F456400

General Info

Members Datasets Scaffolds Average Seq Length
505 301 1010 236

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0290941|Ga0466963_0290941_66_833
Length 255
Sequence MAAVATVDEARRLDAATLDSGRDWGRLRTRADLKALAEQAGRDLEGASAVDVLRWAEQEFGPSWAVASSMADAVVPHLAAQVRPGVHVLFLDTGYHFAETIGTRDAVQATLPVVVRSIVPEQSVAEQDAEFGPRLFERNPDQCCALRKVAPLRRALQDYSAWASGLRRDEADSRASVRVVEWDDRRGMVKLNPIAAWTQDDVDRYIAENGVLVNPLLYDGYGSIGCAPCTRRLKPGEHARAGRWSGTSKTECGLH

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
68 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
71 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
76 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
77 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
78 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
79 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
80 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
81 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
217 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
218 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
219 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
220 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
221 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
237 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
238 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
239 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
240 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
241 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
242 2643221647 Streptomyces sp. Root369 Isolate Unclassified
243 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
244 2643221714 Streptomyces sp. Root264 Isolate Unclassified
245 2738541305 Nocardioides sp. CF167 Isolate Unclassified
246 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
247 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
248 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
249 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
250 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
251 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
252 2808606448 Streptomyces sp. 193411 Isolate Unclassified
253 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
254 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
255 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
256 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
257 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
258 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
259 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
260 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
261 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
262 2862574272 Streptomyces sp. AcE210 Isolate Nodule
263 2867369537 Streptomyces sp. Z26 Isolate Unclassified
264 2867428634 Streptomyces sp. RP5T Isolate Unclassified
265 2867475112 Streptomyces sp. TM32 Isolate Unclassified
266 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
267 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
268 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
269 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
270 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
271 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
272 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
273 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
274 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
275 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
276 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
277 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
278 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
279 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
280 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
281 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
282 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
283 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
284 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
285 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
286 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
287 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
288 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
289 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
290 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
291 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
292 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
293 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
294 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
295 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
296 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
297 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
298 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
299 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
300 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
301 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.15
Metatranscriptomes 1.78
Isolates 13.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 0.79
