria 38274
111 Ga0207686_10093816 3300025934 Bacteria 1988
112 Ga0209281_1002515 3300027111 Bacteria 7212
113 Ga0209282_1000072 3300027666 Bacteria 81137
114 Ga0307515_10000084 3300028794 Bacteria 221434
115 Ga0307515_10178226 3300028794 Bacteria 2087
116 Ga0316177_1067313 3300030731 Bacteria 1528
117 Ga0316180_1166365 3300030736 Bacteria 2979
118 Ga0265327_10239654 3300031251 Bacteria 811
119 Ga0307513_10070736 3300031456 Bacteria 3645
120 Ga0307513_10199506 3300031456 Bacteria 1843
121 Ga0307408_100000531 3300031548 Bacteria 32967
122 Ga0307408_100001492 3300031548 Bacteria 17360
123 Ga0307408_100002211 3300031548 Bacteria 13890
124 Ga0307408_100053583 3300031548 Bacteria 2913
125 Ga0307408_100062045 3300031548 Bacteria 2730
126 Ga0307514_10000954 3300031649 Bacteria 43472
127 Ga0265314_10011332 3300031711 Bacteria 7369
128 Ga0307405_10052848 3300031731 Bacteria 2528
129 Ga0307406_10344423 3300031901 Bacteria 1162
130 Ga0307416_100013029 3300032002 Bacteria 5633
131 Ga0373939_0004293 3300035114 Bacteria 3368
132 Ga0373931_0012232 3300035691 Unclassified 4156
133 Ga0395898_0335880 3300037466 Bacteria 1441
134 Ga0436361_0002419 3300039447 Bacteria 2615
135 Ga0436361_0235534 3300039447 Bacteria 12344
136 Ga0436361_0491134 3300039447 Unclassified 803
137 Ga0436361_0820978 3300039447 Bacteria 73779
138 Ga0436361_0906875 3300039447 Bacteria 3330
139 Ga0436361_0938421 3300039447 Bacteria 11081
140 Ga0450911_000361 3300042115 Bacteria 15223
141 Ga0466965_0003099 3300044683 Bacteria 7247
142 Ga0466965_0195296 3300044683 Bacteria 1072
143 Ga0466968_0003648 3300044735 Bacteria 5707
144 Ga0466960_0090052 3300044901 Bacteria 1562
145 Ga0495617_000245 3300046452 Bacteria 32248
146 Ga0495617_004444 3300046452 Bacteria 5103
147 Ga0495617_005143 3300046452 Bacteria 4670
148 Ga0495617_022766 3300046452 Bacteria 2118
149 Ga0495617_047270 3300046452 Bacteria 1433
150 Ga0495617_071252 3300046452 Bacteria 1143
151 Ga0495627_000011 3300046453 Bacteria 354522
152 Ga0495627_073987 3300046453 Bacteria 992
153 Ga0495603_0050867 3300046455 Bacteria 2463
154 Ga0495603_0066461 3300046455 Bacteria 2123
155 Ga0495590_0000020 3300046457 Bacteria 212352
156 Ga0495590_0008308 3300046457 Bacteria 3966
157 Ga0495590_0020726 3300046457 Bacteria 2334
158 Ga0495590_0024247 3300046457 Bacteria 2138
159 Ga0495629_0001463 3300046459 Bacteria 18603
160 Ga0495629_0077429 3300046459 Bacteria 2321
161 Ga0495638_0000235 3300046460 Bacteria 75760
162 Ga0495638_0002305 3300046460 Bacteria 15718
163 Ga0495638_0005619 3300046460 Bacteria 9256
164 Ga0495638_0009129 3300046460 Bacteria 6978
165 Ga0495638_0011136 3300046460 Bacteria 6213
166 Ga0495638_0113464 3300046460 Bacteria 1607
167 Ga0495653_0000067 3300046463 Bacteria 90116
168 Ga0495650_0000200 3300046471 Bacteria 130223
169 Ga0495650_0000436 3300046471 Bacteria 67167
170 Ga0495650_0000864 3300046471 Bacteria 36231
171 Ga0495650_0000903 3300046471 Bacteria 34949
172 Ga0495650_0003129 3300046471 Bacteria 12396
173 Ga0495650_0004386 3300046471 Bacteria 9699
174 Ga0495650_0006085 3300046471 Bacteria 7609
175 Ga0495650_0012473 3300046471 Bacteria 4571
176 Ga0495650_0018453 3300046471 Bacteria 3465
177 Ga0495582_0021263 3300046473 Bacteria 3551
178 Ga0495605_0000061 3300046474 Bacteria 145286
179 Ga0495605_0000764 3300046474 Bacteria 23490
180 Ga0495605_0190117 3300046474 Bacteria 899
181 Ga0495639_0040830 3300046475 Bacteria 2089
182 Ga0495584_0000005 3300046491 Bacteria 306957
183 Ga0495584_0000308 3300046491 Bacteria 34325
184 Ga0495584_0005003 3300046491 Bacteria 7054
185 Ga0495584_0007528 3300046491 Bacteria 5674
186 Ga0495584_0044957 3300046491 Bacteria 2227
187 Ga0495584_0050856 3300046491 Bacteria 2087
188 Ga0495584_0053991 3300046491 Bacteria 2022
189 Ga0495584_0101765 3300046491 Bacteria 1452
190 Ga0495585_0000599 3300046492 Bacteria 33707
191 Ga0495585_0002632 3300046492 Bacteria 12644
192 Ga0495585_0018339 3300046492 Bacteria 4037
193 Ga0495585_0025891 3300046492 Bacteria 3355
194 Ga0495585_0028549 3300046492 Bacteria 3181
195 Ga0495585_0032642 3300046492 Bacteria 2949
196 Ga0495585_0044226 3300046492 Bacteria 2488
197 Ga0495585_0056041 3300046492 Bacteria 2177
198 Ga0495594_0001208 3300046499 Bacteria 13499
199 Ga0495594_0017324 3300046499 Bacteria 3805
200 Ga0495596_0003746 3300046500 Bacteria 7591
201 Ga0495596_0008572 3300046500 Bacteria 4543
202 Ga0495596_0040055 3300046500 Bacteria 1849
203 Ga0495596_0108822 3300046500 Bacteria 1076
204 Ga0495607_0000514 3300046501 Bacteria 38263
205 Ga0495607_0004516 3300046501 Bacteria 10213
206 Ga0495607_0012662 3300046501 Bacteria 5557
207 Ga0495607_0137403 3300046501 Bacteria 1264
208 Ga0495607_0147241 3300046501 Bacteria 1208
209 Ga0495607_0154514 3300046501 Bacteria 1171
210 Ga0495583_0000214 3300046506 Bacteria 97639
211 Ga0495583_0000317 3300046506 Bacteria 76193
212 Ga0495583_0000900 3300046506 Bacteria 35357
213 Ga0495583_0005023 3300046506 Bacteria 9157
214 Ga0495583_0005716 3300046506 Bacteria 8350
215 Ga0495583_0007827 3300046506 Bacteria 6638
216 Ga0495583_0125294 3300046506 Bacteria 1078
217 Ga0495606_0000120 3300046507 Bacteria 133907
218 Ga0495606_0000262 3300046507 Bacteria 92896
219 Ga0495606_0000433 3300046507 Bacteria 69506
220 Ga0495606_0002563 3300046507 Bacteria 20868
221 Ga0495606_0003569 3300046507 Bacteria 16403
222 Ga0495606_0007596 3300046507 Bacteria 9646
223 Ga0495606_0012487 3300046507 Bacteria 6803
224 Ga0495606_0019003 3300046507 Bacteria 5133
225 Ga0495606_0019986 3300046507 Bacteria 4956
226 Ga0495606_0023776 3300046507 Bacteria 4431
227 Ga0495606_0039459 3300046507 Bacteria 3181
228 Ga0495606_0059224 3300046507 Bacteria 2457
229 Ga0495606_0128304 3300046507 Bacteria 1510
230 Ga0495606_0131117 3300046507 Bacteria 1490
231 Ga0495610_0000017 3300046512 Bacteria 365675
232 Ga0495610_0002788 3300046512 Bacteria 14311
233 Ga0495610_0003795 3300046512 Bacteria 11523
234 Ga0495610_0006344 3300046512 Bacteria 8172
235 Ga0495616_0000234 3300046513 Bacteria 45006
236 Ga0495616_0001575 3300046513 Bacteria 15690
237 Ga0495616_0005282 3300046513 Bacteria 7963
238 Ga0495616_0018502 3300046513 Bacteria 3823
239 Ga0495616_0036761 3300046513 Bacteria 2525
