F456473

General Info

Members Datasets Scaffolds Average Seq Length
506 257 506 111

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10586615|Ga0070709_105866152
Length 125
Sequence MSHYAQVVVELTILVLAVFLGVEVISKVPTLLHTPLMSGTNAIHGIVIVGAMLVAGLGHKDTLTTVVGLVAVVLASANVVGGFVVTDRMLEMFRKRESPAAERAAAQDGGARGENQSKQEVPPSR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
111 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
145 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.46
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10026727 3300005327 Bacteria 4632
2 Ga0070658_10471629 3300005327 Bacteria 1083
3 Ga0070682_101054447 3300005337 Bacteria 678
4 Ga0068868_100694951 3300005338 Bacteria 909
5 Ga0068868_101552041 3300005338 Bacteria 621
6 Ga0070660_100888695 3300005339 Bacteria 751
7 Ga0070675_100054440 3300005354 Bacteria 3292
8 Ga0070675_100729097 3300005354 Bacteria 904
9 Ga0070671_100239516 3300005355 Bacteria 1540
10 Ga0070674_100510461 3300005356 Bacteria 1003
11 Ga0070673_100429499 3300005364 Bacteria 1186
12 Ga0070659_100019212 3300005366 Bacteria 5173
13 Ga0070703_10005274 3300005406 Bacteria 3612
14 Ga0070709_10059046 3300005434 Bacteria 2435
15 Ga0070709_10558580 3300005434 Bacteria 877
16 Ga0070709_10586615 3300005434 Bacteria 857
17 Ga0070714_100101812 3300005435 Bacteria 2531
18 Ga0070714_100351958 3300005435 Bacteria 1384
19 Ga0070714_100361230 3300005435 Bacteria 1365
20 Ga0070714_100572622 3300005435 Bacteria 1083
21 Ga0070713_100045966 3300005436 Bacteria 3580
22 Ga0070713_100132979 3300005436 Bacteria 2195
23 Ga0070710_10014415 3300005437 Bacteria 3980
24 Ga0070710_10799622 3300005437 Bacteria 674
25 Ga0070711_100069979 3300005439 Bacteria 2469
26 Ga0070711_100464866 3300005439 Bacteria 1038
27 Ga0070705_100002894 3300005440 Bacteria 8502
28 Ga0070705_100210611 3300005440 Bacteria 1339
29 Ga0070705_101245940 3300005440 Bacteria 614
30 Ga0070705_101471461 3300005440 Bacteria 570
31 Ga0070700_101408454 3300005441 Bacteria 589
32 Ga0070694_100006193 3300005444 Bacteria 7262
33 Ga0070694_100047985 3300005444 Bacteria 2871
34 Ga0070694_100304656 3300005444 Bacteria 1222
35 Ga0070694_101176721 3300005444 Bacteria 642
36 Ga0070708_100037183 3300005445 Bacteria 4246
37 Ga0070708_100057632 3300005445 Bacteria 3459
38 Ga0070708_100389274 3300005445 Bacteria 1314
39 Ga0070663_100434729 3300005455 Bacteria 1079
40 Ga0070678_100008721 3300005456 Bacteria 6089
41 Ga0070681_10008465 3300005458 Bacteria 10068
42 Ga0070681_10856727 3300005458 Bacteria 826
43 Ga0070681_11046327 3300005458 Bacteria 737
44 Ga0070706_100038404 3300005467 Bacteria 4419
45 Ga0070706_100043648 3300005467 Bacteria 4143
46 Ga0070706_100088455 3300005467 Bacteria 2872
47 Ga0070706_100510757 3300005467 Bacteria 1118
48 Ga0070706_100960178 3300005467 Bacteria 789
49 Ga0070707_100003070 3300005468 Bacteria 15819
50 Ga0070707_100173882 3300005468 Bacteria 2099
51 Ga0070707_100588788 3300005468 Bacteria 1075
52 Ga0070698_100034688 3300005471 Bacteria 5221
53 Ga0070698_100038281 3300005471 Bacteria 4942
54 Ga0070698_100592684 3300005471 Bacteria 1049
55 Ga0070698_101632941 3300005471 Bacteria 597
56 Ga0070699_100235316 3300005518 Bacteria 1634
57 Ga0070699_100333072 3300005518 Bacteria 1365
58 Ga0070699_100524129 3300005518 Bacteria 1077
59 Ga0070699_100751821 3300005518 Bacteria 892
60 Ga0070679_100023598 3300005530 Bacteria 6024
61 Ga0070679_100253203 3300005530 Bacteria 1717
62 Ga0070679_100826063 3300005530 Bacteria 870
63 Ga0070684_100251393 3300005535 Bacteria 1616
64 Ga0070684_100467994 3300005535 Bacteria 1166
65 Ga0070697_100222838 3300005536 Bacteria 1607
66 Ga0070697_100244935 3300005536 Bacteria 1532
67 Ga0070697_100411887 3300005536 Bacteria 1174
68 Ga0070695_100257646 3300005545 Bacteria 1272
69 Ga0070695_101291884 3300005545 Bacteria 602
70 Ga0070696_100049358 3300005546 Bacteria 2923
71 Ga0070665_100459816 3300005548 Bacteria 1283
72 Ga0070704_100065009 3300005549 Bacteria 2624
73 Ga0070704_101335655 3300005549 Bacteria 656
74 Ga0068855_100006798 3300005563 Bacteria 13873
75 Ga0068855_100091988 3300005563 Bacteria 3498
76 Ga0068855_100494557 3300005563 Bacteria 1330
77 Ga0068854_100763846 3300005578 Bacteria 840
78 Ga0070702_100101356 3300005615 Bacteria 1767
79 Ga0070702_100144567 3300005615 Bacteria 1519
80 Ga0068866_10138485 3300005718 Bacteria 1394
81 Ga0068861_100055152 3300005719 Bacteria 3030
82 Ga0070717_10291223 3300006028 Bacteria 1450
83 Ga0070717_10652036 3300006028 Bacteria 956
84 Ga0070715_10003951 3300006163 Bacteria 4798
85 Ga0070715_10491845 3300006163 Bacteria 700
86 Ga0070715_10521690 3300006163 Bacteria 684
87 Ga0070716_100003903 3300006173 Bacteria 7079
88 Ga0070716_100057665 3300006173 Bacteria 2232
89 Ga0070716_100360232 3300006173 Bacteria 1032
90 Ga0070716_100518622 3300006173 Bacteria 882
91 Ga0070712_100020734 3300006175 Bacteria 4304
92 Ga0070712_100228137 3300006175 Bacteria 1478
93 Ga0070712_100253123 3300006175 Bacteria 1408
94 Ga0070712_100314099 3300006175 Bacteria 1272
95 Ga0070712_100470163 3300006175 Bacteria 1050
96 Ga0070712_100641936 3300006175 Bacteria 901
97 Ga0070712_100739048 3300006175 Bacteria 841
98 Ga0070712_100775538 3300006175 Bacteria 821
99 Ga0097621_100095406 3300006237 Bacteria 2495
100 Ga0068871_100048828 3300006358 Bacteria 3418
101 Ga0075433_10271666 3300006852 Bacteria 1502
102 Ga0075434_100468731 3300006871 Bacteria 1281
103 Ga0075434_100633666 3300006871 Bacteria 1088
104 Ga0068865_100257254 3300006881 Bacteria 1381
105 Ga0075436_100004084 3300006914 Bacteria 10015
106 Ga0075435_100583954 3300007076 Bacteria 968
107 Ga0099795_10186346 3300007788 Bacteria 869
108 Ga0105240_10875162 3300009093 Bacteria 968
109 Ga0105245_11081481 3300009098 Bacteria 848
110 Ga0114129_10399847 3300009147 Bacteria 1811
111 Ga0114129_11529203 3300009147 Bacteria 819
112 Ga0114129_12201523 3300009147 Bacteria 663
113 Ga0105243_10023761 3300009148 Bacteria 4672
114 Ga0105243_10128751 3300009148 Bacteria 2145
115 Ga0105241_10301181 3300009174 Bacteria 1376
116 Ga0105241_10492329 3300009174 Bacteria 1092
117 Ga0105242_10151808 3300009176 Bacteria 2020
118 Ga0105249_10714928 3300009553 Bacteria 1062
119 Ga0099796_10047369 3300010159 Bacteria 1479
120 Ga0105239_10330974 3300010375 Bacteria 1718
121 Ga0105239_10711591 3300010375 Bacteria 1149
122 Ga0105239_12893100 3300010375 Bacteria 560
123 Ga0157371_10548278 3300013102 Bacteria 857
124 Ga0157370_10026629 3300013104 Bacteria 5706
125 Ga0157369_10002166 3300013105 Bacteria 23672
126 Ga0157369_10060832 3300013105 Bacteria 4072
127 Ga0157369_10884977 3300013105 Bacteria 916
128 Ga0157374_10277799 3300013296 Bacteria 1653
129 Ga0157374_10835336 3300013296 Bacteria 938
130 Ga0157374_11958157 3300013296 Bacteria 612
131 Ga0163162_10384806 3300013306 Bacteria 1536
132 Ga0157372_10584714 3300013307 Bacteria 1301
133 Ga0157372_10735617 3300013307 Bacteria 1147
134 Ga0182005_1204703 3300015265 Bacteria 595
135 Ga0213871_10010293 3300021441 Bacteria 2118
136 Ga0207653_10007254 3300025885 Bacteria 3458
137 Ga0207692_10121132 3300025898 Bacteria 1465
138 Ga0207692_10191990 3300025898 Bacteria 1196
139 Ga0207692_10405242 3300025898 Bacteria 851