Rhizoplane 2.97
Rhizosphere 78.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0290941 3300044694 Bacteria 1148
2 JGI24739J22299_10080323 3300001989 Bacteria 1002
3 JGI24737J22298_10003190 3300001990 Bacteria 5817
4 JGI24735J21928_10034302 3300002067 Bacteria 1496
5 rootH1_10003304 3300003323 Bacteria 9323
6 JGI25160J50197_1061837 3300003354 Bacteria 745
7 Ga0006562J51391_1039091 3300003578 Bacteria 1330
8 Ga0070714_100019064 3300005435 Bacteria 5583
9 Ga0070714_100295404 3300005435 Bacteria 1509
10 Ga0070713_100050596 3300005436 Bacteria 3433
11 Ga0070711_100073404 3300005439 Bacteria 2417
12 Ga0070678_100284650 3300005456 Bacteria 1399
13 Ga0070665_100168868 3300005548 Bacteria 2189
14 Ga0068855_100067853 3300005563 Bacteria 4153
15 Ga0068856_100004071 3300005614 Bacteria 14629
16 Ga0068856_100068707 3300005614 Bacteria 3503
17 Ga0068856_100382630 3300005614 Bacteria 1426
18 Ga0068852_100084788 3300005616 Bacteria 2821
19 Ga0081455_10002092 3300005937 Bacteria 23828
20 Ga0081455_10048164 3300005937 Bacteria 3685
21 Ga0081540_1037017 3300005983 Bacteria 2592
22 Ga0070717_10833549 3300006028 Bacteria 839
23 Ga0075363_100226057 3300006048 Bacteria 1073
24 Ga0075363_100296608 3300006048 Bacteria 937
25 Ga0070712_100094624 3300006175 Bacteria 2196
26 Ga0075367_10024432 3300006178 Bacteria 3408
27 Ga0075370_10084188 3300006353 Bacteria 1830
28 Ga0099826_10114314 3300006948 Bacteria 1602
29 Ga0105240_10030467 3300009093 Bacteria 7013
30 Ga0105240_10091285 3300009093 Bacteria 3722
31 Ga0105240_10932565 3300009093 Bacteria 932
32 Ga0105247_10420054 3300009101 Bacteria 957
33 Ga0105247_10480435 3300009101 Bacteria 902
34 Ga0105241_10003392 3300009174 Bacteria 11854
35 Ga0105248_10520275 3300009177 Bacteria 1341
36 Ga0105237_10037249 3300009545 Bacteria 4918
37 Ga0105237_10220068 3300009545 Bacteria 1899
38 Ga0105237_10450574 3300009545 Bacteria 1293
39 Ga0105239_10020545 3300010375 Bacteria 7284
40 Ga0105239_10058710 3300010375 Bacteria 4222
41 Ga0157372_10221767 3300013307 Bacteria 2192
42 Ga0163163_10233031 3300014325 Bacteria 1891
43 Ga0183367_1001 3300015688 Bacteria 1225545
44 Ga0197907_10051208 3300020069 Bacteria 2613
45 Ga0197907_11339174 3300020069 Bacteria 1314
46 Ga0206356_11353819 3300020070 Bacteria 1825
47 Ga0224712_10022350 3300022467 Bacteria 2179
48 Ga0207426_1001177 3300025302 Bacteria 23399
49 Ga0207426_1014513 3300025302 Bacteria 2884
50 Ga0207647_10007894 3300025904 Bacteria 7652
51 Ga0207647_10079284 3300025904 Bacteria 1972
52 Ga0207705_10075649 3300025909 Bacteria 2446
53 Ga0207654_10007073 3300025911 Bacteria 5654
54 Ga0207695_10002874 3300025913 Bacteria 24990
55 Ga0207695_10023232 3300025913 Bacteria 7014
56 Ga0207695_10226313 3300025913 Bacteria 1776
57 Ga0207671_10000284 3300025914 Bacteria 74874
58 Ga0207671_10074243 3300025914 Bacteria 2541
59 Ga0207663_10050739 3300025916 Bacteria 2580
60 Ga0207694_10000669 3300025924 Bacteria 30779
61 Ga0207700_10037322 3300025928 Bacteria 3518
62 Ga0207664_10018097 3300025929 Bacteria 5176
63 Ga0207664_10061590 3300025929 Bacteria 2994
64 Ga0207667_10010681 3300025949 Bacteria 10716
65 Ga0207658_10117545 3300025986 Bacteria 2113
66 Ga0207677_10416907 3300026023 Bacteria 1143
67 Ga0207702_10007850 3300026078 Bacteria 9051
68 Ga0207702_10121535 3300026078 Bacteria 2338
69 Ga0207698_10560715 3300026142 Bacteria 1121
70 Ga0209282_1091991 3300027666 Bacteria 1586
71 Ga0268266_10254741 3300028379 Bacteria 1624
72 Ga0307517_10001330 3300028786 Bacteria 41532
73 Ga0307517_10004423 3300028786 Bacteria 21589
74 Ga0307515_10000501 3300028794 Bacteria 93663
75 Ga0307515_10005358 3300028794 Bacteria 26039
76 Ga0307515_10256124 3300028794 Bacteria 1494
77 Ga0268256_1024135 3300030500 Bacteria 1565
78 Ga0307512_10028984 3300030522 Bacteria 4842
79 Ga0307513_10017461 3300031456 Bacteria 8604
80 Ga0307513_10131381 3300031456 Bacteria 2449
81 Ga0307509_10097178 3300031507 Bacteria 2994
82 Ga0307508_10003642 3300031616 Bacteria 15443
83 Ga0307508_10015847 3300031616 Bacteria 6868
84 Ga0307508_10351627 3300031616 Bacteria 1065
85 Ga0307508_10419804 3300031616 Bacteria 929
86 Ga0307514_10003913 3300031649 Bacteria 13930
87 Ga0307514_10022176 3300031649 Bacteria 5166
88 Ga0307514_10049266 3300031649 Bacteria 3276
89 Ga0307514_10308503 3300031649 Bacteria 880
90 Ga0307514_10338673 3300031649 Bacteria 811
91 Ga0307516_10038926 3300031730 Bacteria 4741
92 Ga0307516_10052097 3300031730 Bacteria 4009
93 Ga0307507_10010364 3300033179 Bacteria 12066
94 Ga0307507_10159323 3300033179 Bacteria 1672
95 Ga0307510_10019886 3300033180 Bacteria 7865
96 Ga0307510_10082507 3300033180 Bacteria 3109
97 Ga0307510_10160207 3300033180 Bacteria 1848
98 Ga0307510_10250451 3300033180 Bacteria 1259
99 Ga0395898_0272873 3300037466 Bacteria 1613
100 Ga0395898_0654035 3300037466 Bacteria 993
101 Ga0395905_0487423 3300037471 Bacteria 1132
102 Ga0439439_0013610 3300041406 Bacteria 1973
103 Ga0451789_1276089 3300041443 Bacteria 1379
104 Ga0451849_1572190 3300041505 Bacteria 1012
105 Ga0451853_1098851 3300041512 Bacteria 2125
106 Ga0451853_2200265 3300041512 Bacteria 11798