240 Ga0495616_0133227 3300046513 Bacteria 1137
241 Ga0495631_0028593 3300046518 Bacteria 2542
242 Ga0495632_0011228 3300046519 Bacteria 5240
243 Ga0495637_0000179 3300046520 Bacteria 49260
244 Ga0495637_0004230 3300046520 Bacteria 7457
245 Ga0495637_0064388 3300046520 Bacteria 1495
246 Ga0495643_0001510 3300046522 Bacteria 21024
247 Ga0495643_0001515 3300046522 Bacteria 20976
248 Ga0495643_0002282 3300046522 Bacteria 15491
249 Ga0495643_0008569 3300046522 Bacteria 6458
250 Ga0495643_0068039 3300046522 Bacteria 1875
251 Ga0495644_0004709 3300046523 Bacteria 5365
252 Ga0495648_0000350 3300046524 Bacteria 50788
253 Ga0495648_0002610 3300046524 Bacteria 16463
254 Ga0495648_0009448 3300046524 Bacteria 7557
255 Ga0495648_0009718 3300046524 Bacteria 7410
256 Ga0495648_0010369 3300046524 Bacteria 7100
257 Ga0495648_0027424 3300046524 Bacteria 3812
258 Ga0495648_0035985 3300046524 Bacteria 3202
259 Ga0495648_0052546 3300046524 Bacteria 2474
260 Ga0495648_0118886 3300046524 Bacteria 1424
261 Ga0495663_0008275 3300046525 Bacteria 2879
262 Ga0495663_0009279 3300046525 Bacteria 2728
263 Ga0495663_0021527 3300046525 Bacteria 1857
264 Ga0495663_0104245 3300046525 Bacteria 937
265 Ga0495666_0075542 3300046526 Bacteria 1597
266 Ga0495642_0001130 3300046528 Bacteria 12263
267 Ga0495642_0001943 3300046528 Bacteria 8727
268 Ga0495642_0003971 3300046528 Bacteria 5785
269 Ga0495642_0009415 3300046528 Bacteria 3739
270 Ga0495642_0012611 3300046528 Bacteria 3258
271 Ga0495642_0035959 3300046528 Bacteria 2000
272 Ga0495654_0000060 3300046530 Bacteria 134307
273 Ga0495654_0001107 3300046530 Bacteria 19460
274 Ga0495654_0001159 3300046530 Bacteria 18844
275 Ga0495654_0003528 3300046530 Bacteria 9549
276 Ga0495654_0045079 3300046530 Bacteria 2177
277 Ga0495665_0021889 3300046531 Bacteria 3437
278 Ga0495609_0001337 3300046538 Bacteria 16700
279 Ga0495609_0002743 3300046538 Bacteria 10602
280 Ga0495609_0003502 3300046538 Bacteria 8970
281 Ga0495609_0031660 3300046538 Bacteria 2403
282 Ga0495597_0001017 3300046542 Bacteria 21453
283 Ga0495597_0001027 3300046542 Bacteria 21345
284 Ga0495597_0001085 3300046542 Bacteria 20660
285 Ga0495597_0025389 3300046542 Bacteria 2727
286 Ga0495597_0030651 3300046542 Bacteria 2450
287 Ga0495597_0131002 3300046542 Bacteria 1040
288 Ga0495622_0000210 3300046557 Bacteria 46319
289 Ga0495622_0000292 3300046557 Bacteria 37769
290 Ga0495622_0012944 3300046557 Bacteria 3869
291 Ga0495622_0027453 3300046557 Bacteria 2657
292 Ga0495622_0089051 3300046557 Bacteria 1418
293 Ga0495633_0001329 3300046558 Bacteria 19396
294 Ga0495633_0002397 3300046558 Bacteria 13276
295 Ga0495633_0002578 3300046558 Bacteria 12688
296 Ga0495633_0009758 3300046558 Bacteria 5275
297 Ga0495633_0016905 3300046558 Bacteria 3744
298 Ga0495633_0019657 3300046558 Bacteria 3413
299 Ga0495633_0024806 3300046558 Bacteria 2958
300 Ga0495633_0043891 3300046558 Bacteria 2119
301 Ga0495633_0094229 3300046558 Bacteria 1391
302 Ga0495656_0014975 3300046615 Bacteria 2917
303 Ga0495656_0165110 3300046615 Bacteria 1078
304 Ga0495668_0000162 3300046616 Bacteria 101114
305 Ga0495668_0000427 3300046616 Bacteria 54797
306 Ga0495668_0000769 3300046616 Bacteria 37454
307 Ga0495668_0002786 3300046616 Bacteria 13924
308 Ga0495668_0006299 3300046616 Bacteria 7815
309 Ga0495668_0017881 3300046616 Bacteria 4107
310 Ga0495668_0024806 3300046616 Bacteria 3409
311 Ga0495668_0046337 3300046616 Bacteria 2415
312 Ga0495668_0086883 3300046616 Bacteria 1715
313 Ga0495611_0003429 3300046648 Bacteria 6989
314 Ga0495611_0008811 3300046648 Bacteria 4267
315 Ga0495611_0013233 3300046648 Bacteria 3511
316 Ga0495611_0122343 3300046648 Bacteria 1213
317 Ga0495625_0001192 3300046660 Bacteria 33259
318 Ga0495625_0001372 3300046660 Bacteria 29946
319 Ga0495625_0001954 3300046660 Bacteria 23300
320 Ga0495625_0003285 3300046660 Bacteria 16318
321 Ga0495625_0007946 3300046660 Bacteria 9118
322 Ga0495625_0065676 3300046660 Bacteria 2557
323 Ga0495625_0095897 3300046660 Bacteria 2044
324 Ga0495625_0228457 3300046660 Bacteria 1216
325 Ga0495635_0018505 3300046663 Bacteria 4860
326 Ga0495659_0000114 3300046664 Bacteria 35846
327 Ga0495659_0001470 3300046664 Bacteria 7989
328 Ga0495659_0001963 3300046664 Bacteria 6766
329 Ga0495661_0005515 3300046665 Bacteria 8979
330 Ga0495661_0015210 3300046665 Bacteria 5138
331 Ga0495661_0015705 3300046665 Bacteria 5047
332 Ga0495661_0036104 3300046665 Bacteria 3097
333 Ga0495661_0062470 3300046665 Bacteria 2206
334 Ga0495661_0075193 3300046665 Bacteria 1963
335 Ga0495588_0011666 3300046674 Bacteria 4130
336 Ga0495588_0106890 3300046674 Bacteria 1473
337 Ga0495588_0183835 3300046674 Bacteria 1104
338 Ga0495623_0161582 3300046679 Bacteria 1316
339 Ga0495669_0000844 3300046684 Bacteria 13033
340 Ga0495670_0004436 3300046691 Bacteria 6884
341 Ga0495670_0015815 3300046691 Bacteria 3708
342 Ga0495670_0018028 3300046691 Bacteria 3478
343 Ga0495670_0021735 3300046691 Bacteria 3166
344 Ga0495670_0023607 3300046691 Bacteria 3035
345 Ga0495670_0043035 3300046691 Bacteria 2253
346 Ga0495670_0130287 3300046691 Bacteria 1310
347 Ga0495671_0000037 3300046692 Bacteria 177605
348 Ga0495671_0000437 3300046692 Bacteria 33043
349 Ga0495671_0015212 3300046692 Bacteria 4129
350 Ga0495671_0046881 3300046692 Bacteria 2160
351 Ga0495671_0069641 3300046692 Bacteria 1729
352 Ga0495671_0085980 3300046692 Bacteria 1540
353 Ga0495671_0090165 3300046692 Bacteria 1500
354 Ga0495671_0110878 3300046692 Bacteria 1340
355 Ga0495649_0032428 3300046694 Bacteria 2877
356 Ga0495649_0117448 3300046694 Bacteria 1408
357 Ga0495649_0142273 3300046694 Bacteria 1262
358 Ga0495589_0011854 3300046794 Bacteria 4521
359 Ga0495589_0034924 3300046794 Bacteria 2522
360 Ga0495589_0040997 3300046794 Bacteria 2310
361 Ga0495589_0061071 3300046794 Bacteria 1850
362 Ga0495660_0000980 3300046810 Bacteria 20850
363 Ga0495660_0001240 3300046810 Bacteria 17748
364 Ga0495660_0003025 3300046810 Bacteria 10486
365 Ga0495660_0004378 3300046810 Bacteria 8553
366 Ga0495660_0009294 3300046810 Bacteria 5737
367 Ga0495660_0021388 3300046810 Bacteria 3705
368 Ga0495660_0096953 3300046810 Bacteria 1523
369 Ga0495660_0198747 3300046810 Bacteria 958