140 Ga0207688_10572874 3300025901 Bacteria 710
141 Ga0207647_10483560 3300025904 Bacteria 691
142 Ga0207685_10267487 3300025905 Bacteria 834
143 Ga0207685_10640930 3300025905 Bacteria 574
144 Ga0207699_10025326 3300025906 Bacteria 3255
145 Ga0207699_10028410 3300025906 Bacteria 3108
146 Ga0207699_10413101 3300025906 Bacteria 963
147 Ga0207705_10010191 3300025909 Bacteria 6837
148 Ga0207705_10893021 3300025909 Bacteria 688
149 Ga0207684_10050106 3300025910 Bacteria 3542
150 Ga0207684_10128178 3300025910 Bacteria 2178
151 Ga0207684_10132903 3300025910 Bacteria 2136
152 Ga0207684_10293310 3300025910 Bacteria 1402
153 Ga0207684_11112551 3300025910 Bacteria 657
154 Ga0207654_10541429 3300025911 Bacteria 826
155 Ga0207654_10551277 3300025911 Bacteria 819
156 Ga0207707_10041370 3300025912 Bacteria 4025
157 Ga0207707_10086212 3300025912 Bacteria 2744
158 Ga0207707_10203463 3300025912 Bacteria 1726
159 Ga0207707_11126271 3300025912 Bacteria 638
160 Ga0207707_11229023 3300025912 Bacteria 605
161 Ga0207695_11007212 3300025913 Bacteria 713
162 Ga0207693_10000953 3300025915 Bacteria 25942
163 Ga0207693_10001391 3300025915 Bacteria 21447
164 Ga0207693_10009293 3300025915 Bacteria 8022
165 Ga0207693_10051203 3300025915 Bacteria 3241
166 Ga0207693_10072315 3300025915 Bacteria 2700
167 Ga0207693_10265536 3300025915 Bacteria 1345
168 Ga0207663_10948470 3300025916 Bacteria 689
169 Ga0207660_10288493 3300025917 Bacteria 1304
170 Ga0207660_10508604 3300025917 Bacteria 977
171 Ga0207660_11665712 3300025917 Bacteria 513
172 Ga0207657_10011588 3300025919 Bacteria 8746
173 Ga0207657_10757933 3300025919 Bacteria 752
174 Ga0207649_10746649 3300025920 Bacteria 761
175 Ga0207652_10056113 3300025921 Bacteria 3390
176 Ga0207652_10702095 3300025921 Bacteria 902
177 Ga0207652_10928294 3300025921 Bacteria 768
178 Ga0207652_11536936 3300025921 Bacteria 570
179 Ga0207646_10002172 3300025922 Bacteria 23421
180 Ga0207646_10120231 3300025922 Bacteria 2360
181 Ga0207646_10222027 3300025922 Bacteria 1707
182 Ga0207646_10863718 3300025922 Bacteria 804
183 Ga0207646_10926469 3300025922 Bacteria 772
184 Ga0207659_10035122 3300025926 Bacteria 3463
185 Ga0207687_10210724 3300025927 Bacteria 1524
186 Ga0207700_10000002 3300025928 Bacteria 775978
187 Ga0207700_10060181 3300025928 Bacteria 2875
188 Ga0207700_11770019 3300025928 Bacteria 544
189 Ga0207664_10043682 3300025929 Bacteria 3507
190 Ga0207664_10056887 3300025929 Bacteria 3108
191 Ga0207664_10817819 3300025929 Bacteria 838
192 Ga0207690_10010129 3300025932 Bacteria 5599
193 Ga0207709_10025785 3300025935 Bacteria 3369
194 Ga0207709_11814589 3300025935 Bacteria 507
195 Ga0207665_10006188 3300025939 Bacteria 7947
196 Ga0207665_10046470 3300025939 Bacteria 2908
197 Ga0207665_10280644 3300025939 Bacteria 1239
198 Ga0207665_10908870 3300025939 Bacteria 698
199 Ga0207661_10111098 3300025944 Bacteria 2318
200 Ga0207661_10121438 3300025944 Bacteria 2225
201 Ga0207667_10037939 3300025949 Bacteria 5149
202 Ga0207667_10469861 3300025949 Bacteria 1277
203 Ga0207668_11437470 3300025972 Bacteria 622
204 Ga0207640_10623446 3300025981 Bacteria 916
205 Ga0207677_10397273 3300026023 Bacteria 1168
206 Ga0207678_10298450 3300026067 Bacteria 1384
207 Ga0207675_100038564 3300026118 Bacteria 4458
208 Ga0207683_10100403 3300026121 Bacteria 2584
209 Ga0207683_10313775 3300026121 Bacteria 1436
210 Ga0207683_10687465 3300026121 Bacteria 948
211 Ga0268266_10090515 3300028379 Bacteria 2682
212 Ga0265338_10010589 3300028800 Bacteria 10786
213 Ga0265331_10273100 3300031250 Bacteria 758
214 Ga0265314_10156386 3300031711 Bacteria 1392
215 Ga0265342_10168463 3300031712 Bacteria 1207
216 Ga0307405_10100227 3300031731 Bacteria 1941
217 Ga0307413_10550604 3300031824 Bacteria 936
218 Ga0307409_101029576 3300031995 Bacteria 842
219 Ga0307409_101097158 3300031995 Bacteria 817
220 Ga0307415_100060137 3300032126 Bacteria 2624
221 Ga0373948_0005735 3300034817 Bacteria 2023
222 Ga0373959_0001226 3300034820 Bacteria 4136
223 Ga0373938_0068231 3300034957 Bacteria 845
224 Ga0373928_0002525 3300035084 Bacteria 3543
225 Ga0373934_0196216 3300035086 Bacteria 831
226 Ga0373940_0000525 3300035088 Bacteria 6044
227 Ga0373949_0002532 3300035090 Bacteria 4655
228 Ga0373951_0001381 3300035091 Bacteria 6371
229 Ga0373952_0000856 3300035092 Bacteria 5535
230 Ga0373939_0002044 3300035114 Bacteria 4815
231 Ga0373941_0000445 3300035115 Bacteria 8211
232 Ga0373957_0165985 3300035120 Bacteria 911
233 Ga0373960_0001131 3300035121 Bacteria 5770
234 Ga0373943_0076257 3300035170 Bacteria 1710
235 Ga0373943_0432450 3300035170 Bacteria 763
236 Ga0373942_0003190 3300035207 Bacteria 3872
237 Ga0373961_0005658 3300035241 Bacteria 3000
238 Ga0373962_0002372 3300035242 Bacteria 4501
239 Ga0373931_0005708 3300035691 Bacteria 5780
240 Ga0373927_0020337 3300035695 Bacteria 4354
241 Ga0373947_0001152 3300035725 Bacteria 16210
242 Ga0373937_0210482 3300036401 Bacteria 1829
243 Ga0373925_0144424 3300037068 Bacteria 1864
244 Ga0395899_0006155 3300037312 Bacteria 9302
245 Ga0395899_0010607 3300037312 Bacteria 7061
246 Ga0395899_0015362 3300037312 Bacteria 5836
247 Ga0395899_0042426 3300037312 Bacteria 3396
248 Ga0395899_0608901 3300037312 Bacteria 695
249 Ga0395900_0006779 3300037418 Bacteria 11890
250 Ga0395900_0019711 3300037418 Bacteria 6876
251 Ga0395900_0039108 3300037418 Bacteria 4888
252 Ga0395900_0067612 3300037418 Bacteria 3671
253 Ga0395900_0863142 3300037418 Bacteria 830
254 Ga0395900_0934440 3300037418 Bacteria 789
255 Ga0395900_0940524 3300037418 Bacteria 786
256 Ga0395900_1041657 3300037418 Bacteria 737
257 Ga0395898_0002248 3300037466 Bacteria 23454
258 Ga0395898_0022199 3300037466 Bacteria 6431
259 Ga0395898_0034891 3300037466 Bacteria 5006
260 Ga0395898_0036193 3300037466 Bacteria 4902
261 Ga0395898_0141924 3300037466 Bacteria 2299
262 Ga0395898_0273193 3300037466 Bacteria 1612
263 Ga0395898_1541833 3300037466 Bacteria 590
264 Ga0395905_0030777 3300037471 Bacteria 5055
265 Ga0395905_0231070 3300037471 Bacteria 1729
266 Ga0395905_0373896 3300037471 Bacteria 1318
267 Ga0395905_0448904 3300037471 Bacteria 1187
268 Ga0395905_1300558 3300037471 Bacteria 631
269 Ga0395905_1389426 3300037471 Bacteria 606
270 Ga0395905_1801851 3300037471 Bacteria 518
271 Ga0436364_0593312 3300037853 Bacteria 596
272 Ga0395901_0003877 3300038443 Bacteria 15032
273 Ga0395901_0020642 3300038443 Bacteria 6741
274 Ga0395901_0087931 3300038443 Bacteria 3249
275 Ga0395901_0238946 3300038443 Bacteria 1895
276 Ga0395901_0479372 3300038443 Bacteria 1269
277 Ga0395901_0942686 3300038443 Bacteria 842
278 Ga0436360_0338877 3300039438 Bacteria 4323
279 Ga0436362_0709804 3300039453 Bacteria 1674
280 Ga0439438_051135 3300041405 Bacteria 1050
281 Ga0439461_0014079 3300041410 Bacteria 1516
282 Ga0451802_0252418 3300041460 Bacteria 3577
283 Ga0439445_0012348 3300042004 Bacteria 2051
284 Ga0439445_0043643 3300042004 Bacteria 1197
285 Ga0450898_010981 3300042134 Bacteria 1476
286 Ga0450910_066997 3300042147 Bacteria 613
287 Ga0439446_0021852 3300042156 Bacteria 1810
288 Ga0439434_0154182 3300042435 Bacteria 761
289 Ga0466965_0448598 3300044683 Bacteria 718
290 Ga0466965_0619136 3300044683 Bacteria 616