107 Ga0439442_008382 3300042002 Bacteria 2087
108 Ga0439448_0001874 3300042005 Bacteria 5585
109 Ga0439448_0061953 3300042005 Bacteria 1237
110 Ga0439449_0000414 3300042007 Bacteria 15761
111 Ga0439455_0000981 3300042012 Bacteria 4465
112 Ga0439457_000009 3300042014 Bacteria 41871
113 Ga0439457_000296 3300042014 Bacteria 13769
114 Ga0439457_030706 3300042014 Bacteria 1191
115 Ga0439462_0018210 3300042015 Bacteria 1823
116 Ga0450894_000028 3300042131 Bacteria 21227
117 Ga0450895_000633 3300042132 Bacteria 2124
118 Ga0450896_001531 3300042133 Bacteria 2870
119 Ga0450898_000057 3300042134 Bacteria 9483
120 Ga0450899_003716 3300042135 Bacteria 1638
121 Ga0450899_006013 3300042135 Bacteria 1310
122 Ga0450903_000364 3300042138 Bacteria 9940
123 Ga0450906_000171 3300042145 Bacteria 12159
124 Ga0439458_0000381 3300042157 Bacteria 11160
125 Ga0439458_0026176 3300042157 Bacteria 1371
126 Ga0450901_006649 3300042533 Bacteria 1190
127 Ga0466969_0022995 3300044656 Bacteria 3214
128 Ga0466969_0055017 3300044656 Bacteria 1948
129 Ga0466969_0065035 3300044656 Bacteria 1764
130 Ga0466972_0007916 3300044658 Bacteria 5329
131 Ga0466972_0050289 3300044658 Bacteria 2012
132 Ga0466972_0066479 3300044658 Bacteria 1723
133 Ga0466965_0000530 3300044683 Bacteria 13704
134 Ga0466965_0001703 3300044683 Bacteria 9028
135 Ga0466965_0074628 3300044683 Bacteria 1709
136 Ga0466966_0000480 3300044684 Bacteria 25684
137 Ga0466966_0012279 3300044684 Bacteria 5676
138 Ga0466966_0018605 3300044684 Bacteria 4578
139 Ga0466966_0246929 3300044684 Bacteria 1075
140 Ga0466966_0251765 3300044684 Bacteria 1064
141 Ga0466966_0348807 3300044684 Bacteria 889
142 Ga0466961_0000749 3300044693 Bacteria 20317
143 Ga0466961_0010427 3300044693 Bacteria 5930
144 Ga0466961_0015009 3300044693 Bacteria 4974
145 Ga0466961_0029518 3300044693 Bacteria 3524
146 Ga0466961_0112674 3300044693 Bacteria 1710
147 Ga0466961_0145194 3300044693 Bacteria 1484
148 Ga0466961_0188517 3300044693 Bacteria 1279
149 Ga0466961_0253236 3300044693 Bacteria 1081
150 Ga0466963_0000053 3300044694 Bacteria 38770
151 Ga0466963_0001657 3300044694 Bacteria 12144
152 Ga0466963_0181555 3300044694 Bacteria 1469
153 Ga0466963_0225664 3300044694 Bacteria 1312
154 Ga0466963_0245310 3300044694 Bacteria 1256
155 Ga0466964_0001852 3300044706 Bacteria 7367
156 Ga0466964_0062503 3300044706 Bacteria 1553
157 Ga0466964_0242150 3300044706 Bacteria 885
158 Ga0466971_0000530 3300044719 Bacteria 15092
159 Ga0466971_0010241 3300044719 Bacteria 4095
160 Ga0466971_0103744 3300044719 Bacteria 1308
161 Ga0466971_0120114 3300044719 Bacteria 1216
162 Ga0466968_0094714 3300044735 Bacteria 1327
163 Ga0466970_0000077 3300044765 Bacteria 40147
164 Ga0466970_0010609 3300044765 Bacteria 4678
165 Ga0466970_0069751 3300044765 Bacteria 1890
166 Ga0466957_0000461 3300044842 Bacteria 20154
167 Ga0466960_0001743 3300044901 Bacteria 7995
168 Ga0466960_0079524 3300044901 Bacteria 1649
169 Ga0466960_0253003 3300044901 Bacteria 979
170 Ga0466959_0000623 3300045049 Bacteria 20525
171 Ga0466959_0002375 3300045049 Bacteria 12004
172 Ga0466959_0019578 3300045049 Bacteria 4978
173 Ga0466959_0088786 3300045049 Bacteria 2222
174 Ga0466959_0237125 3300045049 Bacteria 1261
175 Ga0466959_0296676 3300045049 Bacteria 1107
176 Ga0466958_0000820 3300045836 Bacteria 13725
177 Ga0466958_0004142 3300045836 Bacteria 7611
178 Ga0466958_0219537 3300045836 Bacteria 1212
179 Ga0466967_0007988 3300045976 Bacteria 7703
180 Ga0466967_0045214 3300045976 Bacteria 3825
181 Ga0466967_0047705 3300045976 Bacteria 3735
182 Ga0466967_0047976 3300045976 Bacteria 3727
183 Ga0466967_0048418 3300045976 Bacteria 3711
184 Ga0466967_0122573 3300045976 Bacteria 2404
185 Ga0466967_0516009 3300045976 Bacteria 1174
186 Ga0495592_0001940 3300046454 Bacteria 14585
187 Ga0495592_0005101 3300046454 Bacteria 9674
188 Ga0495603_0000293 3300046455 Bacteria 26615
189 Ga0495603_0094219 3300046455 Bacteria 1750
190 Ga0495629_0000865 3300046459 Bacteria 24384
191 Ga0495629_0011955 3300046459 Bacteria 6294
192 Ga0495629_0080579 3300046459 Bacteria 2272
193 Ga0495638_0171367 3300046460 Bacteria 1245
194 Ga0495651_0004704 3300046462 Bacteria 10446
195 Ga0495582_0354575 3300046473 Bacteria 845
196 Ga0495605_0007353 3300046474 Bacteria 6253
197 Ga0495605_0023509 3300046474 Bacteria 3239
198 Ga0495662_0018662 3300046476 Bacteria 3357
199 Ga0495664_0002987 3300046477 Bacteria 9139
200 Ga0495664_0268439 3300046477 Bacteria 1031
201 Ga0495664_0278405 3300046477 Bacteria 1011
202 Ga0495585_0165935 3300046492 Bacteria 1143
203 Ga0495594_0000910 3300046499 Bacteria 15347
204 Ga0495594_0009172 3300046499 Bacteria 5105
205 Ga0495594_0128555 3300046499 Bacteria 1434
206 Ga0495594_0190602 3300046499 Bacteria 1168
207 Ga0495606_0035663 3300046507 Bacteria 3397
208 Ga0495628_0152195 3300046516 Bacteria 1761
209 Ga0495630_0086292 3300046517 Bacteria 2370
210 Ga0495631_0028536 3300046518 Bacteria 2545
211 Ga0495631_0039353 3300046518 Bacteria 2098
212 Ga0495632_0025828 3300046519 Bacteria 3102
213 Ga0495643_0023669 3300046522 Bacteria 3489
214 Ga0495648_0045127 3300046524 Bacteria 2744