370 Ga0495636_0001201 3300047318 Bacteria 9794
371 Ga0495636_0012088 3300047318 Bacteria 3420
372 Ga0495636_0014953 3300047318 Bacteria 3090
373 Ga0495636_0032332 3300047318 Bacteria 2146
374 Ga0495636_0052999 3300047318 Bacteria 1702
375 Ga0495636_0138818 3300047318 Bacteria 1085
376 Ga0495636_0242849 3300047318 Bacteria 831
377 Ga0495674_0000762 3300047319 Bacteria 30538
378 Ga0495672_0000013 3300047320 Bacteria 511827
379 Ga0495672_0000297 3300047320 Bacteria 68017
380 Ga0495672_0000353 3300047320 Bacteria 58748
381 Ga0495672_0024677 3300047320 Bacteria 3867
382 Ga0495672_0047519 3300047320 Bacteria 2551
383 Ga0495676_0018079 3300047321 Bacteria 6219
384 Ga0495676_0067465 3300047321 Bacteria 2767
385 Ga0495676_0116710 3300047321 Bacteria 1948
386 Ga0495676_0132611 3300047321 Bacteria 1796
387 Ga0495676_0264751 3300047321 Bacteria 1168
388 Ga0495683_0000589 3300047323 Bacteria 27334
389 Ga0495683_0000773 3300047323 Bacteria 22984
390 Ga0495683_0084604 3300047323 Bacteria 1543
391 Ga0495683_0101452 3300047323 Bacteria 1383
392 Ga0495687_000342 3300047443 Bacteria 59692
393 Ga0495687_013104 3300047443 Bacteria 4342
394 Ga0495687_051741 3300047443 Bacteria 1740
395 Ga0495677_0002300 3300047445 Bacteria 7531
396 Ga0495677_0004779 3300047445 Bacteria 5160
397 Ga0495677_0005748 3300047445 Bacteria 4698
398 Ga0495677_0018004 3300047445 Bacteria 2561
399 Ga0495677_0070319 3300047445 Bacteria 1304
400 Ga0495679_003087 3300047446 Bacteria 8167
401 Ga0495679_006195 3300047446 Bacteria 5192
402 Ga0495685_000088 3300047447 Bacteria 33952
403 Ga0495685_004449 3300047447 Bacteria 4528
404 Ga0495685_014998 3300047447 Bacteria 2638
405 Ga0495685_018222 3300047447 Bacteria 2408
406 Ga0495685_064936 3300047447 Bacteria 1227
407 Ga0495673_0000179 3300047469 Bacteria 102128
408 Ga0495673_0000201 3300047469 Bacteria 92885
409 Ga0495673_0000248 3300047469 Bacteria 75224
410 Ga0495673_0004072 3300047469 Bacteria 9300
411 Ga0495673_0032573 3300047469 Bacteria 2427
412 Ga0495681_0012354 3300047470 Bacteria 5022
413 Ga0495681_0013502 3300047470 Bacteria 4733
414 Ga0495681_0022109 3300047470 Bacteria 3411
415 Ga0495686_0001233 3300047472 Bacteria 29192
416 Ga0495686_0001635 3300047472 Bacteria 23409
417 Ga0495686_0002872 3300047472 Bacteria 15482
418 Ga0495686_0010721 3300047472 Bacteria 6503
419 Ga0495686_0025863 3300047472 Bacteria 3844
420 Ga0495686_0068655 3300047472 Bacteria 2187
421 Ga0495593_0006893 3300047673 Bacteria 6653
422 Ga0495614_0048445 3300048089 Bacteria 1822
423 Ga0495626_0001076 3300048091 Bacteria 23259
424 Ga0495626_0002479 3300048091 Bacteria 12768
425 Ga0495626_0004782 3300048091 Bacteria 8172
426 Ga0495626_0017095 3300048091 Bacteria 3669
427 Ga0495626_0017369 3300048091 Bacteria 3634
428 Ga0495626_0018346 3300048091 Bacteria 3515
429 Ga0496102_0000074 3300048905 Bacteria 148938
430 Ga0496103_0002217 3300048906 Bacteria 12309
431 Ga0496103_0004962 3300048906 Bacteria 8028
432 Ga0496103_0013075 3300048906 Bacteria 4921
433 Ga0496103_0392041 3300048906 Bacteria 892
434 Ga0496104_0106876 3300048907 Bacteria 2682
435 Ga0496114_0065855 3300048917 Bacteria 3036
436 Ga0496115_0024122 3300048918 Bacteria 4725
437 Ga0496115_0048379 3300048918 Bacteria 3401
438 Ga0496121_0007721 3300048924 Bacteria 12905
439 Ga0496121_0169425 3300048924 Bacteria 1588
440 Ga0496121_0213017 3300048924 Bacteria 1367
441 Ga0496122_0011421 3300048925 Bacteria 8992
442 Ga0496122_0046904 3300048925 Bacteria 3341
443 Ga0496123_0004566 3300048926 Bacteria 14439
444 Ga0496123_0107105 3300048926 Bacteria 1609
445 Ga0496124_0026956 3300048927 Bacteria 5171
446 Ga0496124_0054348 3300048927 Bacteria 3390
447 Ga0496124_0064848 3300048927 Bacteria 3048
448 Ga0496124_0161578 3300048927 Bacteria 1745
449 Ga0496125_0003307 3300048928 Bacteria 19733
450 Ga0496125_0007029 3300048928 Bacteria 12036
451 Ga0496125_0007689 3300048928 Bacteria 11424
452 Ga0496126_0006579 3300048929 Bacteria 12945
453 Ga0496126_0189803 3300048929 Bacteria 1741
454 Ga0501309_001993 3300049129 Bacteria 2130
455 Ga0501309_007948 3300049129 Bacteria 1325
456 Ga0501310_010489 3300049130 Bacteria 1035
457 Ga0495678_000010 3300049459 Bacteria 357896
458 Ga0495678_001298 3300049459 Bacteria 20180
459 Ga0495678_006816 3300049459 Bacteria 6012
460 Ga0495678_017265 3300049459 Bacteria 3276
461 Ga0495678_033539 3300049459 Bacteria 2118
462 Ga0495678_034719 3300049459 Bacteria 2072
463 Ga0495678_102979 3300049459 Bacteria 986
464 Ga0501300_000189 3300049523 Bacteria 9319
465 Ga0501311_000115 3300049527 Bacteria 4029
466 Ga0501323_003508 3300049539 Bacteria 1606
467 Ga0501037_0046723 3300049573 Bacteria 3175
468 Ga0501227_000633 3300049665 Bacteria 7650
469 Ga0501249_016396 3300049679 Bacteria 1591
470 Ga0501266_000050 3300049763 Bacteria 19942
471 Ga0501269_000202 3300049766 Bacteria 17720
472 Ga0501279_002391 3300049775 Bacteria 2463
473 Ga0501282_000116 3300049778 Bacteria 9330
474 Ga0501226_000204 3300049853 Bacteria 9309
475 nmdc:mga0k408_575_c1 3300050493 Bacteria 20303
476 Ga0500594_0013202 3300053118 Bacteria 1960
477 Ga0500618_000139 3300053125 Bacteria 60811
478 Ga0500618_016037 3300053125 Bacteria 1882
479 Ga0500559_0245491 3300053136 Bacteria 844
480 Ga0500586_000201 3300053145 Bacteria 11570
481 Ga0500586_001237 3300053145 Bacteria 5335
482 Ga0500586_091707 3300053145 Bacteria 1067
483 Ga0500634_0017045 3300053161 Bacteria 3885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049459 Ga0495678_033539 Ga0495678_033539_1119_1793 184
2 3300048918 Ga0496115_0048379 Ga0496115_0048379_1683_2348 186
3 3300053145 Ga0500586_091707 Ga0500586_091707_354_1016 186
4 3300046457 Ga0495590_0000020 Ga0495590_0000020_152809_153480 189
5 3300046522 Ga0495643_0002282 Ga0495643_0002282_8556_9227 189
6 3300046542 Ga0495597_0001017 Ga0495597_0001017_16968_17639 189
7 3300046616 Ga0495668_0000769 Ga0495668_0000769_35236_35907 189
8 3300046691 Ga0495670_0018028 Ga0495670_0018028_574_1245 189
9 3300046810 Ga0495660_0009294 Ga0495660_0009294_4214_4885 189
10 3300046460 Ga0495638_0000235 Ga0495638_0000235_19893_20564 191
11 3300046471 Ga0495650_0006085 Ga0495650_0006085_946_1617 191
12 3300046506 Ga0495583_0000900 Ga0495583_0000900_6114_6785 191