291 Ga0466966_0529807 3300044684 Bacteria 709
292 Ga0466963_0003326 3300044694 Bacteria 9171
293 Ga0466963_0013449 3300044694 Bacteria 5025
294 Ga0466963_0014387 3300044694 Bacteria 4877
295 Ga0466964_0012463 3300044706 Bacteria 3216
296 Ga0466964_0073128 3300044706 Bacteria 1454
297 Ga0466964_0159243 3300044706 Bacteria 1054
298 Ga0466968_0671495 3300044735 Bacteria 527
299 Ga0466957_0141871 3300044842 Bacteria 1548
300 Ga0466957_0348487 3300044842 Bacteria 1004
301 Ga0466957_0750771 3300044842 Bacteria 691
302 Ga0466960_0019663 3300044901 Bacteria 2979
303 Ga0466960_0720575 3300044901 Bacteria 599
304 Ga0466960_0962161 3300044901 Bacteria 523
305 Ga0451576_0771658 3300045051 Bacteria 1010
306 Ga0466958_0016507 3300045836 Bacteria 4253
307 Ga0466958_0447197 3300045836 Bacteria 836
308 Ga0466967_0012010 3300045976 Bacteria 6600
309 Ga0466967_0052748 3300045976 Bacteria 3571
310 Ga0466967_0088031 3300045976 Bacteria 2817
311 Ga0466967_0179760 3300045976 Bacteria 1995
312 Ga0466967_0726596 3300045976 Bacteria 984
313 Ga0466967_1965741 3300045976 Bacteria 581
314 Ga0495592_0230552 3300046454 Bacteria 1233
315 Ga0495590_0125914 3300046457 Bacteria 920
316 Ga0495629_0297054 3300046459 Bacteria 1107
317 Ga0495641_0036733 3300046461 Bacteria 2300
318 Ga0495641_0157623 3300046461 Bacteria 1015
319 Ga0495653_0188165 3300046463 Bacteria 1411
320 Ga0495653_0287506 3300046463 Bacteria 1077
321 Ga0495605_0126395 3300046474 Bacteria 1156
322 Ga0495639_0128084 3300046475 Bacteria 1214
323 Ga0495639_0679826 3300046475 Bacteria 531
324 Ga0495664_0263387 3300046477 Bacteria 1042
325 Ga0495584_0049414 3300046491 Bacteria 2119
326 Ga0495584_0183264 3300046491 Bacteria 1064
327 Ga0495583_0142587 3300046506 Bacteria 997
328 Ga0495608_0046583 3300046511 Bacteria 2885
329 Ga0495618_0167320 3300046514 Bacteria 1400
330 Ga0495630_0138883 3300046517 Bacteria 1847
331 Ga0495630_0356146 3300046517 Bacteria 1120
332 Ga0495630_0653441 3300046517 Bacteria 805
333 Ga0495637_0247008 3300046520 Bacteria 643
334 Ga0495637_0253107 3300046520 Bacteria 634
335 Ga0495663_0131002 3300046525 Bacteria 846
336 Ga0495642_0392231 3300046528 Bacteria 612
337 Ga0495654_0369421 3300046530 Bacteria 574
338 Ga0495665_0586355 3300046531 Bacteria 558
339 Ga0495665_0652437 3300046531 Bacteria 524
340 Ga0495586_0278553 3300046535 Bacteria 957
341 Ga0495609_0070939 3300046538 Bacteria 1531
342 Ga0495609_0144255 3300046538 Bacteria 1015
343 Ga0495621_0112254 3300046539 Bacteria 1046
344 Ga0495621_0138692 3300046539 Bacteria 950
345 Ga0495667_0048175 3300046559 Bacteria 2814
346 Ga0495667_0659883 3300046559 Bacteria 649
347 Ga0495667_0953192 3300046559 Bacteria 525
348 Ga0495656_0034872 3300046615 Bacteria 2064
349 Ga0495611_0076555 3300046648 Bacteria 1534
350 Ga0495635_0112873 3300046663 Bacteria 1856
351 Ga0495635_0532557 3300046663 Bacteria 771
352 Ga0495659_0014261 3300046664 Bacteria 2600
353 Ga0495661_0623134 3300046665 Bacteria 506
354 Ga0495646_0371461 3300046680 Bacteria 747
355 Ga0495589_0361198 3300046794 Bacteria 668
356 Ga0495600_0234466 3300046809 Bacteria 1171
357 Ga0495581_0309458 3300047315 Bacteria 923
358 Ga0495604_0585289 3300047317 Bacteria 717
359 Ga0495636_0096735 3300047318 Bacteria 1287
360 Ga0495674_1373238 3300047319 Bacteria 527
361 Ga0495676_0128452 3300047321 Bacteria 1833
362 Ga0495680_0015636 3300047322 Bacteria 6541
363 Ga0495680_0177854 3300047322 Bacteria 1537
364 Ga0495677_0148539 3300047445 Bacteria 902
365 Ga0495684_0257059 3300047471 Bacteria 1268
366 Ga0495602_0870752 3300048088 Bacteria 601
367 Ga0496100_0432140 3300048903 Bacteria 1007
368 Ga0496100_0668619 3300048903 Bacteria 809
369 Ga0496101_0026159 3300048904 Bacteria 4055
370 Ga0496101_0234896 3300048904 Bacteria 1426
371 Ga0496101_0240977 3300048904 Bacteria 1407
372 Ga0496102_0011395 3300048905 Bacteria 7662
373 Ga0496102_0081167 3300048905 Bacteria 2989
374 Ga0496102_0294176 3300048905 Bacteria 1530
375 Ga0496102_0391488 3300048905 Bacteria 1307
376 Ga0496103_0777842 3300048906 Bacteria 604
377 Ga0496104_0013936 3300048907 Bacteria 7255
378 Ga0496104_0021325 3300048907 Bacteria 5946
379 Ga0496104_0182337 3300048907 Bacteria 2010
380 Ga0496104_0443665 3300048907 Bacteria 1210
381 Ga0496104_0926049 3300048907 Bacteria 776
382 Ga0496105_0005138 3300048908 Bacteria 9928
383 Ga0496105_0123136 3300048908 Bacteria 2138
384 Ga0496105_0193326 3300048908 Bacteria 1663
385 Ga0496105_0420266 3300048908 Bacteria 1058
386 Ga0496105_0659057 3300048908 Bacteria 807
387 Ga0496105_0807533 3300048908 Bacteria 713
388 Ga0496106_0144546 3300048909 Bacteria 1872
389 Ga0496106_0318862 3300048909 Bacteria 1247
390 Ga0496107_0049945 3300048910 Bacteria 3014
391 Ga0496108_0008889 3300048911 Bacteria 8143
392 Ga0496109_0124963 3300048912 Bacteria 2398
393 Ga0496109_0129740 3300048912 Bacteria 2352
394 Ga0496109_0224835 3300048912 Bacteria 1765
395 Ga0496109_0783191 3300048912 Bacteria 892
396 Ga0496110_0030116 3300048913 Bacteria 4676
397 Ga0496110_0133275 3300048913 Bacteria 2244
398 Ga0496110_0572781 3300048913 Bacteria 1025
399 Ga0496110_0662431 3300048913 Bacteria 944
400 Ga0496110_0846829 3300048913 Bacteria 820
401 Ga0496110_1533730 3300048913 Bacteria 576
402 Ga0496110_1809213 3300048913 Bacteria 521
403 Ga0496111_0072433 3300048914 Bacteria 2508
404 Ga0496111_0081876 3300048914 Bacteria 2357
405 Ga0496111_0224794 3300048914 Bacteria 1394
406 Ga0496111_0286026 3300048914 Bacteria 1223
407 Ga0496111_0290483 3300048914 Bacteria 1212
408 Ga0496112_0014100 3300048915 Bacteria 7400
409 Ga0496112_0084785 3300048915 Bacteria 3134
410 Ga0496112_0139186 3300048915 Bacteria 2396
411 Ga0496112_0278451 3300048915 Bacteria 1620
412 Ga0496112_0552120 3300048915 Bacteria 1086
413 Ga0496112_0970129 3300048915 Bacteria 770
414 Ga0496112_1142271 3300048915 Bacteria 696
415 Ga0496113_0037640 3300048916 Bacteria 3552
416 Ga0496113_0106029 3300048916 Bacteria 2182
417 Ga0496114_0062245 3300048917 Bacteria 3123
418 Ga0496114_0360837 3300048917 Bacteria 1285
419 Ga0496114_0362183 3300048917 Bacteria 1283
420 Ga0496114_0508491 3300048917 Bacteria 1066
421 Ga0496114_1276558 3300048917 Bacteria 621
422 Ga0496115_0108076 3300048918 Bacteria 2284
423 Ga0496115_0455950 3300048918 Bacteria 1032
424 Ga0501032_0187302 3300049569 Bacteria 1353
425 Ga0501033_0043431 3300049570 Bacteria 3348
426 Ga0501034_0024534 3300049571 Bacteria 6134
427 Ga0501034_0752187 3300049571 Bacteria 870
428 Ga0501036_0003172 3300049572 Bacteria 13122
429 Ga0501036_0974894 3300049572 Bacteria 694
430 Ga0501036_1060140 3300049572 Bacteria 663
431 Ga0501037_0696832 3300049573 Bacteria 676
432 Ga0501037_0728445 3300049573 Bacteria 658
433 Ga0501038_0010798 3300049574 Bacteria 8348
434 Ga0501038_0594025 3300049574 Bacteria 838
435 Ga0501039_0001887 3300049575 Bacteria 15502
436 Ga0501039_0440768 3300049575 Bacteria 1023
437 Ga0501040_0004441 3300049576 Bacteria 9109
438 Ga0501040_0139677 3300049576 Bacteria 1706
439 Ga0501041_0000938 3300049577 Bacteria 15805
440 Ga0501041_0488418 3300049577 Bacteria 783
441 Ga0501042_0002395 3300049578 Bacteria 11497
442 Ga0501043_0009737 3300049579 Bacteria 7533