215 Ga0495652_0032656 3300046529 Bacteria 4551
216 Ga0495654_0052042 3300046530 Bacteria 1996
217 Ga0495640_0104576 3300046533 Bacteria 1855
218 Ga0495586_0015888 3300046535 Bacteria 4005
219 Ga0495587_0020501 3300046536 Bacteria 4080
220 Ga0495587_0187999 3300046536 Bacteria 1170
221 Ga0495645_0011013 3300046543 Bacteria 6355
222 Ga0495622_0223620 3300046557 Bacteria 833
223 Ga0495633_0032696 3300046558 Bacteria 2512
224 Ga0495634_0130076 3300046642 Bacteria 1606
225 Ga0495611_0010340 3300046648 Bacteria 3948
226 Ga0495611_0017160 3300046648 Bacteria 3094
227 Ga0495611_0061748 3300046648 Bacteria 1703
228 Ga0495625_0010567 3300046660 Bacteria 7623
229 Ga0495625_0032246 3300046660 Bacteria 3888
230 Ga0495625_0174531 3300046660 Bacteria 1433
231 Ga0495625_0212036 3300046660 Bacteria 1272
232 Ga0495635_0002380 3300046663 Bacteria 12808
233 Ga0495661_0028891 3300046665 Bacteria 3544
234 Ga0495661_0084014 3300046665 Bacteria 1829
235 Ga0495588_0001000 3300046674 Bacteria 12321
236 Ga0495588_0003939 3300046674 Bacteria 6514
237 Ga0495657_0002647 3300046675 Bacteria 14972
238 Ga0495657_0104554 3300046675 Bacteria 1800
239 Ga0495599_0052608 3300046678 Bacteria 2551
240 Ga0495623_0008320 3300046679 Bacteria 6746
241 Ga0495623_0021961 3300046679 Bacteria 4122
242 Ga0495646_0004259 3300046680 Bacteria 9002
243 Ga0495658_0008960 3300046683 Bacteria 4974
244 Ga0495658_0019476 3300046683 Bacteria 3543
245 Ga0495613_0000824 3300046689 Bacteria 24009
246 Ga0495613_0456300 3300046689 Bacteria 865
247 Ga0495624_0025605 3300046690 Bacteria 3873
248 Ga0495624_0080020 3300046690 Bacteria 2025
249 Ga0495670_0051024 3300046691 Bacteria 2070
250 Ga0495671_0014074 3300046692 Bacteria 4313
251 Ga0495649_0060003 3300046694 Bacteria 2047
252 Ga0495649_0130776 3300046694 Bacteria 1324
253 Ga0495589_0014935 3300046794 Bacteria 3996
254 Ga0495589_0024189 3300046794 Bacteria 3087
255 Ga0495589_0028651 3300046794 Bacteria 2809
256 Ga0495600_0061776 3300046809 Bacteria 2447
257 Ga0495660_0021839 3300046810 Bacteria 3661
258 Ga0495660_0097003 3300046810 Bacteria 1522
259 Ga0495581_0031374 3300047315 Bacteria 3079
260 Ga0495581_0117029 3300047315 Bacteria 1550
261 Ga0495604_0008808 3300047317 Bacteria 7975
262 Ga0495604_0009563 3300047317 Bacteria 7668
263 Ga0495604_0021492 3300047317 Bacteria 5151
264 Ga0495636_0013050 3300047318 Bacteria 3294
265 Ga0495636_0143803 3300047318 Bacteria 1066
266 Ga0495674_0052129 3300047319 Bacteria 3602
267 Ga0495672_0029147 3300047320 Bacteria 3481
268 Ga0495676_0003837 3300047321 Bacteria 13668
269 Ga0495676_0004683 3300047321 Bacteria 12526
270 Ga0495676_0009172 3300047321 Bacteria 9018
271 Ga0495676_0071205 3300047321 Bacteria 2673
272 Ga0495676_0084402 3300047321 Bacteria 2396
273 Ga0495680_0009068 3300047322 Bacteria 8981
274 Ga0495683_0018606 3300047323 Bacteria 3589
275 Ga0495683_0107697 3300047323 Bacteria 1333
276 Ga0495687_021280 3300047443 Bacteria 3141
277 Ga0495687_047092 3300047443 Bacteria 1857
278 Ga0495687_066574 3300047443 Bacteria 1461
279 Ga0495687_079499 3300047443 Bacteria 1288
280 Ga0495675_0004558 3300047444 Bacteria 8400
281 Ga0495685_003008 3300047447 Bacteria 5332
282 Ga0495685_004561 3300047447 Bacteria 4486
283 Ga0495685_006881 3300047447 Bacteria 3740
284 Ga0495685_010378 3300047447 Bacteria 3122
285 Ga0495685_026495 3300047447 Bacteria 1994
286 Ga0495681_0001279 3300047470 Bacteria 19056
287 Ga0495681_0002006 3300047470 Bacteria 14881
288 Ga0495684_0057721 3300047471 Bacteria 2958
289 Ga0495686_0014092 3300047472 Bacteria 5518
290 Ga0495686_0056822 3300047472 Bacteria 2444
291 Ga0495593_0001957 3300047673 Bacteria 12286
292 Ga0495593_0057426 3300047673 Bacteria 2043
293 Ga0495593_0061513 3300047673 Bacteria 1964
294 Ga0495593_0099041 3300047673 Bacteria 1496
295 Ga0495593_0176834 3300047673 Bacteria 1075
296 Ga0495602_0434006 3300048088 Bacteria 930
297 Ga0495614_0000354 3300048089 Bacteria 18301
298 Ga0495614_0024809 3300048089 Bacteria 2588
299 Ga0495614_0029651 3300048089 Bacteria 2354
300 Ga0495615_0044638 3300048090 Bacteria 1120
301 Ga0496100_0200654 3300048903 Bacteria 1454
302 Ga0496100_0324889 3300048903 Bacteria 1157
303 Ga0496102_0736656 3300048905 Bacteria 909
304 Ga0496104_0124792 3300048907 Bacteria 2472
305 Ga0496105_0208247 3300048908 Bacteria 1595
306 Ga0496106_0069971 3300048909 Bacteria 2680
307 Ga0496107_0380659 3300048910 Bacteria 1050
308 Ga0496108_0064074 3300048911 Bacteria 3096
309 Ga0496108_0662800 3300048911 Bacteria 907
310 Ga0496109_0039738 3300048912 Bacteria 4259
311 Ga0496110_0493489 3300048913 Bacteria 1115
312 Ga0496114_0127028 3300048917 Bacteria 2199
313 Ga0496114_0482880 3300048917 Bacteria 1096
314 Ga0496126_0055468 3300048929 Bacteria 3585
315 Ga0501305_037715 3300049161 Bacteria 777
316 Ga0495678_041221 3300049459 Bacteria 1849
317 Ga0501311_019811 3300049527 Bacteria 905
318 Ga0501318_006202 3300049534 Bacteria 1214
319 Ga0501320_015844 3300049536 Bacteria 828
320 Ga0501031_0003983 3300049568 Bacteria 9523
321 Ga0501031_0038352 3300049568 Bacteria 3127
322 Ga0501031_0119548 3300049568 Bacteria 1721
323 Ga0501031_0318180 3300049568 Bacteria 1008