13 3300046524 Ga0495648_0000350 Ga0495648_0000350_30258_30929 191
14 3300046528 Ga0495642_0001943 Ga0495642_0001943_2069_2740 191
15 3300046557 Ga0495622_0000292 Ga0495622_0000292_30965_31636 191
16 3300046558 Ga0495633_0001329 Ga0495633_0001329_12128_12799 191
17 3300046660 Ga0495625_0001954 Ga0495625_0001954_6314_6985 191
18 3300047445 Ga0495677_0070319 Ga0495677_0070319_616_1287 191
19 3300049459 Ga0495678_034719 Ga0495678_034719_595_1266 191
20 3300046507 Ga0495606_0059224 Ga0495606_0059224_1241_1903 196
21 3300053161 Ga0500634_0017045 Ga0500634_0017045_3026_3724 197
22 3300006195 Ga0075366_10000393 Ga0075366_1000039310 198
23 3300028794 Ga0307515_10178226 Ga0307515_101782263 198
24 3300050493 nmdc:mga0k408_575_c1 nmdc:mga0k408_575_c1_9508_10167 198
25 3300005539 Ga0068853_100039191 Ga0068853_1000391914 199
26 3300031456 Ga0307513_10199506 Ga0307513_101995062 199
27 3300046471 Ga0495650_0004386 Ga0495650_0004386_5069_5752 201
28 3300046475 Ga0495639_0040830 Ga0495639_0040830_256_927 201
29 3300046520 Ga0495637_0000179 Ga0495637_0000179_32695_33378 201
30 3300046530 Ga0495654_0000060 Ga0495654_0000060_81164_81847 201
31 3300046810 Ga0495660_0198747 Ga0495660_0198747_54_737 201
32 3300046810 Ga0495660_0000980 Ga0495660_0000980_6301_6963 202
33 3300047472 Ga0495686_0002872 Ga0495686_0002872_1959_2621 202
34 3300049665 Ga0501227_000633 Ga0501227_000633_2190_2882 202
35 3300002987 JGI25159J45721_1000892 JGI25159J45721_10008924 203
36 3300004625 Ga0055543_1006902 Ga0055543_10069023 203
37 3300005262 Ga0065165_1000504 Ga0065165_100050423 203
38 3300025284 Ga0209130_1000290 Ga0209130_100029023 203
39 3300046457 Ga0495590_0020726 Ga0495590_0020726_63_728 203
40 3300046460 Ga0495638_0005619 Ga0495638_0005619_8110_8775 203
41 3300046501 Ga0495607_0000514 Ga0495607_0000514_24568_25233 203
42 3300046506 Ga0495583_0007827 Ga0495583_0007827_195_860 203
43 3300046513 Ga0495616_0001575 Ga0495616_0001575_8544_9209 203
44 3300046538 Ga0495609_0001337 Ga0495609_0001337_8730_9395 203
45 3300046558 Ga0495633_0009758 Ga0495633_0009758_2042_2722 203
46 3300046616 Ga0495668_0024806 Ga0495668_0024806_223_888 203
47 3300046660 Ga0495625_0001372 Ga0495625_0001372_23904_24569 203
48 3300046664 Ga0495659_0001470 Ga0495659_0001470_5907_6572 203
49 3300046665 Ga0495661_0015705 Ga0495661_0015705_3077_3742 203
50 3300046684 Ga0495669_0000844 Ga0495669_0000844_1615_2280 203
51 3300046692 Ga0495671_0069641 Ga0495671_0069641_315_980 203
52 3300046810 Ga0495660_0021388 Ga0495660_0021388_2210_2875 203
53 3300047318 Ga0495636_0052999 Ga0495636_0052999_62_727 203
54 3300047443 Ga0495687_051741 Ga0495687_051741_100_765 203
55 3300047445 Ga0495677_0004779 Ga0495677_0004779_2881_3546 203
56 3300047446 Ga0495679_003087 Ga0495679_003087_282_947 203
57 3300047447 Ga0495685_014998 Ga0495685_014998_1886_2551 203
58 3300047470 Ga0495681_0012354 Ga0495681_0012354_2160_2825 203
59 3300047472 Ga0495686_0001233 Ga0495686_0001233_11483_12148 203
60 3300049459 Ga0495678_102979 Ga0495678_102979_200_865 203
61 3300053145 Ga0500586_000201 Ga0500586_000201_7527_8207 203
62 3300003215 JGI25153J46596_10014209 JGI25153J46596_100142093 204
63 3300003771 Ga0055526_1000337 Ga0055526_10003375 204
64 3300009036 Ga0105244_10003379 Ga0105244_100033792 204
65 3300025245 Ga0207425_1000640 Ga0207425_100064015 204
66 3300025245 Ga0207425_1012715 Ga0207425_10127153 204
67 3300025263 Ga0209565_1031904 Ga0209565_10319042 204
68 3300025294 Ga0209025_1058436 Ga0209025_10584362 204
69 3300025295 Ga0209564_1000027 Ga0209564_1000027297 204
70 3300025297 Ga0209758_1000322 Ga0209758_100032259 204
71 3300031251 Ga0265327_10239654 Ga0265327_102396541 204
72 3300035114 Ga0373939_0004293 Ga0373939_0004293_1435_2109 204
73 3300046452 Ga0495617_000245 Ga0495617_000245_27855_28535 204
74 3300046460 Ga0495638_0011136 Ga0495638_0011136_3038_3718 204
75 3300046463 Ga0495653_0000067 Ga0495653_0000067_31656_32336 204
76 3300046471 Ga0495650_0000864 Ga0495650_0000864_13854_14528 204
77 3300046471 Ga0495650_0000903 Ga0495650_0000903_34017_34697 204
78 3300046471 Ga0495650_0018453 Ga0495650_0018453_2142_2822 204
79 3300046474 Ga0495605_0000061 Ga0495605_0000061_105855_106529 204
80 3300046492 Ga0495585_0018339 Ga0495585_0018339_2550_3230 204
81 3300046507 Ga0495606_0000120 Ga0495606_0000120_101292_101966 204
82 3300046507 Ga0495606_0000262 Ga0495606_0000262_57837_58517 204
83 3300046512 Ga0495610_0000017 Ga0495610_0000017_296672_297349 204
84 3300046512 Ga0495610_0006344 Ga0495610_0006344_3089_3763 204
85 3300046524 Ga0495648_0009718 Ga0495648_0009718_4967_5647 204
86 3300046524 Ga0495648_0010369 Ga0495648_0010369_2463_3143 204
87 3300046530 Ga0495654_0001159 Ga0495654_0001159_2664_3344 204
88 3300046558 Ga0495633_0016905 Ga0495633_0016905_1833_2507 204
89 3300046616 Ga0495668_0000162 Ga0495668_0000162_20147_20821 204
90 3300046616 Ga0495668_0002786 Ga0495668_0002786_8453_9133 204
91 3300046616 Ga0495668_0006299 Ga0495668_0006299_4780_5454 204
92 3300046660 Ga0495625_0003285 Ga0495625_0003285_6243_6923 204
93 3300046660 Ga0495625_0095897 Ga0495625_0095897_778_1458 204
94 3300046665 Ga0495661_0015210 Ga0495661_0015210_2327_3007 204
95 3300046692 Ga0495671_0000037 Ga0495671_0000037_143346_144026 204
96 3300046692 Ga0495671_0085980 Ga0495671_0085980_275_955 204
97 3300046810 Ga0495660_0004378 Ga0495660_0004378_2534_3214 204
98 3300047321 Ga0495676_0116710 Ga0495676_0116710_122_775 204
99 3300047469 Ga0495673_0000179 Ga0495673_0000179_32065_32745 204
100 3300047469 Ga0495673_0000201 Ga0495673_0000201_62079_62753 204
101 3300047472 Ga0495686_0010721 Ga0495686_0010721_1405_2079 204
102 3300048924 Ga0496121_0169425 Ga0496121_0169425_570_1250 204
103 3300048925 Ga0496122_0011421 Ga0496122_0011421_1850_2530 204
104 3300048925 Ga0496122_0046904 Ga0496122_0046904_2645_3325 204
105 3300048926 Ga0496123_0004566 Ga0496123_0004566_5328_6008 204
106 3300048926 Ga0496123_0107105 Ga0496123_0107105_650_1330 204
107 3300048927 Ga0496124_0064848 Ga0496124_0064848_1286_1966 204
108 3300048927 Ga0496124_0161578 Ga0496124_0161578_483_1157 204
109 3300048929 Ga0496126_0006579 Ga0496126_0006579_6323_6997 204
110 3300049775 Ga0501279_002391 Ga0501279_002391_880_1578 204