443 Ga0501046_0004068 3300049580 Bacteria 13340
444 Ga0501046_0105015 3300049580 Bacteria 2164
445 Ga0501047_1040634 3300049581 Bacteria 632
446 Ga0501048_0005835 3300049582 Bacteria 9367
447 Ga0501068_0021162 3300049584 Bacteria 3796
448 Ga0501070_0024438 3300049586 Bacteria 5068
449 Ga0501070_1265503 3300049586 Bacteria 564
450 Ga0501071_0000519 3300049587 Bacteria 19656
451 Ga0501071_0042960 3300049587 Bacteria 3240
452 Ga0501072_0001016 3300049588 Bacteria 20770
453 Ga0501072_1223275 3300049588 Bacteria 583
454 Ga0501073_0027663 3300049589 Bacteria 4053
455 Ga0501073_0101498 3300049589 Bacteria 1998
456 Ga0501074_0001499 3300049590 Bacteria 15733
457 Ga0501074_0010204 3300049590 Bacteria 6817
458 Ga0501074_0040355 3300049590 Bacteria 3381
459 Ga0501074_1043842 3300049590 Bacteria 574
460 Ga0501075_0000695 3300049591 Bacteria 20858
461 Ga0501075_0111157 3300049591 Bacteria 2083
462 Ga0501076_0001669 3300049592 Bacteria 15013
463 Ga0501076_0142491 3300049592 Bacteria 1948
464 Ga0501077_0000853 3300049593 Bacteria 18411
465 Ga0501077_0030370 3300049593 Bacteria 3438
466 Ga0501079_0007313 3300049741 Bacteria 8342
467 Ga0501079_0660551 3300049741 Bacteria 823
468 Ga0501079_1624270 3300049741 Bacteria 508
469 Ga0501080_0001180 3300049742 Bacteria 21655
470 Ga0501080_0009794 3300049742 Bacteria 8757
471 Ga0501080_0088572 3300049742 Bacteria 2875
472 Ga0501080_0969067 3300049742 Bacteria 739
473 Ga0501081_0001156 3300049743 Bacteria 15969
474 Ga0501081_0038948 3300049743 Bacteria 3251
475 Ga0501083_0001050 3300049744 Bacteria 18406
476 Ga0501035_0003754 3300049822 Bacteria 14484
477 Ga0501044_0153694 3300049823 Bacteria 2282
478 Ga0501045_0001667 3300049824 Bacteria 14925
479 Ga0501045_0255653 3300049824 Bacteria 1304
480 Ga0501045_0840369 3300049824 Bacteria 675
481 nmdc:mga05p37_1811607_c1 3300050507 Bacteria 588
482 nmdc:mga05p37_20441_c1 3300050507 Bacteria 1498
483 nmdc:mga05p37_661268_c1 3300050507 Bacteria 1168
484 nmdc:mga0n895_250174_c1 3300050512 Bacteria 1799
485 nmdc:mga0n895_412565_c1 3300050512 Bacteria 1365
486 nmdc:mga0rr50_160777_c1 3300050513 Bacteria 1823
487 nmdc:mga0rr50_96096_c1 3300050513 Bacteria 2318
488 nmdc:mga08x19_5491_c1 3300050514 Bacteria 7499
489 nmdc:mga0a205_4695_c1 3300050515 Bacteria 12267
490 Ga0495601_1000977 3300053077 Bacteria 525
491 Ga0495612_0237381 3300053078 Bacteria 809
492 Ga0495655_0005225 3300053083 Bacteria 2281
493 Ga0495655_0308231 3300053083 Bacteria 546
494 Ga0495595_0303502 3300053084 Bacteria 803
495 Ga0495619_0216889 3300053085 Bacteria 1325
496 Ga0501084_0002076 3300054114 Bacteria 15991
497 Ga0501084_0298442 3300054114 Bacteria 1361
498 Ga0501084_0377583 3300054114 Bacteria 1198
499 Ga0501084_0965221 3300054114 Bacteria 716
500 Ga0501084_1450737 3300054114 Bacteria 574
501 Ga0587079_191923 3300059647 Bacteria 553
502 Ga0587107_077289 3300059652 Bacteria 619
503 Ga0501082_0009868 3300060353 Bacteria 8225
504 Ga0501082_0199853 3300060353 Bacteria 1739
505 Ga0501082_0406622 3300060353 Bacteria 1188
506 Ga0530510_1004645 3300061734 Bacteria 638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100057632 Ga0070708_1000576324 97
2 3300005468 Ga0070707_100588788 Ga0070707_1005887882 97
3 3300005471 Ga0070698_100034688 Ga0070698_1000346884 97
4 3300005338 Ga0068868_101552041 Ga0068868_1015520412 98
5 3300006028 Ga0070717_10652036 Ga0070717_106520362 98
6 3300038443 Ga0395901_0479372 Ga0395901_0479372_789_1094 98
7 3300048088 Ga0495602_0870752 Ga0495602_0870752_111_464 98
8 3300005467 Ga0070706_100510757 Ga0070706_1005107572 99
9 3300005518 Ga0070699_100235316 Ga0070699_1002353162 99
10 3300005536 Ga0070697_100411887 Ga0070697_1004118871 99
11 3300009147 Ga0114129_11529203 Ga0114129_115292032 99
12 3300009147 Ga0114129_12201523 Ga0114129_122015232 99
13 3300025910 Ga0207684_10132903 Ga0207684_101329032 99
14 3300025922 Ga0207646_10863718 Ga0207646_108637182 99
15 3300025928 Ga0207700_11770019 Ga0207700_117700192 99
16 3300037418 Ga0395900_0863142 Ga0395900_0863142_12_317 99
17 3300037466 Ga0395898_0141924 Ga0395898_0141924_1576_1881 99
18 3300037466 Ga0395898_0273193 Ga0395898_0273193_193_498 99
19 3300037471 Ga0395905_0448904 Ga0395905_0448904_525_830 99
20 3300037471 Ga0395905_1300558 Ga0395905_1300558_237_542 99
21 3300037471 Ga0395905_1801851 Ga0395905_1801851_30_338 99
22 3300046520 Ga0495637_0253107 Ga0495637_0253107_68_406 99
23 3300048903 Ga0496100_0432140 Ga0496100_0432140_649_972 99
24 3300048907 Ga0496104_0926049 Ga0496104_0926049_65_388 99
25 3300048908 Ga0496105_0123136 Ga0496105_0123136_1720_2043 99
26 3300048915 Ga0496112_0552120 Ga0496112_0552120_244_570 99
27 3300048917 Ga0496114_0508491 Ga0496114_0508491_595_918 99
28 3300048918 Ga0496115_0108076 Ga0496115_0108076_264_587 99
29 3300050507 nmdc:mga05p37_1811607_c1 nmdc:mga05p37_1811607_c1_19_324 99
30 3300005444 Ga0070694_100304656 Ga0070694_1003046562 100
31 3300005458 Ga0070681_10856727 Ga0070681_108567272 100
32 3300005468 Ga0070707_100173882 Ga0070707_1001738822 100
33 3300005530 Ga0070679_100023598 Ga0070679_1000235986 100
34 3300005563 Ga0068855_100091988 Ga0068855_1000919884 100
35 3300005563 Ga0068855_100494557 Ga0068855_1004945572 100
36 3300013296 Ga0157374_11958157 Ga0157374_119581572 100
37 3300013307 Ga0157372_10584714 Ga0157372_105847142 100
38 3300025912 Ga0207707_10086212 Ga0207707_100862124 100
39 3300025912 Ga0207707_11229023 Ga0207707_112290231 100
40 3300025913 Ga0207695_11007212 Ga0207695_110072122 100
41 3300025917 Ga0207660_10508604 Ga0207660_105086041 100
42 3300025921 Ga0207652_10056113 Ga0207652_100561132 100
43 3300025922 Ga0207646_10222027 Ga0207646_102220272 100
44 3300025949 Ga0207667_10469861 Ga0207667_104698612 100
45 3300031731 Ga0307405_10100227 Ga0307405_101002272 100
46 3300031824 Ga0307413_10550604 Ga0307413_105506042 100
47 3300031995 Ga0307409_101029576 Ga0307409_1010295762 100
48 3300032126 Ga0307415_100060137 Ga0307415_1000601372 100
49 3300037312 Ga0395899_0010607 Ga0395899_0010607_353_664 100
50 3300037312 Ga0395899_0015362 Ga0395899_0015362_3444_3755 100
51 3300037418 Ga0395900_0006779 Ga0395900_0006779_5061_5372 100
52 3300037418 Ga0395900_0067612 Ga0395900_0067612_2362_2673 100
53 3300037466 Ga0395898_0002248 Ga0395898_0002248_16758_17069 100
54 3300037466 Ga0395898_0036193 Ga0395898_0036193_3862_4173 100
55 3300037471 Ga0395905_0231070 Ga0395905_0231070_1042_1353 100
56 3300038443 Ga0395901_0003877 Ga0395901_0003877_6502_6813 100
57 3300038443 Ga0395901_0020642 Ga0395901_0020642_4439_4750 100
58 3300042004 Ga0439445_0043643 Ga0439445_0043643_617_922 100
59 3300044694 Ga0466963_0003326 Ga0466963_0003326_3035_3346 100
60 3300045836 Ga0466958_0447197 Ga0466958_0447197_246_557 100
61 3300045976 Ga0466967_0088031 Ga0466967_0088031_1028_1339 100
62 3300045976 Ga0466967_0726596 Ga0466967_0726596_425_736 100
63 3300046457 Ga0495590_0125914 Ga0495590_0125914_353_691 100
64 3300046491 Ga0495584_0049414 Ga0495584_0049414_858_1196 100
65 3300046506 Ga0495583_0142587 Ga0495583_0142587_195_506 100
66 3300046520 Ga0495637_0247008 Ga0495637_0247008_77_388 100
67 3300046525 Ga0495663_0131002 Ga0495663_0131002_278_583 100
68 3300046528 Ga0495642_0392231 Ga0495642_0392231_17_325 100