324 Ga0501032_0002106 3300049569 Bacteria 15701
325 Ga0501032_0009630 3300049569 Bacteria 7000
326 Ga0501032_0017800 3300049569 Bacteria 4986
327 Ga0501032_0024997 3300049569 Bacteria 4120
328 Ga0501032_0243006 3300049569 Bacteria 1169
329 Ga0501033_0001751 3300049570 Bacteria 19000
330 Ga0501033_0002047 3300049570 Bacteria 17529
331 Ga0501033_0005691 3300049570 Bacteria 9832
332 Ga0501034_0001946 3300049571 Bacteria 26168
333 Ga0501034_0013287 3300049571 Bacteria 8484
334 Ga0501034_0106643 3300049571 Bacteria 2794
335 Ga0501036_0001036 3300049572 Bacteria 20979
336 Ga0501036_0006679 3300049572 Bacteria 9376
337 Ga0501036_0021294 3300049572 Bacteria 5448
338 Ga0501036_0401413 3300049572 Bacteria 1143
339 Ga0501037_0000583 3300049573 Bacteria 28693
340 Ga0501037_0019326 3300049573 Bacteria 5024
341 Ga0501037_0133894 3300049573 Bacteria 1776
342 Ga0501037_0312845 3300049573 Bacteria 1088
343 Ga0501038_0007082 3300049574 Bacteria 10358
344 Ga0501038_0015186 3300049574 Bacteria 7006
345 Ga0501038_0030890 3300049574 Bacteria 4735
346 Ga0501038_0063916 3300049574 Bacteria 3140
347 Ga0501038_0075755 3300049574 Bacteria 2843
348 Ga0501039_0009401 3300049575 Bacteria 7451
349 Ga0501039_0029761 3300049575 Bacteria 4207
350 Ga0501040_0003664 3300049576 Bacteria 9951
351 Ga0501041_0119168 3300049577 Bacteria 1639
352 Ga0501042_0020658 3300049578 Bacteria 4583
353 Ga0501042_0026322 3300049578 Bacteria 4088
354 Ga0501042_0028376 3300049578 Bacteria 3942
355 Ga0501043_0002709 3300049579 Bacteria 14837
356 Ga0501043_0023659 3300049579 Bacteria 4817
357 Ga0501043_0087822 3300049579 Bacteria 2443
358 Ga0501046_0001733 3300049580 Bacteria 20807
359 Ga0501046_0011869 3300049580 Bacteria 7434
360 Ga0501046_0092689 3300049580 Bacteria 2322
361 Ga0501046_0345976 3300049580 Bacteria 1080
362 Ga0501047_0000036 3300049581 Bacteria 195504
363 Ga0501047_0003115 3300049581 Bacteria 15734
364 Ga0501047_0029655 3300049581 Bacteria 5274
365 Ga0501047_0049199 3300049581 Bacteria 4070
366 Ga0501047_0126041 3300049581 Bacteria 2441
367 Ga0501047_0157583 3300049581 Bacteria 2143
368 Ga0501048_0032977 3300049582 Bacteria 3742
369 Ga0501048_0251461 3300049582 Bacteria 1255
370 Ga0501067_0026969 3300049583 Bacteria 3181
371 Ga0501067_0218368 3300049583 Bacteria 1062
372 Ga0501068_0007663 3300049584 Bacteria 5975
373 Ga0501068_0233404 3300049584 Bacteria 1170
374 Ga0501070_0005095 3300049586 Bacteria 11198
375 Ga0501070_0008677 3300049586 Bacteria 8592
376 Ga0501070_0036012 3300049586 Bacteria 4133
377 Ga0501071_0001130 3300049587 Bacteria 14911
378 Ga0501072_0000332 3300049588 Bacteria 33590
379 Ga0501073_0016085 3300049589 Bacteria 5423
380 Ga0501074_0014378 3300049590 Bacteria 5760
381 Ga0501074_0039015 3300049590 Bacteria 3440
382 Ga0501075_0184210 3300049591 Bacteria 1593
383 Ga0501076_0007436 3300049592 Bacteria 7974
384 Ga0501077_0002268 3300049593 Bacteria 11599
385 Ga0501077_0144875 3300049593 Bacteria 1507
386 Ga0501235_026022 3300049669 Bacteria 1310
387 Ga0501079_0001534 3300049741 Bacteria 16336
388 Ga0501080_0081292 3300049742 Bacteria 3011
389 Ga0501083_0000304 3300049744 Bacteria 30994
390 Ga0501035_0028760 3300049822 Bacteria 5071
391 Ga0501035_0100411 3300049822 Bacteria 2540
392 Ga0501035_0102594 3300049822 Bacteria 2509
393 Ga0501035_0155973 3300049822 Bacteria 1979
394 Ga0501044_0002714 3300049823 Bacteria 20128
395 Ga0501044_0002967 3300049823 Bacteria 19278
396 Ga0501044_0016489 3300049823 Bacteria 7929
397 Ga0501044_0027946 3300049823 Bacteria 5953
398 Ga0501044_0059581 3300049823 Bacteria 3911
399 Ga0501044_0085871 3300049823 Bacteria 3179
400 Ga0501044_0155483 3300049823 Bacteria 2266
401 Ga0501044_0187947 3300049823 Bacteria 2030
402 Ga0501045_0011037 3300049824 Bacteria 6332
403 Ga0501045_0282679 3300049824 Bacteria 1235
404 Ga0501045_0411729 3300049824 Bacteria 1006
405 nmdc:mga03n38_191080_c1 3300050490 Bacteria 1055
406 nmdc:mga03n38_5292_c1 3300050490 Bacteria 4378
407 nmdc:mga06z11_36250_c1 3300050494 Bacteria 2434
408 nmdc:mga07m45_195242_c1 3300050496 Bacteria 1177
409 Ga0495619_0063615 3300053085 Bacteria 2458
410 Ga0500578_0089289 3300053086 Bacteria 1956
411 Ga0500566_0049258 3300053094 Bacteria 2413
412 Ga0500566_0228095 3300053094 Bacteria 921
413 Ga0500640_069222 3300053095 Bacteria 1516
414 Ga0500654_018250 3300053099 Bacteria 4561
415 Ga0500660_025112 3300053100 Bacteria 3149
416 Ga0500560_002617 3300053107 Bacteria 3480
417 Ga0500560_060149 3300053107 Bacteria 1237
418 Ga0500614_005185 3300053123 Bacteria 2734
419 Ga0500652_000523 3300053131 Bacteria 13547
420 Ga0500658_0005806 3300053134 Bacteria 4597
421 Ga0500561_0009535 3300053137 Bacteria 1975
422 Ga0500573_0028480 3300053140 Bacteria 3217
423 Ga0500573_0059024 3300053140 Bacteria 2199
424 Ga0500588_0048780 3300053146 Bacteria 1311
425 Ga0500600_0007714 3300053149 Bacteria 6476
426 Ga0500600_0128929 3300053149 Bacteria 1291
427 Ga0500616_0061487 3300053153 Bacteria 1943
428 Ga0500633_0001949 3300053160 Bacteria 4090
429 Ga0500634_0020364 3300053161 Bacteria 3586
430 Ga0500636_0254918 3300053177 Bacteria 892