111 3300053125 Ga0500618_000139 Ga0500618_000139_53886_54563 204
112 3300053145 Ga0500586_001237 Ga0500586_001237_2268_2948 204
113 3300003771 Ga0055526_1000651 Ga0055526_100065118 205
114 3300003773 Ga0055537_1000038 Ga0055537_100003832 205
115 3300003784 Ga0055534_1000074 Ga0055534_100007424 205
116 3300003790 Ga0055528_1000231 Ga0055528_100023119 205
117 3300013102 Ga0157371_10000018 Ga0157371_10000018251 205
118 3300014497 Ga0182008_10011838 Ga0182008_100118384 205
119 3300015261 Ga0182006_1013039 Ga0182006_10130393 205
120 3300044683 Ga0466965_0195296 Ga0466965_0195296_375_1037 205
121 3300046471 Ga0495650_0003129 Ga0495650_0003129_7664_8344 205
122 3300046694 Ga0495649_0032428 Ga0495649_0032428_213_923 205
123 3300047446 Ga0495679_006195 Ga0495679_006195_2760_3440 205
124 iso_pu_bacteria 2643221570 2643867697 205
125 iso_pu_bacteria 2643221596 2643991559 205
126 3300021361 Ga0213872_10000541 Ga0213872_1000054114 206
127 3300021361 Ga0213872_10002380 Ga0213872_100023809 206
128 3300021361 Ga0213872_10044866 Ga0213872_100448662 206
129 3300021361 Ga0213872_10121531 Ga0213872_101215312 206
130 3300025263 Ga0209565_1000123 Ga0209565_100012371 206
131 3300025273 Ga0209673_1000040 Ga0209673_1000040259 206
132 3300025291 Ga0209675_1000117 Ga0209675_100011734 206
133 3300025295 Ga0209564_1000121 Ga0209564_1000121154 206
134 3300025299 Ga0209256_1000288 Ga0209256_100028815 206
135 3300031711 Ga0265314_10011332 Ga0265314_100113324 206
136 3300035691 Ga0373931_0012232 Ga0373931_0012232_573_1244 206
137 3300039447 Ga0436361_0002419 Ga0436361_0002419_936_1619 206
138 3300039447 Ga0436361_0235534 Ga0436361_0235534_1845_2603 206
139 3300039447 Ga0436361_0906875 Ga0436361_0906875_648_1391 206
140 3300039447 Ga0436361_0938421 Ga0436361_0938421_1493_2179 206
141 3300046452 Ga0495617_071252 Ga0495617_071252_161_835 206
142 3300046471 Ga0495650_0000436 Ga0495650_0000436_42274_42942 206
143 3300046491 Ga0495584_0101765 Ga0495584_0101765_317_973 206
144 3300046507 Ga0495606_0007596 Ga0495606_0007596_3816_4484 206
145 3300046519 Ga0495632_0011228 Ga0495632_0011228_4421_5083 206
146 3300046524 Ga0495648_0035985 Ga0495648_0035985_1108_1782 206
147 3300046616 Ga0495668_0000427 Ga0495668_0000427_27129_27794 206
148 3300046810 Ga0495660_0096953 Ga0495660_0096953_465_1157 206
149 3300047469 Ga0495673_0000248 Ga0495673_0000248_53949_54623 206
150 3300053118 Ga0500594_0013202 Ga0500594_0013202_817_1491 206
151 iso_pu_bacteria 2738541297 2738826821 206
152 iso_pu_bacteria 2738541357 2739150618 206
153 iso_pu_bacteria 2738543003 2739192537 206
154 iso_pu_bacteria 2738543026 2739319014 206
155 iso_pu_bacteria 2738543029 2739337255 206
156 3300021361 Ga0213872_10000005 Ga0213872_1000000523 207
157 3300028794 Ga0307515_10000084 Ga0307515_10000084199 207
158 3300031456 Ga0307513_10070736 Ga0307513_100707363 207
159 3300031649 Ga0307514_10000954 Ga0307514_100009547 207
160 3300039447 Ga0436361_0820978 Ga0436361_0820978_28563_29249 207
161 3300046455 Ga0495603_0066461 Ga0495603_0066461_1384_2055 207
162 3300046459 Ga0495629_0077429 Ga0495629_0077429_1021_1692 207
163 3300046473 Ga0495582_0021263 Ga0495582_0021263_433_1104 207
164 3300046492 Ga0495585_0056041 Ga0495585_0056041_32_703 207
165 3300046499 Ga0495594_0001208 Ga0495594_0001208_12451_13122 207
166 3300046526 Ga0495666_0075542 Ga0495666_0075542_363_1034 207
167 3300046557 Ga0495622_0012944 Ga0495622_0012944_1698_2369 207
168 3300046674 Ga0495588_0106890 Ga0495588_0106890_48_719 207
169 3300047320 Ga0495672_0000013 Ga0495672_0000013_49558_50250 207
170 3300047321 Ga0495676_0067465 Ga0495676_0067465_921_1592 207
171 3300049523 Ga0501300_000189 Ga0501300_000189_713_1375 207
172 3300049778 Ga0501282_000116 Ga0501282_000116_7936_8598 207
173 3300049853 Ga0501226_000204 Ga0501226_000204_733_1395 207
174 3300002773 JGI25152J39213_1000224 JGI25152J39213_10002243 208
175 3300002774 JGI25150J39212_1000695 JGI25150J39212_10006959 208
176 3300003215 JGI25153J46596_10002862 JGI25153J46596_100028624 208
177 3300003775 Ga0055524_1001031 Ga0055524_10010312 208
178 3300003791 Ga0055530_10012220 Ga0055530_100122202 208
179 3300003794 Ga0055531_10026594 Ga0055531_100265942 208
180 3300009176 Ga0105242_10004610 Ga0105242_100046103 208
181 3300025245 Ga0207425_1000021 Ga0207425_100002162 208
182 3300025258 Ga0209129_1000020 Ga0209129_1000020133 208
183 3300025263 Ga0209565_1042551 Ga0209565_10425512 208
184 3300025297 Ga0209758_1000077 Ga0209758_1000077202 208
185 3300025299 Ga0209256_1000674 Ga0209256_100067425 208
186 3300025934 Ga0207686_10093816 Ga0207686_100938162 208
187 3300031731 Ga0307405_10052848 Ga0307405_100528483 208
188 3300031901 Ga0307406_10344423 Ga0307406_103444232 208
189 3300042115 Ga0450911_000361 Ga0450911_000361_12126_12800 208
190 3300046530 Ga0495654_0001107 Ga0495654_0001107_2830_3495 208
191 3300046558 Ga0495633_0002397 Ga0495633_0002397_6431_7108 208
192 3300048917 Ga0496114_0065855 Ga0496114_0065855_972_1643 208
193 3300048924 Ga0496121_0007721 Ga0496121_0007721_5978_6652 208
194 3300048927 Ga0496124_0026956 Ga0496124_0026956_1090_1764 208
195 3300048928 Ga0496125_0003307 Ga0496125_0003307_8231_8905 208
196 3300048928 Ga0496125_0007029 Ga0496125_0007029_3639_4313 208
197 3300048928 Ga0496125_0007689 Ga0496125_0007689_2080_2751 208
198 3300048929 Ga0496126_0189803 Ga0496126_0189803_626_1300 208
199 3300049679 Ga0501249_016396 Ga0501249_016396_873_1544 208
200 iso_pu_bacteria 2990710928 2990713995 208
201 3300003322 rootL2_10043261 rootL2_100432614 209
202 3300003763 Ga0055529_1000079 Ga0055529_100007955 209
203 3300025233 Ga0209437_105622 Ga0209437_1056222 209
204 3300025263 Ga0209565_1001882 Ga0209565_10018826 209
205 3300025272 Ga0209455_1000070 Ga0209455_1000070218 209
206 3300031548 Ga0307408_100002211 Ga0307408_1000022114 209
207 3300031548 Ga0307408_100062045 Ga0307408_1000620452 209
208 3300037466 Ga0395898_0335880 Ga0395898_0335880_109_786 209
209 3300046452 Ga0495617_004444 Ga0495617_004444_2797_3462 209
210 3300046452 Ga0495617_005143 Ga0495617_005143_1704_2378 209
211 3300046452 Ga0495617_022766 Ga0495617_022766_253_918 209
212 3300046457 Ga0495590_0008308 Ga0495590_0008308_906_1571 209