69 3300046530 Ga0495654_0369421 Ga0495654_0369421_57_398 100
70 3300046538 Ga0495609_0070939 Ga0495609_0070939_521_862 100
71 3300046539 Ga0495621_0112254 Ga0495621_0112254_221_562 100
72 3300046615 Ga0495656_0034872 Ga0495656_0034872_1669_2007 100
73 3300046648 Ga0495611_0076555 Ga0495611_0076555_1135_1446 100
74 3300046664 Ga0495659_0014261 Ga0495659_0014261_1806_2147 100
75 3300046665 Ga0495661_0623134 Ga0495661_0623134_125_430 100
76 3300046794 Ga0495589_0361198 Ga0495589_0361198_120_461 100
77 3300047318 Ga0495636_0096735 Ga0495636_0096735_147_488 100
78 3300047445 Ga0495677_0148539 Ga0495677_0148539_28_369 100
79 3300048915 Ga0496112_0139186 Ga0496112_0139186_1801_2112 100
80 3300048915 Ga0496112_0278451 Ga0496112_0278451_503_814 100
81 3300048915 Ga0496112_1142271 Ga0496112_1142271_350_661 100
82 3300049569 Ga0501032_0187302 Ga0501032_0187302_350_655 100
83 3300049570 Ga0501033_0043431 Ga0501033_0043431_2776_3081 100
84 3300049571 Ga0501034_0752187 Ga0501034_0752187_27_332 100
85 3300049572 Ga0501036_0003172 Ga0501036_0003172_5461_5766 100
86 3300049572 Ga0501036_1060140 Ga0501036_1060140_25_330 100
87 3300049573 Ga0501037_0696832 Ga0501037_0696832_90_395 100
88 3300049573 Ga0501037_0728445 Ga0501037_0728445_58_363 100
89 3300049574 Ga0501038_0010798 Ga0501038_0010798_805_1110 100
90 3300049574 Ga0501038_0594025 Ga0501038_0594025_251_556 100
91 3300049575 Ga0501039_0001887 Ga0501039_0001887_8018_8323 100
92 3300049576 Ga0501040_0004441 Ga0501040_0004441_1648_1953 100
93 3300049577 Ga0501041_0000938 Ga0501041_0000938_7438_7743 100
94 3300049577 Ga0501041_0488418 Ga0501041_0488418_378_683 100
95 3300049578 Ga0501042_0002395 Ga0501042_0002395_920_1225 100
96 3300049579 Ga0501043_0009737 Ga0501043_0009737_2639_2944 100
97 3300049580 Ga0501046_0004068 Ga0501046_0004068_8612_8917 100
98 3300049581 Ga0501047_1040634 Ga0501047_1040634_23_328 100
99 3300049582 Ga0501048_0005835 Ga0501048_0005835_7350_7655 100
100 3300049584 Ga0501068_0021162 Ga0501068_0021162_2662_2967 100
101 3300049586 Ga0501070_1265503 Ga0501070_1265503_230_535 100
102 3300049587 Ga0501071_0000519 Ga0501071_0000519_13034_13339 100
103 3300049587 Ga0501071_0042960 Ga0501071_0042960_1113_1418 100
104 3300049588 Ga0501072_0001016 Ga0501072_0001016_7075_7380 100
105 3300049589 Ga0501073_0101498 Ga0501073_0101498_860_1165 100
106 3300049590 Ga0501074_0001499 Ga0501074_0001499_10702_11007 100
107 3300049590 Ga0501074_1043842 Ga0501074_1043842_98_403 100
108 3300049591 Ga0501075_0000695 Ga0501075_0000695_5674_5979 100
109 3300049591 Ga0501075_0111157 Ga0501075_0111157_1389_1694 100
110 3300049592 Ga0501076_0001669 Ga0501076_0001669_7437_7742 100
111 3300049592 Ga0501076_0142491 Ga0501076_0142491_1633_1938 100
112 3300049593 Ga0501077_0000853 Ga0501077_0000853_6295_6600 100
113 3300049741 Ga0501079_0007313 Ga0501079_0007313_3447_3752 100
114 3300049742 Ga0501080_0009794 Ga0501080_0009794_3058_3363 100
115 3300049742 Ga0501080_0969067 Ga0501080_0969067_51_356 100
116 3300049743 Ga0501081_0001156 Ga0501081_0001156_11755_12060 100
117 3300049822 Ga0501035_0003754 Ga0501035_0003754_8279_8584 100
118 3300049823 Ga0501044_0153694 Ga0501044_0153694_1675_1980 100
119 3300049824 Ga0501045_0001667 Ga0501045_0001667_7539_7844 100
120 3300049824 Ga0501045_0255653 Ga0501045_0255653_600_905 100
121 3300053083 Ga0495655_0005225 Ga0495655_0005225_1314_1625 100
122 3300053083 Ga0495655_0308231 Ga0495655_0308231_86_427 100
123 3300054114 Ga0501084_0002076 Ga0501084_0002076_8148_8453 100
124 3300054114 Ga0501084_0377583 Ga0501084_0377583_468_773 100
125 3300054114 Ga0501084_1450737 Ga0501084_1450737_10_315 100
126 3300060353 Ga0501082_0009868 Ga0501082_0009868_7535_7840 100
127 3300061734 Ga0530510_1004645 Ga0530510_1004645_180_485 100
128 3300005354 Ga0070675_100054440 Ga0070675_1000544403 101
129 3300005364 Ga0070673_100429499 Ga0070673_1004294992 101
130 3300005434 Ga0070709_10059046 Ga0070709_100590463 101
131 3300005435 Ga0070714_100101812 Ga0070714_1001018123 101
132 3300005436 Ga0070713_100045966 Ga0070713_1000459661 101
133 3300005441 Ga0070700_101408454 Ga0070700_1014084541 101
134 3300005548 Ga0070665_100459816 Ga0070665_1004598162 101
135 3300006173 Ga0070716_100003903 Ga0070716_1000039037 101
136 3300006173 Ga0070716_100518622 Ga0070716_1005186222 101
137 3300006175 Ga0070712_100228137 Ga0070712_1002281372 101
138 3300006871 Ga0075434_100633666 Ga0075434_1006336662 101
139 3300015265 Ga0182005_1204703 Ga0182005_12047032 101
140 3300025906 Ga0207699_10025326 Ga0207699_100253262 101
141 3300025915 Ga0207693_10072315 Ga0207693_100723152 101
142 3300025926 Ga0207659_10035122 Ga0207659_100351222 101
143 3300025928 Ga0207700_10000002 Ga0207700_10000002411 101
144 3300025929 Ga0207664_10043682 Ga0207664_100436822 101
145 3300025939 Ga0207665_10006188 Ga0207665_100061882 101
146 3300025949 Ga0207667_10037939 Ga0207667_100379394 101
147 3300026121 Ga0207683_10313775 Ga0207683_103137752 101
148 3300028379 Ga0268266_10090515 Ga0268266_100905152 101
149 3300031995 Ga0307409_101097158 Ga0307409_1010971582 101
150 3300037418 Ga0395900_0940524 Ga0395900_0940524_343_663 101
151 3300038443 Ga0395901_0238946 Ga0395901_0238946_170_496 101
152 3300041405 Ga0439438_051135 Ga0439438_051135_170_484 101
153 3300041410 Ga0439461_0014079 Ga0439461_0014079_912_1226 101
154 3300041460 Ga0451802_0252418 Ga0451802_0252418_236_571 101
155 3300042004 Ga0439445_0012348 Ga0439445_0012348_837_1151 101
156 3300042134 Ga0450898_010981 Ga0450898_010981_420_734 101
157 3300042147 Ga0450910_066997 Ga0450910_066997_78_392 101
158 3300042156 Ga0439446_0021852 Ga0439446_0021852_506_820 101
159 3300042435 Ga0439434_0154182 Ga0439434_0154182_356_670 101
160 3300044683 Ga0466965_0448598 Ga0466965_0448598_100_489 101
161 3300044706 Ga0466964_0012463 Ga0466964_0012463_2608_2997 101
162 3300044901 Ga0466960_0019663 Ga0466960_0019663_2235_2627 101
163 3300044901 Ga0466960_0720575 Ga0466960_0720575_262_588 101
164 3300045976 Ga0466967_0052748 Ga0466967_0052748_1085_1477 101
165 3300046474 Ga0495605_0126395 Ga0495605_0126395_550_864 101
166 3300046475 Ga0495639_0128084 Ga0495639_0128084_742_1056 101
167 3300048907 Ga0496104_0013936 Ga0496104_0013936_439_765 101
168 3300048908 Ga0496105_0193326 Ga0496105_0193326_876_1202 101
169 3300048913 Ga0496110_0030116 Ga0496110_0030116_3231_3557 101
170 3300048913 Ga0496110_0846829 Ga0496110_0846829_306_620 101
171 3300048914 Ga0496111_0072433 Ga0496111_0072433_1815_2141 101
172 3300050512 nmdc:mga0n895_412565_c1 nmdc:mga0n895_412565_c1_266_592 101
173 3300059652 Ga0587107_077289 Ga0587107_077289_131_457 101
174 3300005327 Ga0070658_10471629 Ga0070658_104716292 102
175 3300005435 Ga0070714_100572622 Ga0070714_1005726222 102
176 3300005444 Ga0070694_101176721 Ga0070694_1011767212 102
177 3300005458 Ga0070681_10008465 Ga0070681_100084657 102
178 3300005458 Ga0070681_11046327 Ga0070681_110463272 102
179 3300005467 Ga0070706_100960178 Ga0070706_1009601782 102
180 3300005471 Ga0070698_101632941 Ga0070698_1016329411 102
181 3300005530 Ga0070679_100253203 Ga0070679_1002532032 102
182 3300005535 Ga0070684_100251393 Ga0070684_1002513932 102