431 Ga0500656_000182 3300053732 Bacteria 4117
432 Ga0501084_0003191 3300054114 Bacteria 13268
433 Ga0501084_0370066 3300054114 Bacteria 1211
434 Ga0501082_0045380 3300060353 Bacteria 3790
435 Ga0466962_0000217 3300061719 Bacteria 23834
436 Ga0466962_0002222 3300061719 Bacteria 9177
437 Ga0466962_0007099 3300061719 Bacteria 5370
438 Ga0466962_0176798 3300061719 Bacteria 1040
439 Ga0530510_0029009 3300061734 Bacteria 3969
440 2547407541 2547132111 Bacteria 8013147
441 2554260497 2554235005 Bacteria 6457341
442 2585309284 2582581313 Bacteria 10042643
443 2585316657 2582581314 Bacteria 11452267
444 2616699797 2616644814 Bacteria 11555299
445 2643943273 2643221587 Bacteria 7586415
446 2644264736 2643221647 Bacteria 10741251
447 2644430741 2643221677 Bacteria 7584031
448 2644626741 2643221714 Bacteria 9015452
449 2738871795 2738541305 Bacteria 4910150
450 2784591259 2784132148 Bacteria 8627943
451 2785340427 2784746763 Bacteria 9783172
452 2785372337 2784746768 Bacteria 10036182
453 2786673474 2786546132 Bacteria 10419719
454 2793978323 2791355406 Bacteria 11364898
455 2808914348 2808606375 Bacteria 9466072
456 2809234831 2808606448 Bacteria 8656184
457 2811843747 2808606982 Bacteria 7791042
458 2812333233 2811994874 Bacteria 5367947
459 2812355177 2811994879 Bacteria 9313447
460 2812477911 2811994917 Bacteria 7761064
461 2819699845 2818991463 Bacteria 7948711
462 2852638682 2852635781 Bacteria 8251373
463 2862182435 2862178590 Bacteria 8583590
464 2862283739 2862281513 Bacteria 9621493
465 2862291896 2862290372 Bacteria 7471434
466 2862576719 2862574272 Bacteria 10567477
467 2867374500 2867369537 Bacteria 6501581
468 2867432180 2867428634 Bacteria 9590268
469 2867476546 2867475112 Bacteria 6909112
470 2877678313 2877676314 Bacteria 9512378
471 2912729429 2912723979 Bacteria 8557534
472 2918507269 2918501144 Bacteria 8668083
473 2935391212 2935390628 Bacteria 7043367
474 2946070715 2946064051 Bacteria 8957905
475 2946078432 2946072368 Bacteria 8999607
476 2947226081 2947224130 Bacteria 9938529
477 2954010253 2954002825 Bacteria 9173742
478 2954383226 2954380949 Bacteria 10050426
479 2954679779 2954673503 Bacteria 9685905
480 2954684374 2954682443 Bacteria 9862841
481 2954693936 2954691527 Bacteria 10720516
482 2954709042 2954701450 Bacteria 10834262
483 2954713547 2954711539 Bacteria 10867210
484 2954723510 2954721474 Bacteria 10456478
485 2954738320 2954731030 Bacteria 10243860
486 2954742414 2954740390 Bacteria 10229294
487 2954757180 2954749733 Bacteria 10366972
488 2954761383 2954759201 Bacteria 9358192
489 2990049146 2990044586 Bacteria 6603797
490 2997602031 2997600082 Bacteria 9896405
491 3006327158 3006321560 Bacteria 8247479
492 3006430154 3006425503 Bacteria 6491253
493 3006500637 3006493962 Bacteria 8825450
494 8008563702 8008558824 Bacteria 10610750
495 8008576430 8008574985 Bacteria 7815457
496 8023630241 8023623736 Bacteria 8593882
497 8025417645 8025413630 Bacteria 7014048
498 8033685015 8033684223 Bacteria 6906479
499 8047895441 8047893842 Bacteria 11723082
500 8048132475 8048127548 Bacteria 11053136
501 8048363513 8048356638 Bacteria 11044339
502 8048372466 8048369669 Bacteria 11666822
503 8048381400 8048379754 Bacteria 11877923
504 8054163087 8054160619 Bacteria 7783213
505 8056829810 8056829672 Bacteria 9045328
506 Ga0466963_0290941
507 JGI24739J22299_10080323
508 JGI24737J22298_10003190
509 JGI24735J21928_10034302
510 rootH1_10003304
511 JGI25160J50197_1061837
512 Ga0006562J51391_1039091
513 Ga0070714_100019064
514 Ga0070714_100295404
515 Ga0070713_100050596
516 Ga0070711_100073404
517 Ga0070678_100284650
518 Ga0070665_100168868
519 Ga0068855_100067853
520 Ga0068856_100004071
521 Ga0068856_100068707
522 Ga0068856_100382630
523 Ga0068852_100084788
524 Ga0081455_10002092
525 Ga0081455_10048164
526 Ga0081540_1037017
527 Ga0070717_10833549
528 Ga0075363_100226057
529 Ga0075363_100296608
530 Ga0070712_100094624
531 Ga0075367_10024432
532 Ga0075370_10084188
533 Ga0099826_10114314
534 Ga0105240_10030467
535 Ga0105240_10091285
536 Ga0105240_10932565
537 Ga0105247_10420054
538 Ga0105247_10480435
539 Ga0105241_10003392
540 Ga0105248_10520275
541 Ga0105237_10037249
542 Ga0105237_10220068
543 Ga0105237_10450574
544 Ga0105239_10020545
545 Ga0105239_10058710
546 Ga0157372_10221767
547 Ga0163163_10233031
548 Ga0183367_1001
549 Ga0197907_10051208
550 Ga0197907_11339174
551 Ga0206356_11353819
552 Ga0224712_10022350
553 Ga0207426_1001177
554 Ga0207426_1014513
555 Ga0207647_10007894
556 Ga0207647_10079284
557 Ga0207705_10075649
558 Ga0207654_10007073
559 Ga0207695_10002874
560 Ga0207695_10023232
561 Ga0207695_10226313
562 Ga0207671_10000284
563 Ga0207671_10074243
564 Ga0207663_10050739
565 Ga0207694_10000669
566 Ga0207700_10037322
567 Ga0207664_10018097
568 Ga0207664_10061590
569 Ga0207667_10010681
570 Ga0207658_10117545
571 Ga0207677_10416907
572 Ga0207702_10007850
573 Ga0207702_10121535
574 Ga0207698_10560715
575 Ga0209282_1091991
576 Ga0268266_10254741
577 Ga0307517_10001330
578 Ga0307517_10004423
579 Ga0307515_10000501
580 Ga0307515_10005358
581 Ga0307515_10256124
582 Ga0268256_1024135
583 Ga0307512_10028984
584 Ga0307513_10017461