213 3300046460 Ga0495638_0002305 Ga0495638_0002305_8515_9177 209
214 3300046471 Ga0495650_0012473 Ga0495650_0012473_2788_3462 209
215 3300046474 Ga0495605_0000764 Ga0495605_0000764_9530_10192 209
216 3300046492 Ga0495585_0028549 Ga0495585_0028549_1122_1787 209
217 3300046501 Ga0495607_0137403 Ga0495607_0137403_31_696 209
218 3300046501 Ga0495607_0147241 Ga0495607_0147241_152_817 209
219 3300046501 Ga0495607_0154514 Ga0495607_0154514_400_1062 209
220 3300046506 Ga0495583_0000317 Ga0495583_0000317_33559_34221 209
221 3300046507 Ga0495606_0002563 Ga0495606_0002563_14160_14834 209
222 3300046507 Ga0495606_0039459 Ga0495606_0039459_1978_2640 209
223 3300046513 Ga0495616_0005282 Ga0495616_0005282_400_1062 209
224 3300046513 Ga0495616_0036761 Ga0495616_0036761_409_1071 209
225 3300046520 Ga0495637_0004230 Ga0495637_0004230_5022_5696 209
226 3300046524 Ga0495648_0002610 Ga0495648_0002610_6191_6853 209
227 3300046530 Ga0495654_0003528 Ga0495654_0003528_4092_4754 209
228 3300046538 Ga0495609_0003502 Ga0495609_0003502_1573_2235 209
229 3300046542 Ga0495597_0001085 Ga0495597_0001085_6056_6736 209
230 3300046542 Ga0495597_0025389 Ga0495597_0025389_393_1055 209
231 3300046557 Ga0495622_0027453 Ga0495622_0027453_1114_1779 209
232 3300046558 Ga0495633_0024806 Ga0495633_0024806_1935_2600 209
233 3300046615 Ga0495656_0014975 Ga0495656_0014975_1685_2350 209
234 3300046648 Ga0495611_0122343 Ga0495611_0122343_400_1062 209
235 3300046660 Ga0495625_0001192 Ga0495625_0001192_6080_6742 209
236 3300046660 Ga0495625_0007946 Ga0495625_0007946_6074_6739 209
237 3300046664 Ga0495659_0000114 Ga0495659_0000114_29269_29931 209
238 3300046664 Ga0495659_0001963 Ga0495659_0001963_4461_5123 209
239 3300046691 Ga0495670_0004436 Ga0495670_0004436_5749_6411 209
240 3300046691 Ga0495670_0043035 Ga0495670_0043035_1520_2182 209
241 3300046692 Ga0495671_0000437 Ga0495671_0000437_5984_6646 209
242 3300046692 Ga0495671_0015212 Ga0495671_0015212_2416_3090 209
243 3300046692 Ga0495671_0090165 Ga0495671_0090165_569_1231 209
244 3300046694 Ga0495649_0117448 Ga0495649_0117448_358_1020 209
245 3300047318 Ga0495636_0001201 Ga0495636_0001201_6758_7420 209
246 3300047320 Ga0495672_0000297 Ga0495672_0000297_25707_26369 209
247 3300047320 Ga0495672_0024677 Ga0495672_0024677_2025_2687 209
248 3300047320 Ga0495672_0047519 Ga0495672_0047519_592_1254 209
249 3300047323 Ga0495683_0000773 Ga0495683_0000773_17173_17835 209
250 3300047443 Ga0495687_000342 Ga0495687_000342_41973_42635 209
251 3300047445 Ga0495677_0002300 Ga0495677_0002300_750_1412 209
252 3300047447 Ga0495685_000088 Ga0495685_000088_6893_7555 209
253 3300047469 Ga0495673_0004072 Ga0495673_0004072_4757_5422 209
254 3300047472 Ga0495686_0025863 Ga0495686_0025863_1013_1675 209
255 3300049459 Ga0495678_006816 Ga0495678_006816_4547_5212 209
256 3300049527 Ga0501311_000115 Ga0501311_000115_1541_2227 209
257 3300049573 Ga0501037_0046723 Ga0501037_0046723_1250_1936 209
258 3300049763 Ga0501266_000050 Ga0501266_000050_9306_9989 209
259 iso_pu_bacteria 2643221554 2643792043 209
260 iso_pu_bacteria 2643221638 2644216476 209
261 iso_pu_bacteria 2643221645 2644254778 209
262 iso_pu_bacteria 2643221664 2644360331 209
263 iso_pu_bacteria 2738541280 2738738086 209
264 iso_pu_bacteria 2738541300 2738843123 209
265 iso_pu_bacteria 2738543018 2739273874 209
266 iso_pu_bacteria 2738543030 2739342918 209
267 3300005293 Ga0065715_10030871 Ga0065715_100308713 210
268 3300030731 Ga0316177_1067313 Ga0316177_10673132 210
269 3300030736 Ga0316180_1166365 Ga0316180_11663652 210
270 3300032002 Ga0307416_100013029 Ga0307416_1000130293 210
271 3300039447 Ga0436361_0491134 Ga0436361_0491134_79_729 210
272 3300046452 Ga0495617_047270 Ga0495617_047270_640_1308 210
273 3300046453 Ga0495627_073987 Ga0495627_073987_143_811 210
274 3300046455 Ga0495603_0050867 Ga0495603_0050867_1511_2182 210
275 3300046457 Ga0495590_0024247 Ga0495590_0024247_658_1326 210
276 3300046459 Ga0495629_0001463 Ga0495629_0001463_15664_16335 210
277 3300046460 Ga0495638_0009129 Ga0495638_0009129_1866_2534 210
278 3300046471 Ga0495650_0000200 Ga0495650_0000200_15754_16428 210
279 3300046474 Ga0495605_0190117 Ga0495605_0190117_171_839 210
280 3300046491 Ga0495584_0000005 Ga0495584_0000005_33172_33837 210
281 3300046491 Ga0495584_0000308 Ga0495584_0000308_17912_18577 210
282 3300046491 Ga0495584_0007528 Ga0495584_0007528_1714_2385 210
283 3300046491 Ga0495584_0044957 Ga0495584_0044957_821_1489 210
284 3300046491 Ga0495584_0050856 Ga0495584_0050856_697_1365 210
285 3300046491 Ga0495584_0053991 Ga0495584_0053991_1193_1864 210
286 3300046492 Ga0495585_0000599 Ga0495585_0000599_6933_7601 210
287 3300046492 Ga0495585_0002632 Ga0495585_0002632_5922_6587 210
288 3300046492 Ga0495585_0025891 Ga0495585_0025891_863_1531 210
289 3300046492 Ga0495585_0032642 Ga0495585_0032642_2251_2916 210
290 3300046492 Ga0495585_0044226 Ga0495585_0044226_1496_2167 210
291 3300046499 Ga0495594_0017324 Ga0495594_0017324_2472_3143 210
292 3300046500 Ga0495596_0003746 Ga0495596_0003746_4810_5478 210
293 3300046500 Ga0495596_0008572 Ga0495596_0008572_2573_3238 210
294 3300046500 Ga0495596_0040055 Ga0495596_0040055_1162_1830 210
295 3300046500 Ga0495596_0108822 Ga0495596_0108822_240_911 210
296 3300046501 Ga0495607_0012662 Ga0495607_0012662_2828_3496 210
297 3300046506 Ga0495583_0000214 Ga0495583_0000214_84629_85300 210
298 3300046506 Ga0495583_0005023 Ga0495583_0005023_2653_3327 210
299 3300046506 Ga0495583_0005716 Ga0495583_0005716_7110_7778 210
300 3300046506 Ga0495583_0125294 Ga0495583_0125294_325_990 210
301 3300046507 Ga0495606_0012487 Ga0495606_0012487_2573_3241 210
302 3300046507 Ga0495606_0019003 Ga0495606_0019003_857_1522 210
303 3300046507 Ga0495606_0019986 Ga0495606_0019986_3234_3902 210
304 3300046507 Ga0495606_0128304 Ga0495606_0128304_394_1062 210
305 3300046507 Ga0495606_0131117 Ga0495606_0131117_364_1029 210
306 3300046513 Ga0495616_0000234 Ga0495616_0000234_15960_16634 210
307 3300046513 Ga0495616_0018502 Ga0495616_0018502_1852_2517 210
308 3300046513 Ga0495616_0133227 Ga0495616_0133227_227_895 210
309 3300046518 Ga0495631_0028593 Ga0495631_0028593_1371_2042 210
310 3300046520 Ga0495637_0064388 Ga0495637_0064388_458_1132 210