183 3300005535 Ga0070684_100467994 Ga0070684_1004679941 102
184 3300007788 Ga0099795_10186346 Ga0099795_101863462 102
185 3300009174 Ga0105241_10492329 Ga0105241_104923292 102
186 3300010159 Ga0099796_10047369 Ga0099796_100473692 102
187 3300010375 Ga0105239_12893100 Ga0105239_128931002 102
188 3300013102 Ga0157371_10548278 Ga0157371_105482782 102
189 3300013296 Ga0157374_10835336 Ga0157374_108353362 102
190 3300021441 Ga0213871_10010293 Ga0213871_100102932 102
191 3300025909 Ga0207705_10893021 Ga0207705_108930212 102
192 3300025911 Ga0207654_10541429 Ga0207654_105414291 102
193 3300025912 Ga0207707_10041370 Ga0207707_100413702 102
194 3300025912 Ga0207707_11126271 Ga0207707_111262712 102
195 3300025919 Ga0207657_10011588 Ga0207657_100115885 102
196 3300025920 Ga0207649_10746649 Ga0207649_107466492 102
197 3300025921 Ga0207652_10702095 Ga0207652_107020952 102
198 3300025921 Ga0207652_10928294 Ga0207652_109282942 102
199 3300025935 Ga0207709_11814589 Ga0207709_118145892 102
200 3300025944 Ga0207661_10111098 Ga0207661_101110982 102
201 3300025944 Ga0207661_10121438 Ga0207661_101214382 102
202 3300035170 Ga0373943_0432450 Ga0373943_0432450_63_410 102
203 3300037312 Ga0395899_0608901 Ga0395899_0608901_174_491 102
204 3300037418 Ga0395900_1041657 Ga0395900_1041657_273_590 102
205 3300039438 Ga0436360_0338877 Ga0436360_0338877_3275_3598 102
206 3300039453 Ga0436362_0709804 Ga0436362_0709804_753_1076 102
207 3300044694 Ga0466963_0013449 Ga0466963_0013449_1153_1470 102
208 3300044706 Ga0466964_0073128 Ga0466964_0073128_613_930 102
209 3300044842 Ga0466957_0141871 Ga0466957_0141871_564_881 102
210 3300045051 Ga0451576_0771658 Ga0451576_0771658_240_557 102
211 3300045836 Ga0466958_0016507 Ga0466958_0016507_3109_3426 102
212 3300045976 Ga0466967_0012010 Ga0466967_0012010_6185_6502 102
213 3300046459 Ga0495629_0297054 Ga0495629_0297054_492_839 102
214 3300046461 Ga0495641_0036733 Ga0495641_0036733_305_652 102
215 3300046461 Ga0495641_0157623 Ga0495641_0157623_130_477 102
216 3300046463 Ga0495653_0188165 Ga0495653_0188165_157_504 102
217 3300046477 Ga0495664_0263387 Ga0495664_0263387_133_480 102
218 3300046511 Ga0495608_0046583 Ga0495608_0046583_1545_1877 102
219 3300046517 Ga0495630_0356146 Ga0495630_0356146_42_389 102
220 3300046539 Ga0495621_0138692 Ga0495621_0138692_213_551 102
221 3300046559 Ga0495667_0048175 Ga0495667_0048175_708_1055 102
222 3300046663 Ga0495635_0112873 Ga0495635_0112873_744_1091 102
223 3300047315 Ga0495581_0309458 Ga0495581_0309458_136_483 102
224 3300047322 Ga0495680_0015636 Ga0495680_0015636_2571_2918 102
225 3300048904 Ga0496101_0234896 Ga0496101_0234896_75_419 102
226 3300048905 Ga0496102_0294176 Ga0496102_0294176_145_462 102
227 3300048906 Ga0496103_0777842 Ga0496103_0777842_249_566 102
228 3300048907 Ga0496104_0182337 Ga0496104_0182337_561_905 102
229 3300048908 Ga0496105_0420266 Ga0496105_0420266_535_879 102
230 3300048912 Ga0496109_0129740 Ga0496109_0129740_669_1013 102
231 3300048913 Ga0496110_0662431 Ga0496110_0662431_308_652 102
232 3300048914 Ga0496111_0081876 Ga0496111_0081876_1901_2245 102
233 3300048915 Ga0496112_0014100 Ga0496112_0014100_6388_6705 102
234 3300048915 Ga0496112_0970129 Ga0496112_0970129_413_730 102
235 3300048916 Ga0496113_0037640 Ga0496113_0037640_373_690 102
236 3300048917 Ga0496114_0362183 Ga0496114_0362183_590_934 102
237 3300049571 Ga0501034_0024534 Ga0501034_0024534_2887_3204 102
238 3300049586 Ga0501070_0024438 Ga0501070_0024438_2614_2931 102
239 3300049589 Ga0501073_0027663 Ga0501073_0027663_1286_1603 102
240 3300049590 Ga0501074_0010204 Ga0501074_0010204_2602_2919 102
241 3300049590 Ga0501074_0040355 Ga0501074_0040355_263_580 102
242 3300049741 Ga0501079_0660551 Ga0501079_0660551_448_765 102
243 3300049741 Ga0501079_1624270 Ga0501079_1624270_148_465 102
244 3300049742 Ga0501080_0001180 Ga0501080_0001180_15545_15862 102
245 3300049742 Ga0501080_0088572 Ga0501080_0088572_1741_2058 102
246 3300049744 Ga0501083_0001050 Ga0501083_0001050_3316_3633 102
247 3300053077 Ga0495601_1000977 Ga0495601_1000977_134_466 102
248 3300053085 Ga0495619_0216889 Ga0495619_0216889_573_920 102
249 3300054114 Ga0501084_0298442 Ga0501084_0298442_18_335 102
250 3300060353 Ga0501082_0199853 Ga0501082_0199853_133_450 102
251 3300005563 Ga0068855_100006798 Ga0068855_1000067985 103
252 3300005578 Ga0068854_100763846 Ga0068854_1007638462 103
253 3300009093 Ga0105240_10875162 Ga0105240_108751622 103
254 3300009148 Ga0105243_10023761 Ga0105243_100237615 103
255 3300009176 Ga0105242_10151808 Ga0105242_101518083 103
256 3300010375 Ga0105239_10330974 Ga0105239_103309742 103
257 3300013104 Ga0157370_10026629 Ga0157370_100266295 103
258 3300013105 Ga0157369_10060832 Ga0157369_100608322 103
259 3300025912 Ga0207707_10203463 Ga0207707_102034632 103
260 3300025917 Ga0207660_11665712 Ga0207660_116657121 103
261 3300025981 Ga0207640_10623446 Ga0207640_106234462 103
262 3300034817 Ga0373948_0005735 Ga0373948_0005735_1142_1498 103
263 3300034820 Ga0373959_0001226 Ga0373959_0001226_2214_2570 103
264 3300034957 Ga0373938_0068231 Ga0373938_0068231_128_484 103
265 3300035084 Ga0373928_0002525 Ga0373928_0002525_994_1350 103
266 3300035088 Ga0373940_0000525 Ga0373940_0000525_1497_1853 103
267 3300035090 Ga0373949_0002532 Ga0373949_0002532_2299_2655 103
268 3300035091 Ga0373951_0001381 Ga0373951_0001381_2678_3034 103
269 3300035092 Ga0373952_0000856 Ga0373952_0000856_4448_4804 103
270 3300035114 Ga0373939_0002044 Ga0373939_0002044_3134_3490 103
271 3300035115 Ga0373941_0000445 Ga0373941_0000445_2325_2681 103
272 3300035121 Ga0373960_0001131 Ga0373960_0001131_2986_3342 103
273 3300035170 Ga0373943_0076257 Ga0373943_0076257_523_843 103
274 3300035207 Ga0373942_0003190 Ga0373942_0003190_2178_2534 103
275 3300035241 Ga0373961_0005658 Ga0373961_0005658_2474_2830 103
276 3300035242 Ga0373962_0002372 Ga0373962_0002372_1956_2312 103
277 3300035691 Ga0373931_0005708 Ga0373931_0005708_3254_3610 103
278 3300035695 Ga0373927_0020337 Ga0373927_0020337_2269_2589 103
279 3300035725 Ga0373947_0001152 Ga0373947_0001152_304_624 103
280 3300037068 Ga0373925_0144424 Ga0373925_0144424_588_908 103
281 3300037418 Ga0395900_0934440 Ga0395900_0934440_180_539 103
282 3300037853 Ga0436364_0593312 Ga0436364_0593312_19_339 103
283 3300038443 Ga0395901_0942686 Ga0395901_0942686_26_385 103
284 3300044706 Ga0466964_0159243 Ga0466964_0159243_654_974 103
285 3300044842 Ga0466957_0750771 Ga0466957_0750771_304_624 103
286 3300045976 Ga0466967_0179760 Ga0466967_0179760_884_1204 103
287 3300046454 Ga0495592_0230552 Ga0495592_0230552_543_863 103
288 3300046475 Ga0495639_0679826 Ga0495639_0679826_29_349 103
289 3300046517 Ga0495630_0138883 Ga0495630_0138883_38_358 103
290 3300046531 Ga0495665_0586355 Ga0495665_0586355_124_444 103
291 3300046680 Ga0495646_0371461 Ga0495646_0371461_332_658 103
292 3300047321 Ga0495676_0128452 Ga0495676_0128452_938_1258 103
293 3300048904 Ga0496101_0026159 Ga0496101_0026159_2414_2770 103
294 3300048905 Ga0496102_0011395 Ga0496102_0011395_2550_2906 103
295 3300048907 Ga0496104_0021325 Ga0496104_0021325_3980_4336 103
296 3300048908 Ga0496105_0005138 Ga0496105_0005138_3116_3472 103
297 3300048908 Ga0496105_0659057 Ga0496105_0659057_149_469 103