585 Ga0307513_10131381
586 Ga0307509_10097178
587 Ga0307508_10003642
588 Ga0307508_10015847
589 Ga0307508_10351627
590 Ga0307508_10419804
591 Ga0307514_10003913
592 Ga0307514_10022176
593 Ga0307514_10049266
594 Ga0307514_10308503
595 Ga0307514_10338673
596 Ga0307516_10038926
597 Ga0307516_10052097
598 Ga0307507_10010364
599 Ga0307507_10159323
600 Ga0307510_10019886
601 Ga0307510_10082507
602 Ga0307510_10160207
603 Ga0307510_10250451
604 Ga0395898_0272873
605 Ga0395898_0654035
606 Ga0395905_0487423
607 Ga0439439_0013610
608 Ga0451789_1276089
609 Ga0451849_1572190
610 Ga0451853_1098851
611 Ga0451853_2200265
612 Ga0439442_008382
613 Ga0439448_0001874
614 Ga0439448_0061953
615 Ga0439449_0000414
616 Ga0439455_0000981
617 Ga0439457_000009
618 Ga0439457_000296
619 Ga0439457_030706
620 Ga0439462_0018210
621 Ga0450894_000028
622 Ga0450895_000633
623 Ga0450896_001531
624 Ga0450898_000057
625 Ga0450899_003716
626 Ga0450899_006013
627 Ga0450903_000364
628 Ga0450906_000171
629 Ga0439458_0000381
630 Ga0439458_0026176
631 Ga0450901_006649
632 Ga0466969_0022995
633 Ga0466969_0055017
634 Ga0466969_0065035
635 Ga0466972_0007916
636 Ga0466972_0050289
637 Ga0466972_0066479
638 Ga0466965_0000530
639 Ga0466965_0001703
640 Ga0466965_0074628
641 Ga0466966_0000480
642 Ga0466966_0012279
643 Ga0466966_0018605
644 Ga0466966_0246929
645 Ga0466966_0251765
646 Ga0466966_0348807
647 Ga0466961_0000749
648 Ga0466961_0010427
649 Ga0466961_0015009
650 Ga0466961_0029518
651 Ga0466961_0112674
652 Ga0466961_0145194
653 Ga0466961_0188517
654 Ga0466961_0253236
655 Ga0466963_0000053
656 Ga0466963_0001657
657 Ga0466963_0181555
658 Ga0466963_0225664
659 Ga0466963_0245310
660 Ga0466964_0001852
661 Ga0466964_0062503
662 Ga0466964_0242150
663 Ga0466971_0000530
664 Ga0466971_0010241
665 Ga0466971_0103744
666 Ga0466971_0120114
667 Ga0466968_0094714
668 Ga0466970_0000077
669 Ga0466970_0010609
670 Ga0466970_0069751
671 Ga0466957_0000461
672 Ga0466960_0001743
673 Ga0466960_0079524
674 Ga0466960_0253003
675 Ga0466959_0000623
676 Ga0466959_0002375
677 Ga0466959_0019578
678 Ga0466959_0088786
679 Ga0466959_0237125
680 Ga0466959_0296676
681 Ga0466958_0000820
682 Ga0466958_0004142
683 Ga0466958_0219537
684 Ga0466967_0007988
685 Ga0466967_0045214
686 Ga0466967_0047705
687 Ga0466967_0047976
688 Ga0466967_0048418
689 Ga0466967_0122573
690 Ga0466967_0516009
691 Ga0495592_0001940
692 Ga0495592_0005101
693 Ga0495603_0000293
694 Ga0495603_0094219
695 Ga0495629_0000865
696 Ga0495629_0011955
697 Ga0495629_0080579
698 Ga0495638_0171367
699 Ga0495651_0004704
700 Ga0495582_0354575
701 Ga0495605_0007353
702 Ga0495605_0023509
703 Ga0495662_0018662
704 Ga0495664_0002987
705 Ga0495664_0268439
706 Ga0495664_0278405
707 Ga0495585_0165935
708 Ga0495594_0000910
709 Ga0495594_0009172
710 Ga0495594_0128555
711 Ga0495594_0190602
712 Ga0495606_0035663
713 Ga0495628_0152195
714 Ga0495630_0086292
715 Ga0495631_0028536
716 Ga0495631_0039353
717 Ga0495632_0025828
718 Ga0495643_0023669
719 Ga0495648_0045127
720 Ga0495652_0032656
721 Ga0495654_0052042
722 Ga0495640_0104576
723 Ga0495586_0015888
724 Ga0495587_0020501
725 Ga0495587_0187999
726 Ga0495645_0011013
727 Ga0495622_0223620
728 Ga0495633_0032696
729 Ga0495634_0130076
730 Ga0495611_0010340
731 Ga0495611_0017160
732 Ga0495611_0061748
733 Ga0495625_0010567
734 Ga0495625_0032246
735 Ga0495625_0174531
736 Ga0495625_0212036
737 Ga0495635_0002380
738 Ga0495661_0028891
739 Ga0495661_0084014
740 Ga0495588_0001000
741 Ga0495588_0003939
742 Ga0495657_0002647
743 Ga0495657_0104554
744 Ga0495599_0052608
745 Ga0495623_0008320
746 Ga0495623_0021961
747 Ga0495646_0004259
748 Ga0495658_0008960
749 Ga0495658_0019476
750 Ga0495613_0000824
751 Ga0495613_0456300
752 Ga0495624_0025605
753 Ga0495624_0080020
754 Ga0495670_0051024
755 Ga0495671_0014074
756 Ga0495649_0060003
757 Ga0495649_0130776
758 Ga0495589_0014935
759 Ga0495589_0024189
760 Ga0495589_0028651
761 Ga0495600_0061776
762 Ga0495660_0021839
763 Ga0495660_0097003
764 Ga0495581_0031374
765 Ga0495581_0117029
766 Ga0495604_0008808
767 Ga0495604_0009563
768 Ga0495604_0021492
769 Ga0495636_0013050
770 Ga0495636_0143803
771 Ga0495674_0052129
772 Ga0495672_0029147
773 Ga0495676_0003837
774 Ga0495676_0004683
775 Ga0495676_0009172
776 Ga0495676_0071205
777 Ga0495676_0084402
778 Ga0495680_0009068
779 Ga0495683_0018606
780 Ga0495683_0107697
781 Ga0495687_021280
782 Ga0495687_047092
783 Ga0495687_066574
784 Ga0495687_079499
785 Ga0495675_0004558
786 Ga0495685_003008
787 Ga0495685_004561
788 Ga0495685_006881
789 Ga0495685_010378
790 Ga0495685_026495
791 Ga0495681_0001279
792 Ga0495681_0002006
793 Ga0495684_0057721
794 Ga0495686_0014092
795 Ga0495686_0056822
796 Ga0495593_0001957
797 Ga0495593_0057426
798 Ga0495593_0061513
799 Ga0495593_0099041
800 Ga0495593_0176834
801 Ga0495602_0434006
802 Ga0495614_0000354
803 Ga0495614_0024809
804 Ga0495614_0029651
805 Ga0495615_0044638
806 Ga0496100_0200654
807 Ga0496100_0324889
808 Ga0496102_0736656
809 Ga0496104_0124792
810 Ga0496105_0208247
811 Ga0496106_0069971
812 Ga0496107_0380659
813 Ga0496108_0064074
814 Ga0496108_0662800
815 Ga0496109_0039738