311 3300046522 Ga0495643_0001515 Ga0495643_0001515_4484_5158 210
312 3300046522 Ga0495643_0008569 Ga0495643_0008569_3878_4546 210
313 3300046524 Ga0495648_0009448 Ga0495648_0009448_562_1221 210
314 3300046524 Ga0495648_0027424 Ga0495648_0027424_1983_2654 210
315 3300046524 Ga0495648_0118886 Ga0495648_0118886_496_1164 210
316 3300046525 Ga0495663_0008275 Ga0495663_0008275_172_840 210
317 3300046525 Ga0495663_0009279 Ga0495663_0009279_292_963 210
318 3300046525 Ga0495663_0021527 Ga0495663_0021527_520_1188 210
319 3300046525 Ga0495663_0104245 Ga0495663_0104245_71_736 210
320 3300046528 Ga0495642_0001130 Ga0495642_0001130_5974_6639 210
321 3300046528 Ga0495642_0003971 Ga0495642_0003971_3164_3829 210
322 3300046528 Ga0495642_0012611 Ga0495642_0012611_2045_2713 210
323 3300046528 Ga0495642_0035959 Ga0495642_0035959_1229_1897 210
324 3300046530 Ga0495654_0045079 Ga0495654_0045079_1241_1915 210
325 3300046531 Ga0495665_0021889 Ga0495665_0021889_1210_1881 210
326 3300046538 Ga0495609_0031660 Ga0495609_0031660_1342_2007 210
327 3300046542 Ga0495597_0001027 Ga0495597_0001027_17724_18386 210
328 3300046542 Ga0495597_0030651 Ga0495597_0030651_291_956 210
329 3300046542 Ga0495597_0131002 Ga0495597_0131002_138_809 210
330 3300046557 Ga0495622_0089051 Ga0495622_0089051_305_973 210
331 3300046558 Ga0495633_0002578 Ga0495633_0002578_9605_10270 210
332 3300046558 Ga0495633_0019657 Ga0495633_0019657_1323_1994 210
333 3300046558 Ga0495633_0043891 Ga0495633_0043891_1298_1966 210
334 3300046558 Ga0495633_0094229 Ga0495633_0094229_381_1046 210
335 3300046615 Ga0495656_0165110 Ga0495656_0165110_250_918 210
336 3300046616 Ga0495668_0017881 Ga0495668_0017881_2792_3460 210
337 3300046616 Ga0495668_0046337 Ga0495668_0046337_568_1236 210
338 3300046616 Ga0495668_0086883 Ga0495668_0086883_896_1567 210
339 3300046648 Ga0495611_0003429 Ga0495611_0003429_2451_3119 210
340 3300046648 Ga0495611_0008811 Ga0495611_0008811_1496_2167 210
341 3300046648 Ga0495611_0013233 Ga0495611_0013233_484_1152 210
342 3300046660 Ga0495625_0065676 Ga0495625_0065676_668_1336 210
343 3300046663 Ga0495635_0018505 Ga0495635_0018505_2844_3515 210
344 3300046665 Ga0495661_0005515 Ga0495661_0005515_5929_6594 210
345 3300046665 Ga0495661_0036104 Ga0495661_0036104_19_684 210
346 3300046665 Ga0495661_0062470 Ga0495661_0062470_1060_1734 210
347 3300046665 Ga0495661_0075193 Ga0495661_0075193_580_1248 210
348 3300046674 Ga0495588_0011666 Ga0495588_0011666_2283_2954 210
349 3300046674 Ga0495588_0183835 Ga0495588_0183835_290_961 210
350 3300046679 Ga0495623_0161582 Ga0495623_0161582_82_747 210
351 3300046691 Ga0495670_0015815 Ga0495670_0015815_107_775 210
352 3300046691 Ga0495670_0021735 Ga0495670_0021735_2465_3136 210
353 3300046691 Ga0495670_0023607 Ga0495670_0023607_1244_1909 210
354 3300046691 Ga0495670_0130287 Ga0495670_0130287_499_1167 210
355 3300046692 Ga0495671_0046881 Ga0495671_0046881_615_1283 210
356 3300046694 Ga0495649_0142273 Ga0495649_0142273_301_975 210
357 3300046794 Ga0495589_0011854 Ga0495589_0011854_382_1050 210
358 3300046794 Ga0495589_0034924 Ga0495589_0034924_1005_1676 210
359 3300046794 Ga0495589_0040997 Ga0495589_0040997_671_1339 210
360 3300046794 Ga0495589_0061071 Ga0495589_0061071_100_768 210
361 3300047318 Ga0495636_0012088 Ga0495636_0012088_1491_2159 210
362 3300047318 Ga0495636_0014953 Ga0495636_0014953_2300_2968 210
363 3300047318 Ga0495636_0032332 Ga0495636_0032332_908_1576 210
364 3300047318 Ga0495636_0138818 Ga0495636_0138818_194_865 210
365 3300047318 Ga0495636_0242849 Ga0495636_0242849_122_790 210
366 3300047319 Ga0495674_0000762 Ga0495674_0000762_26301_26972 210
367 3300047321 Ga0495676_0018079 Ga0495676_0018079_4610_5278 210
368 3300047321 Ga0495676_0132611 Ga0495676_0132611_1027_1695 210
369 3300047321 Ga0495676_0264751 Ga0495676_0264751_448_1119 210
370 3300047323 Ga0495683_0000589 Ga0495683_0000589_1621_2286 210
371 3300047323 Ga0495683_0084604 Ga0495683_0084604_403_1083 210
372 3300047323 Ga0495683_0101452 Ga0495683_0101452_290_958 210
373 3300047445 Ga0495677_0005748 Ga0495677_0005748_2264_2932 210
374 3300047445 Ga0495677_0018004 Ga0495677_0018004_1865_2533 210
375 3300047447 Ga0495685_004449 Ga0495685_004449_2579_3247 210
376 3300047447 Ga0495685_018222 Ga0495685_018222_1718_2386 210
377 3300047447 Ga0495685_064936 Ga0495685_064936_485_1156 210
378 3300047469 Ga0495673_0032573 Ga0495673_0032573_1651_2319 210
379 3300047470 Ga0495681_0013502 Ga0495681_0013502_2080_2748 210
380 3300047470 Ga0495681_0022109 Ga0495681_0022109_1131_1796 210
381 3300047472 Ga0495686_0068655 Ga0495686_0068655_465_1133 210
382 3300047673 Ga0495593_0006893 Ga0495593_0006893_3715_4386 210
383 3300048089 Ga0495614_0048445 Ga0495614_0048445_57_728 210
384 3300048091 Ga0495626_0001076 Ga0495626_0001076_17023_17697 210
385 3300048091 Ga0495626_0002479 Ga0495626_0002479_4500_5165 210
386 3300048091 Ga0495626_0004782 Ga0495626_0004782_4859_5530 210
387 3300048091 Ga0495626_0017095 Ga0495626_0017095_2125_2793 210
388 3300048091 Ga0495626_0017369 Ga0495626_0017369_2503_3171 210
389 3300048091 Ga0495626_0018346 Ga0495626_0018346_2276_2950 210
390 3300048905 Ga0496102_0000074 Ga0496102_0000074_28853_29521 210
391 3300048906 Ga0496103_0004962 Ga0496103_0004962_2910_3578 210
392 3300048906 Ga0496103_0013075 Ga0496103_0013075_1816_2496 210
393 3300048906 Ga0496103_0392041 Ga0496103_0392041_160_828 210
394 3300048918 Ga0496115_0024122 Ga0496115_0024122_1886_2551 210
395 3300049129 Ga0501309_007948 Ga0501309_007948_441_1112 210
396 3300049130 Ga0501310_010489 Ga0501310_010489_187_858 210
397 3300049459 Ga0495678_017265 Ga0495678_017265_2100_2780 210
398 3300049539 Ga0501323_003508 Ga0501323_003508_923_1594 210
399 iso_pu_bacteria 2821131069 2821135846 210
400 iso_pu_bacteria 2842711865 2842712308 210
401 iso_pu_bacteria 2857553236 2857556245 210
402 iso_pu_bacteria 2857558681 2857560831 210
403 iso_pu_bacteria 2857564685 2857568031 210
404 iso_pu_bacteria 2904424332 2904428830 210
405 iso_pu_bacteria 2919476304 2919476997 210
406 3300006028 Ga0070717_10005399 Ga0070717_100053996 211
407 3300046507 Ga0495606_0000433 Ga0495606_0000433_33343_34002 211