298 3300048909 Ga0496106_0144546 Ga0496106_0144546_527_883 103
299 3300048910 Ga0496107_0049945 Ga0496107_0049945_1047_1403 103
300 3300048911 Ga0496108_0008889 Ga0496108_0008889_3253_3609 103
301 3300048912 Ga0496109_0224835 Ga0496109_0224835_131_487 103
302 3300048913 Ga0496110_0133275 Ga0496110_0133275_1511_1867 103
303 3300048914 Ga0496111_0224794 Ga0496111_0224794_25_381 103
304 3300048916 Ga0496113_0106029 Ga0496113_0106029_348_704 103
305 3300048917 Ga0496114_0062245 Ga0496114_0062245_1141_1497 103
306 3300048917 Ga0496114_1276558 Ga0496114_1276558_145_465 103
307 3300050507 nmdc:mga05p37_20441_c1 nmdc:mga05p37_20441_c1_1095_1451 103
308 3300050507 nmdc:mga05p37_661268_c1 nmdc:mga05p37_661268_c1_40_396 103
309 3300050512 nmdc:mga0n895_250174_c1 nmdc:mga0n895_250174_c1_1200_1556 103
310 3300050513 nmdc:mga0rr50_160777_c1 nmdc:mga0rr50_160777_c1_788_1144 103
311 3300050513 nmdc:mga0rr50_96096_c1 nmdc:mga0rr50_96096_c1_1283_1639 103
312 3300050514 nmdc:mga08x19_5491_c1 nmdc:mga08x19_5491_c1_5173_5529 103
313 3300050515 nmdc:mga0a205_4695_c1 nmdc:mga0a205_4695_c1_2337_2693 103
314 3300005440 Ga0070705_101471461 Ga0070705_1014714611 104
315 3300006175 Ga0070712_100020734 Ga0070712_1000207344 104
316 3300006175 Ga0070712_100775538 Ga0070712_1007755382 104
317 3300013105 Ga0157369_10002166 Ga0157369_1000216619 104
318 3300025898 Ga0207692_10191990 Ga0207692_101919902 104
319 3300025915 Ga0207693_10001391 Ga0207693_100013917 104
320 3300025915 Ga0207693_10265536 Ga0207693_102655362 104
321 3300025929 Ga0207664_10817819 Ga0207664_108178192 104
322 3300026121 Ga0207683_10687465 Ga0207683_106874652 104
323 3300028800 Ga0265338_10010589 Ga0265338_100105892 104
324 3300031711 Ga0265314_10156386 Ga0265314_101563862 104
325 3300031712 Ga0265342_10168463 Ga0265342_101684632 104
326 3300044735 Ga0466968_0671495 Ga0466968_0671495_82_417 104
327 3300048903 Ga0496100_0668619 Ga0496100_0668619_143_463 104
328 3300048904 Ga0496101_0240977 Ga0496101_0240977_662_982 104
329 3300048905 Ga0496102_0391488 Ga0496102_0391488_149_469 104
330 3300048912 Ga0496109_0124963 Ga0496109_0124963_1999_2361 104
331 3300048913 Ga0496110_1533730 Ga0496110_1533730_150_512 104
332 3300048914 Ga0496111_0286026 Ga0496111_0286026_173_535 104
333 3300048915 Ga0496112_0084785 Ga0496112_0084785_2588_2911 104
334 3300048917 Ga0496114_0360837 Ga0496114_0360837_860_1180 104
335 3300053078 Ga0495612_0237381 Ga0495612_0237381_370_693 104
336 3300053084 Ga0495595_0303502 Ga0495595_0303502_85_408 104
337 3300005518 Ga0070699_100751821 Ga0070699_1007518212 105
338 3300037466 Ga0395898_1541833 Ga0395898_1541833_17_340 105
339 3300037471 Ga0395905_1389426 Ga0395905_1389426_172_516 105
340 3300046531 Ga0495665_0652437 Ga0495665_0652437_156_482 105
341 3300049572 Ga0501036_0974894 Ga0501036_0974894_263_589 105
342 3300049575 Ga0501039_0440768 Ga0501039_0440768_212_538 105
343 3300049576 Ga0501040_0139677 Ga0501040_0139677_35_361 105
344 3300049580 Ga0501046_0105015 Ga0501046_0105015_1823_2149 105
345 3300049588 Ga0501072_1223275 Ga0501072_1223275_81_407 105
346 3300049593 Ga0501077_0030370 Ga0501077_0030370_567_893 105
347 3300049743 Ga0501081_0038948 Ga0501081_0038948_97_423 105
348 3300049824 Ga0501045_0840369 Ga0501045_0840369_98_424 105
349 3300054114 Ga0501084_0965221 Ga0501084_0965221_183_509 105
350 3300059647 Ga0587079_191923 Ga0587079_191923_66_404 105
351 3300060353 Ga0501082_0406622 Ga0501082_0406622_671_997 105
352 3300005338 Ga0068868_100694951 Ga0068868_1006949512 106
353 3300005354 Ga0070675_100729097 Ga0070675_1007290971 106
354 3300005355 Ga0070671_100239516 Ga0070671_1002395161 106
355 3300005356 Ga0070674_100510461 Ga0070674_1005104612 106
356 3300005406 Ga0070703_10005274 Ga0070703_100052742 106
357 3300005434 Ga0070709_10558580 Ga0070709_105585803 106
358 3300005435 Ga0070714_100361230 Ga0070714_1003612301 106
359 3300005436 Ga0070713_100132979 Ga0070713_1001329791 106
360 3300005437 Ga0070710_10014415 Ga0070710_100144154 106
361 3300005439 Ga0070711_100069979 Ga0070711_1000699792 106
362 3300005440 Ga0070705_100002894 Ga0070705_1000028949 106
363 3300005440 Ga0070705_100210611 Ga0070705_1002106111 106
364 3300005440 Ga0070705_101245940 Ga0070705_1012459402 106
365 3300005444 Ga0070694_100006193 Ga0070694_1000061933 106
366 3300005444 Ga0070694_100047985 Ga0070694_1000479853 106
367 3300005445 Ga0070708_100037183 Ga0070708_1000371833 106
368 3300005445 Ga0070708_100389274 Ga0070708_1003892742 106
369 3300005455 Ga0070663_100434729 Ga0070663_1004347292 106
370 3300005456 Ga0070678_100008721 Ga0070678_1000087212 106
371 3300005467 Ga0070706_100038404 Ga0070706_1000384045 106
372 3300005467 Ga0070706_100088455 Ga0070706_1000884553 106
373 3300005468 Ga0070707_100003070 Ga0070707_1000030709 106
374 3300005471 Ga0070698_100592684 Ga0070698_1005926843 106
375 3300005518 Ga0070699_100524129 Ga0070699_1005241292 106
376 3300005536 Ga0070697_100222838 Ga0070697_1002228383 106
377 3300005536 Ga0070697_100244935 Ga0070697_1002449352 106
378 3300005545 Ga0070695_100257646 Ga0070695_1002576462 106
379 3300005545 Ga0070695_101291884 Ga0070695_1012918841 106
380 3300005546 Ga0070696_100049358 Ga0070696_1000493582 106
381 3300005549 Ga0070704_100065009 Ga0070704_1000650093 106
382 3300005549 Ga0070704_101335655 Ga0070704_1013356552 106
383 3300005615 Ga0070702_100101356 Ga0070702_1001013561 106
384 3300005615 Ga0070702_100144567 Ga0070702_1001445672 106
385 3300005718 Ga0068866_10138485 Ga0068866_101384852 106
386 3300005719 Ga0068861_100055152 Ga0068861_1000551522 106
387 3300006163 Ga0070715_10003951 Ga0070715_100039514 106
388 3300006163 Ga0070715_10491845 Ga0070715_104918452 106
389 3300006173 Ga0070716_100057665 Ga0070716_1000576652 106
390 3300006173 Ga0070716_100360232 Ga0070716_1003602322 106
391 3300006175 Ga0070712_100253123 Ga0070712_1002531232 106
392 3300006175 Ga0070712_100641936 Ga0070712_1006419362 106
393 3300006175 Ga0070712_100739048 Ga0070712_1007390482 106
394 3300006237 Ga0097621_100095406 Ga0097621_1000954062 106
395 3300006358 Ga0068871_100048828 Ga0068871_1000488283 106
396 3300006852 Ga0075433_10271666 Ga0075433_102716662 106
397 3300006871 Ga0075434_100468731 Ga0075434_1004687311 106
398 3300006881 Ga0068865_100257254 Ga0068865_1002572542 106
399 3300006914 Ga0075436_100004084 Ga0075436_1000040849 106
400 3300007076 Ga0075435_100583954 Ga0075435_1005839541 106
401 3300009098 Ga0105245_11081481 Ga0105245_110814812 106
402 3300009147 Ga0114129_10399847 Ga0114129_103998472 106
403 3300009148 Ga0105243_10128751 Ga0105243_101287511 106
404 3300009174 Ga0105241_10301181 Ga0105241_103011813 106
405 3300009553 Ga0105249_10714928 Ga0105249_107149282 106
406 3300010375 Ga0105239_10711591 Ga0105239_107115912 106
407 3300013105 Ga0157369_10884977 Ga0157369_108849772 106
408 3300013296 Ga0157374_10277799 Ga0157374_102777992 106
409 3300013306 Ga0163162_10384806 Ga0163162_103848062 106
410 3300013307 Ga0157372_10735617 Ga0157372_107356172 106
411 3300025885 Ga0207653_10007254 Ga0207653_100072542 106
412 3300025898 Ga0207692_10121132 Ga0207692_101211321 106
413 3300025901 Ga0207688_10572874 Ga0207688_105728742 106