816 Ga0496110_0493489
817 Ga0496114_0127028
818 Ga0496114_0482880
819 Ga0496126_0055468
820 Ga0501305_037715
821 Ga0495678_041221
822 Ga0501311_019811
823 Ga0501318_006202
824 Ga0501320_015844
825 Ga0501031_0003983
826 Ga0501031_0038352
827 Ga0501031_0119548
828 Ga0501031_0318180
829 Ga0501032_0002106
830 Ga0501032_0009630
831 Ga0501032_0017800
832 Ga0501032_0024997
833 Ga0501032_0243006
834 Ga0501033_0001751
835 Ga0501033_0002047
836 Ga0501033_0005691
837 Ga0501034_0001946
838 Ga0501034_0013287
839 Ga0501034_0106643
840 Ga0501036_0001036
841 Ga0501036_0006679
842 Ga0501036_0021294
843 Ga0501036_0401413
844 Ga0501037_0000583
845 Ga0501037_0019326
846 Ga0501037_0133894
847 Ga0501037_0312845
848 Ga0501038_0007082
849 Ga0501038_0015186
850 Ga0501038_0030890
851 Ga0501038_0063916
852 Ga0501038_0075755
853 Ga0501039_0009401
854 Ga0501039_0029761
855 Ga0501040_0003664
856 Ga0501041_0119168
857 Ga0501042_0020658
858 Ga0501042_0026322
859 Ga0501042_0028376
860 Ga0501043_0002709
861 Ga0501043_0023659
862 Ga0501043_0087822
863 Ga0501046_0001733
864 Ga0501046_0011869
865 Ga0501046_0092689
866 Ga0501046_0345976
867 Ga0501047_0000036
868 Ga0501047_0003115
869 Ga0501047_0029655
870 Ga0501047_0049199
871 Ga0501047_0126041
872 Ga0501047_0157583
873 Ga0501048_0032977
874 Ga0501048_0251461
875 Ga0501067_0026969
876 Ga0501067_0218368
877 Ga0501068_0007663
878 Ga0501068_0233404
879 Ga0501070_0005095
880 Ga0501070_0008677
881 Ga0501070_0036012
882 Ga0501071_0001130
883 Ga0501072_0000332
884 Ga0501073_0016085
885 Ga0501074_0014378
886 Ga0501074_0039015
887 Ga0501075_0184210
888 Ga0501076_0007436
889 Ga0501077_0002268
890 Ga0501077_0144875
891 Ga0501235_026022
892 Ga0501079_0001534
893 Ga0501080_0081292
894 Ga0501083_0000304
895 Ga0501035_0028760
896 Ga0501035_0100411
897 Ga0501035_0102594
898 Ga0501035_0155973
899 Ga0501044_0002714
900 Ga0501044_0002967
901 Ga0501044_0016489
902 Ga0501044_0027946
903 Ga0501044_0059581
904 Ga0501044_0085871
905 Ga0501044_0155483
906 Ga0501044_0187947
907 Ga0501045_0011037
908 Ga0501045_0282679
909 Ga0501045_0411729
910 nmdc:mga03n38_191080_c1
911 nmdc:mga03n38_5292_c1
912 nmdc:mga06z11_36250_c1
913 nmdc:mga07m45_195242_c1
914 Ga0495619_0063615
915 Ga0500578_0089289
916 Ga0500566_0049258
917 Ga0500566_0228095
918 Ga0500640_069222
919 Ga0500654_018250
920 Ga0500660_025112
921 Ga0500560_002617
922 Ga0500560_060149
923 Ga0500614_005185
924 Ga0500652_000523
925 Ga0500658_0005806
926 Ga0500561_0009535
927 Ga0500573_0028480
928 Ga0500573_0059024
929 Ga0500588_0048780
930 Ga0500600_0007714
931 Ga0500600_0128929
932 Ga0500616_0061487
933 Ga0500633_0001949
934 Ga0500634_0020364
935 Ga0500636_0254918
936 Ga0500656_000182
937 Ga0501084_0003191
938 Ga0501084_0370066
939 Ga0501082_0045380
940 Ga0466962_0000217
941 Ga0466962_0002222
942 Ga0466962_0007099
943 Ga0466962_0176798
944 Ga0530510_0029009
945 2547407541
946 2554260497
947 2585309284
948 2585316657
949 2616699797
950 2643943273
951 2644264736
952 2644430741
953 2644626741
954 2738871795
955 2784591259
956 2785340427
957 2785372337
958 2786673474
959 2793978323
960 2808914348
961 2809234831
962 2811843747
963 2812333233
964 2812355177
965 2812477911
966 2819699845
967 2852638682
968 2862182435
969 2862283739
970 2862291896
971 2862576719
972 2867374500
973 2867432180
974 2867476546
975 2877678313
976 2912729429
977 2918507269
978 2935391212
979 2946070715
980 2946078432
981 2947226081
982 2954010253
983 2954383226
984 2954679779
985 2954684374
986 2954693936
987 2954709042
988 2954713547
989 2954723510
990 2954738320
991 2954742414
992 2954757180
993 2954761383
994 2990049146
995 2997602031
996 3006327158
997 3006430154
998 3006500637
999 8008563702
1000 8008576430
1001 8023630241
1002 8025417645
1003 8033685015
1004 8047895441
1005 8048132475
1006 8048363513
1007 8048372466
1008 8048381400
1009 8054163087
1010 8056829810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

62

232

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9828 10 212
7lhs-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9813 10 213
7lhu-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9784 10 213
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9766 10 213
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9626 10 213
ID Description Score Start End Superfamily
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9653 11 234 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9172 11 234 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9122 12 206 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8804 13 223 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8641 18 233 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7K2LX36-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 1.002 10 207 GO:0004604
GO:0005737
GO:0019379
AF-A0A6B3GXH0-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 1.002 10 177 GO:0004604
GO:0005737
GO:0019379
AF-A0A7Y5XDX2-F1-model_v4 deleted 0.9904 11 102
AF-A0A1C4TK60-F1-model_v4 Phosphoadenosine phosphosulfate reductase 0.9875 11 102 GO:0004604
GO:0005737
GO:0019379
AF-A0A2Z5QS77-F1-model_v4 deleted 0.9839 11 151

Map