408 3300048907 Ga0496104_0106876 Ga0496104_0106876_1763_2425 211
409 3300003322 rootL2_10117747 rootL2_101177473 212
410 3300003771 Ga0055526_1025078 Ga0055526_10250782 212
411 3300003773 Ga0055537_1009101 Ga0055537_10091013 212
412 3300003775 Ga0055524_1024546 Ga0055524_10245462 212
413 3300003784 Ga0055534_1010627 Ga0055534_10106272 212
414 3300003791 Ga0055530_10012761 Ga0055530_100127612 212
415 3300009036 Ga0105244_10000158 Ga0105244_1000015824 212
416 3300025263 Ga0209565_1007111 Ga0209565_10071112 212
417 3300025263 Ga0209565_1007877 Ga0209565_10078772 212
418 3300025728 Ga0207655_1000710 Ga0207655_100071020 212
419 3300046528 Ga0495642_0009415 Ga0495642_0009415_653_1315 212
420 3300047472 Ga0495686_0001635 Ga0495686_0001635_20059_20724 212
421 3300048906 Ga0496103_0002217 Ga0496103_0002217_6148_6819 212
422 3300048924 Ga0496121_0213017 Ga0496121_0213017_188_862 212
423 3300002739 JGI25158J39367_1004283 JGI25158J39367_10042833 213
424 3300002739 JGI25158J39367_1009023 JGI25158J39367_10090232 213
425 3300002774 JGI25150J39212_1003218 JGI25150J39212_10032183 213
426 3300002987 JGI25159J45721_1008142 JGI25159J45721_10081422 213
427 3300002987 JGI25159J45721_1008146 JGI25159J45721_10081462 213
428 3300003354 JGI25160J50197_1004010 JGI25160J50197_10040103 213
429 3300003374 JGI25161J50226_1004038 JGI25161J50226_10040383 213
430 3300003374 JGI25161J50226_1004505 JGI25161J50226_10045052 213
431 3300003771 Ga0055526_1009451 Ga0055526_10094514 213
432 3300003773 Ga0055537_1008149 Ga0055537_10081492 213
433 3300003775 Ga0055524_1000024 Ga0055524_100002435 213
434 3300003775 Ga0055524_1013018 Ga0055524_10130183 213
435 3300003784 Ga0055534_1001588 Ga0055534_10015882 213
436 3300003790 Ga0055528_1001043 Ga0055528_100104311 213
437 3300003791 Ga0055530_10012804 Ga0055530_100128042 213
438 3300003794 Ga0055531_10017652 Ga0055531_100176522 213
439 3300004625 Ga0055543_1006140 Ga0055543_10061402 213
440 3300005262 Ga0065165_1015177 Ga0065165_10151772 213
441 3300006946 Ga0079104_1016105 Ga0079104_10161052 213
442 3300006948 Ga0099826_10000010 Ga0099826_10000010226 213
443 3300015261 Ga0182006_1000141 Ga0182006_100014112 213
444 3300015262 Ga0182007_10048524 Ga0182007_100485242 213
445 3300015265 Ga0182005_1000016 Ga0182005_1000016245 213
446 3300025208 Ga0209436_100928 Ga0209436_1009287 213
447 3300025208 Ga0209436_111640 Ga0209436_1116402 213
448 3300025245 Ga0207425_1000223 Ga0207425_100022326 213
449 3300025258 Ga0209129_1004870 Ga0209129_10048703 213
450 3300025263 Ga0209565_1006129 Ga0209565_10061293 213
451 3300025263 Ga0209565_1006737 Ga0209565_10067373 213
452 3300025273 Ga0209673_1002575 Ga0209673_10025754 213
453 3300025284 Ga0209130_1007638 Ga0209130_10076383 213
454 3300025291 Ga0209675_1000650 Ga0209675_100065019 213
455 3300025291 Ga0209675_1003691 Ga0209675_10036915 213
456 3300025295 Ga0209564_1000780 Ga0209564_100078025 213
457 3300025295 Ga0209564_1006698 Ga0209564_10066982 213
458 3300025295 Ga0209564_1011409 Ga0209564_10114093 213
459 3300025298 Ga0209050_1000050 Ga0209050_100005064 213
460 3300025298 Ga0209050_1000795 Ga0209050_100079525 213
461 3300025299 Ga0209256_1000054 Ga0209256_1000054217 213
462 3300025299 Ga0209256_1001001 Ga0209256_100100121 213
463 3300025299 Ga0209256_1002870 Ga0209256_10028704 213
464 3300025302 Ga0207426_1004227 Ga0207426_10042275 213
465 3300025303 Ga0209051_1025401 Ga0209051_10254012 213
466 3300025304 Ga0209257_1000075 Ga0209257_100007564 213
467 3300027111 Ga0209281_1002515 Ga0209281_10025154 213
468 3300027666 Ga0209282_1000072 Ga0209282_100007268 213
469 3300031548 Ga0307408_100000531 Ga0307408_10000053121 213
470 3300031548 Ga0307408_100001492 Ga0307408_10000149213 213
471 3300031548 Ga0307408_100053583 Ga0307408_1000535832 213
472 3300044683 Ga0466965_0003099 Ga0466965_0003099_171_839 213
473 3300044735 Ga0466968_0003648 Ga0466968_0003648_2357_3025 213
474 3300044901 Ga0466960_0090052 Ga0466960_0090052_785_1453 213
475 3300046453 Ga0495627_000011 Ga0495627_000011_299013_299702 213
476 3300046460 Ga0495638_0113464 Ga0495638_0113464_793_1473 213
477 3300046491 Ga0495584_0005003 Ga0495584_0005003_4953_5615 213
478 3300046507 Ga0495606_0023776 Ga0495606_0023776_3021_3701 213
479 3300046512 Ga0495610_0002788 Ga0495610_0002788_7045_7725 213
480 3300046512 Ga0495610_0003795 Ga0495610_0003795_8369_9049 213
481 3300046522 Ga0495643_0001510 Ga0495643_0001510_6222_6902 213
482 3300046522 Ga0495643_0068039 Ga0495643_0068039_1154_1843 213
483 3300046523 Ga0495644_0004709 Ga0495644_0004709_1242_1931 213
484 3300046524 Ga0495648_0052546 Ga0495648_0052546_924_1604 213
485 3300046538 Ga0495609_0002743 Ga0495609_0002743_3935_4624 213
486 3300046557 Ga0495622_0000210 Ga0495622_0000210_6141_6812 213
487 3300046660 Ga0495625_0228457 Ga0495625_0228457_11_691 213
488 3300046692 Ga0495671_0110878 Ga0495671_0110878_646_1326 213
489 3300046810 Ga0495660_0001240 Ga0495660_0001240_15916_16611 213
490 3300046810 Ga0495660_0003025 Ga0495660_0003025_5431_6120 213
491 3300047320 Ga0495672_0000353 Ga0495672_0000353_28805_29485 213
492 3300047443 Ga0495687_013104 Ga0495687_013104_3003_3674 213
493 3300048927 Ga0496124_0054348 Ga0496124_0054348_1318_2007 213
494 3300049129 Ga0501309_001993 Ga0501309_001993_923_1606 213
495 3300049459 Ga0495678_000010 Ga0495678_000010_305391_306080 213
496 3300049459 Ga0495678_001298 Ga0495678_001298_13451_14131 213
497 3300049766 Ga0501269_000202 Ga0501269_000202_5723_6415 213
498 3300053125 Ga0500618_016037 Ga0500618_016037_180_851 213
499 3300053136 Ga0500559_0245491 Ga0500559_0245491_149_829 213
500 3300002738 JGI25154J39366_1002311 JGI25154J39366_10023113 214
501 3300003771 Ga0055526_1000228 Ga0055526_100022835 214
502 3300025233 Ga0209437_103534 Ga0209437_1035343 214
503 3300025246 Ga0209646_1000068 Ga0209646_100006864 214
504 3300025295 Ga0209564_1000047 Ga0209564_100004768 214
505 3300046501 Ga0495607_0004516 Ga0495607_0004516_3497_4174 214
506 3300046507 Ga0495606_0003569 Ga0495606_0003569_9588_10265 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04350

PilO

Pilus assembly protein, PilO

90

231

0.98

Feature Viewer

pLDDT pTM Quality
77.54 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map