414 3300025904 Ga0207647_10483560 Ga0207647_104835601 106
415 3300025905 Ga0207685_10267487 Ga0207685_102674872 106
416 3300025906 Ga0207699_10028410 Ga0207699_100284102 106
417 3300025906 Ga0207699_10413101 Ga0207699_104131012 106
418 3300025910 Ga0207684_10050106 Ga0207684_100501064 106
419 3300025910 Ga0207684_10128178 Ga0207684_101281782 106
420 3300025910 Ga0207684_10293310 Ga0207684_102933102 106
421 3300025911 Ga0207654_10551277 Ga0207654_105512771 106
422 3300025915 Ga0207693_10000953 Ga0207693_100009536 106
423 3300025915 Ga0207693_10051203 Ga0207693_100512032 106
424 3300025917 Ga0207660_10288493 Ga0207660_102884932 106
425 3300025922 Ga0207646_10002172 Ga0207646_100021724 106
426 3300025922 Ga0207646_10120231 Ga0207646_101202312 106
427 3300025922 Ga0207646_10926469 Ga0207646_109264692 106
428 3300025927 Ga0207687_10210724 Ga0207687_102107242 106
429 3300025928 Ga0207700_10060181 Ga0207700_100601813 106
430 3300025929 Ga0207664_10056887 Ga0207664_100568872 106
431 3300025935 Ga0207709_10025785 Ga0207709_100257854 106
432 3300025939 Ga0207665_10046470 Ga0207665_100464703 106
433 3300025939 Ga0207665_10280644 Ga0207665_102806442 106
434 3300025939 Ga0207665_10908870 Ga0207665_109088702 106
435 3300025972 Ga0207668_11437470 Ga0207668_114374702 106
436 3300026023 Ga0207677_10397273 Ga0207677_103972732 106
437 3300026067 Ga0207678_10298450 Ga0207678_102984502 106
438 3300026118 Ga0207675_100038564 Ga0207675_1000385643 106
439 3300026121 Ga0207683_10100403 Ga0207683_101004032 106
440 3300037312 Ga0395899_0006155 Ga0395899_0006155_2611_2985 106
441 3300037418 Ga0395900_0039108 Ga0395900_0039108_1165_1539 106
442 3300037466 Ga0395898_0022199 Ga0395898_0022199_755_1129 106
443 3300037471 Ga0395905_0373896 Ga0395905_0373896_62_436 106
444 3300045976 Ga0466967_1965741 Ga0466967_1965741_124_459 106
445 3300046491 Ga0495584_0183264 Ga0495584_0183264_517_891 106
446 3300046538 Ga0495609_0144255 Ga0495609_0144255_212_586 106
447 3300046559 Ga0495667_0953192 Ga0495667_0953192_184_513 106
448 3300048905 Ga0496102_0081167 Ga0496102_0081167_1912_2286 106
449 3300048907 Ga0496104_0443665 Ga0496104_0443665_751_1083 106
450 3300048908 Ga0496105_0807533 Ga0496105_0807533_311_640 106
451 3300048909 Ga0496106_0318862 Ga0496106_0318862_356_730 106
452 3300048912 Ga0496109_0783191 Ga0496109_0783191_71_445 106
453 3300048913 Ga0496110_0572781 Ga0496110_0572781_402_776 106
454 3300048913 Ga0496110_1809213 Ga0496110_1809213_108_482 106
455 3300048914 Ga0496111_0290483 Ga0496111_0290483_329_703 106
456 3300048918 Ga0496115_0455950 Ga0496115_0455950_168_542 106
457 3300005434 Ga0070709_10586615 Ga0070709_105866152 107
458 3300005435 Ga0070714_100351958 Ga0070714_1003519583 107
459 3300005437 Ga0070710_10799622 Ga0070710_107996221 107
460 3300005439 Ga0070711_100464866 Ga0070711_1004648662 107
461 3300005467 Ga0070706_100043648 Ga0070706_1000436482 107
462 3300005471 Ga0070698_100038281 Ga0070698_1000382811 107
463 3300005518 Ga0070699_100333072 Ga0070699_1003330721 107
464 3300006028 Ga0070717_10291223 Ga0070717_102912232 107
465 3300006163 Ga0070715_10521690 Ga0070715_105216901 107
466 3300006175 Ga0070712_100314099 Ga0070712_1003140992 107
467 3300006175 Ga0070712_100470163 Ga0070712_1004701632 107
468 3300025898 Ga0207692_10405242 Ga0207692_104052421 107
469 3300025905 Ga0207685_10640930 Ga0207685_106409301 107
470 3300025910 Ga0207684_11112551 Ga0207684_111125512 107
471 3300025915 Ga0207693_10009293 Ga0207693_100092932 107
472 3300025916 Ga0207663_10948470 Ga0207663_109484701 107
473 3300031250 Ga0265331_10273100 Ga0265331_102731002 107
474 3300035086 Ga0373934_0196216 Ga0373934_0196216_466_804 107
475 3300035120 Ga0373957_0165985 Ga0373957_0165985_427_765 107
476 3300036401 Ga0373937_0210482 Ga0373937_0210482_216_554 107
477 3300044683 Ga0466965_0619136 Ga0466965_0619136_179_532 107
478 3300044684 Ga0466966_0529807 Ga0466966_0529807_312_665 107
479 3300044694 Ga0466963_0014387 Ga0466963_0014387_3846_4199 107
480 3300044842 Ga0466957_0348487 Ga0466957_0348487_454_807 107
481 3300044901 Ga0466960_0962161 Ga0466960_0962161_52_405 107
482 3300046463 Ga0495653_0287506 Ga0495653_0287506_293_631 107
483 3300046514 Ga0495618_0167320 Ga0495618_0167320_317_655 107
484 3300046517 Ga0495630_0653441 Ga0495630_0653441_114_452 107
485 3300046535 Ga0495586_0278553 Ga0495586_0278553_263_616 107
486 3300046559 Ga0495667_0659883 Ga0495667_0659883_21_359 107
487 3300046663 Ga0495635_0532557 Ga0495635_0532557_187_525 107
488 3300046809 Ga0495600_0234466 Ga0495600_0234466_304_642 107
489 3300047317 Ga0495604_0585289 Ga0495604_0585289_195_533 107
490 3300047319 Ga0495674_1373238 Ga0495674_1373238_20_358 107
491 3300047322 Ga0495680_0177854 Ga0495680_0177854_27_365 107
492 3300047471 Ga0495684_0257059 Ga0495684_0257059_333_671 107
493 3300005327 Ga0070658_10026727 Ga0070658_100267275 108
494 3300005337 Ga0070682_101054447 Ga0070682_1010544471 108
495 3300005339 Ga0070660_100888695 Ga0070660_1008886952 108
496 3300005366 Ga0070659_100019212 Ga0070659_1000192123 108
497 3300005530 Ga0070679_100826063 Ga0070679_1008260632 108
498 3300025909 Ga0207705_10010191 Ga0207705_100101917 108
499 3300025919 Ga0207657_10757933 Ga0207657_107579332 108
500 3300025921 Ga0207652_11536936 Ga0207652_115369361 108
501 3300025932 Ga0207690_10010129 Ga0207690_100101294 108
502 3300037312 Ga0395899_0042426 Ga0395899_0042426_297_665 108
503 3300037418 Ga0395900_0019711 Ga0395900_0019711_3324_3692 108
504 3300037466 Ga0395898_0034891 Ga0395898_0034891_444_812 108
505 3300037471 Ga0395905_0030777 Ga0395905_0030777_1393_1761 108
506 3300038443 Ga0395901_0087931 Ga0395901_0087931_1963_2331 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

10

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mft-assembly1.cif.gz_B crystal structure of four-helix bundle model 0.8858 34 76
5ffe-assembly2.cif.gz_B copm in the ag-bound form (by soaking) 0.8542 42 78
5xzj-assembly1.cif.gz_D crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, c96t/ab5 0.8142 40 75
2n9d-assembly1.cif.gz_A structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states 0.81 33 77
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.8056 36 77
ID Description Score Start End Superfamily
af_Q0JRB0_451_553_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.9414 41 74 1.20.1250.10
af_F4IXW2_67_239_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9212 45 83 1.25.10.10
af_I1LYC1_25_247_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9211 45 77 1.25.10.10
af_O76630_12_269_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9169 42 80 1.25.40.10
af_A0A1D6IFV8_8_202_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8984 45 83 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A442UTR1-F1-model_v4 Uncharacterized protein 0.7164 42 107
AF-A0A4R7FRI0-F1-model_v4 Uncharacterized protein 0.716 31 103 GO:0016020
AF-A0A2H9VHB5-F1-model_v4 deleted 0.6856 42 107
AF-A0A4R7FRI0-F1-model_v4 Uncharacterized protein 0.6691 31 103 GO:0016020
AF-A0A7W0JI12-F1-model_v4 Uncharacterized protein 0.6626 40 108

Feature Viewer

pLDDT pTM Quality
85.11 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map