F456351

General Info

Members Datasets Scaffolds Average Seq Length
505 277 1010 251

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10354867|Ga0105243_103548672
Length 250
Sequence MRRLEPAAIGAVMSREVANFKTYWRGTTFSSIVEPFVYLLALGLGLSATLIKGEIDGVKYIEFVGTGMVATAVIFSSAMPAMFGTFVKHRFQNTYDALLATPIDVEELVTAEMLWIGLRSSFYGCFPLIASFAFGLDPKPAMLLVPFFCFVTALAFAGFGITMAAVVQKIDQLAVTPLFLVAGTFWPIDQLPQGLQVAAQFNPLYQLVELVRGAAFGFEAVDILRFLGLCALALLTWRLASNRLEKRLID

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
221 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
274 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
275 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.15
Nodule 0
Rhizoplane 8.51
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10354867 3300009148 Bacteria 1348
2 JGI24740J21852_10022227 3300001979 Bacteria 2187
3 JGI25407J50210_10003221 3300003373 Bacteria 3884
4 JGI25407J50210_10042348 3300003373 Bacteria 1165
5 Ga0070677_10196247 3300005333 Unclassified 971
6 Ga0070682_100000077 3300005337 Bacteria 89055
7 Ga0070682_100001318 3300005337 Bacteria 14039
8 Ga0070682_100001328 3300005337 Bacteria 13995
9 Ga0070682_100084665 3300005337 Bacteria 2061
10 Ga0068868_100000467 3300005338 Bacteria 26933
11 Ga0068868_100001513 3300005338 Bacteria 15989
12 Ga0068868_100037478 3300005338 Bacteria 3759
13 Ga0070660_100014211 3300005339 Bacteria 5733
14 Ga0070691_10000014 3300005341 Bacteria 50487
15 Ga0070691_10039353 3300005341 Bacteria 2234
16 Ga0070661_100000116 3300005344 Bacteria 66712
17 Ga0070661_100035547 3300005344 Bacteria 3618
18 Ga0070692_10004638 3300005345 Bacteria 5758
19 Ga0070675_100000008 3300005354 Bacteria 250004
20 Ga0070674_100000001 3300005356 Bacteria 277173
21 Ga0070674_100000103 3300005356 Bacteria 39432
22 Ga0070673_100006761 3300005364 Bacteria 7484
23 Ga0070688_100000066 3300005365 Bacteria 52354
24 Ga0070688_100091188 3300005365 Bacteria 1991
25 Ga0070659_100002304 3300005366 Bacteria 13596
26 Ga0070659_100098312 3300005366 Bacteria 2353
27 Ga0070659_100141931 3300005366 Bacteria 1955
28 Ga0070667_100185915 3300005367 Bacteria 1839
29 Ga0070714_100322059 3300005435 Bacteria 1446
30 Ga0070713_100000143 3300005436 Bacteria 47475
31 Ga0070713_100145144 3300005436 Bacteria 2105
32 Ga0070711_100029842 3300005439 Bacteria 3604
33 Ga0070694_100026490 3300005444 Bacteria 3758
34 Ga0070663_100001653 3300005455 Bacteria 12330
35 Ga0070663_100141911 3300005455 Unclassified 1835
36 Ga0070678_100175192 3300005456 Bacteria 1751
37 Ga0070662_100000015 3300005457 Bacteria 109379
38 Ga0070681_10367973 3300005458 Bacteria 1348
39 Ga0068867_100011631 3300005459 Bacteria 6213
40 Ga0070685_10000955 3300005466 Bacteria 15510
41 Ga0070685_10001592 3300005466 Bacteria 11970
42 Ga0070685_10282960 3300005466 Bacteria 1111
43 Ga0070685_10330911 3300005466 Bacteria 1036
44 Ga0070679_100000069 3300005530 Bacteria 76557
45 Ga0070684_100100439 3300005535 Bacteria 2583
46 Ga0070684_100116455 3300005535 Bacteria 2400
47 Ga0070684_100355703 3300005535 Bacteria 1347
48 Ga0068853_100001637 3300005539 Bacteria 16375
49 Ga0068853_100009484 3300005539 Bacteria 7843
50 Ga0068853_100509508 3300005539 Bacteria 1137
51 Ga0070672_100000175 3300005543 Bacteria 35613
52 Ga0070672_100066204 3300005543 Bacteria 2860
53 Ga0070686_100248764 3300005544 Bacteria 1297
54 Ga0070695_100160618 3300005545 Bacteria 1577
55 Ga0070693_100002066 3300005547 Bacteria 9196
56 Ga0070693_100065997 3300005547 Bacteria 2117
57 Ga0070665_100000068 3300005548 Bacteria 204531
58 Ga0070665_100009304 3300005548 Bacteria 9944
59 Ga0070704_100181785 3300005549 Bacteria 1683
60 Ga0070704_100748967 3300005549 Bacteria 870
61 Ga0070664_100013584 3300005564 Bacteria 6633
62 Ga0070664_100080117 3300005564 Bacteria 2812
63 Ga0068854_100000472 3300005578 Bacteria 24819
64 Ga0068854_100052020 3300005578 Bacteria 2936
65 Ga0068856_100000210 3300005614 Bacteria 63036
66 Ga0068856_100003586 3300005614 Bacteria 15613
67 Ga0068856_100040363 3300005614 Bacteria 4584
68 Ga0070702_100004066 3300005615 Bacteria 6632
69 Ga0068852_100000005 3300005616 Bacteria 173127
70 Ga0068852_100013318 3300005616 Bacteria 6292
71 Ga0068864_100000024 3300005618 Bacteria 252632
72 Ga0068864_100476141 3300005618 Bacteria 1198
73 Ga0068866_10000014 3300005718 Bacteria 72482
74 Ga0068866_10000184 3300005718 Bacteria 29338
75 Ga0068861_100117213 3300005719 Bacteria 2143
76 Ga0068851_10005373 3300005834 Bacteria 5810
77 Ga0068851_10074185 3300005834 Bacteria 1765
78 Ga0068851_10278272 3300005834 Bacteria 956
79 Ga0068863_100000136 3300005841 Bacteria 78102
80 Ga0068863_100005789 3300005841 Bacteria 12118
81 Ga0068863_100080857 3300005841 Bacteria 3078
82 Ga0068858_100000088 3300005842 Bacteria 95138
83 Ga0068858_100149848 3300005842 Bacteria 2193
84 Ga0068860_100143846 3300005843 Bacteria 2293
85 Ga0068862_100001623 3300005844 Bacteria 20481
86 Ga0081455_10007263 3300005937 Bacteria 11696
87 Ga0081455_10026626 3300005937 Bacteria 5312
88 Ga0081455_10032691 3300005937 Bacteria 4685
89 Ga0081538_10000044 3300005981 Bacteria 115394
90 Ga0081538_10000296 3300005981 Bacteria 57287
91 Ga0081538_10009039 3300005981 Bacteria 8366
92 Ga0081538_10012794 3300005981 Bacteria 6701
93 Ga0081540_1000296 3300005983 Bacteria 51895
94 Ga0081540_1059232 3300005983 Bacteria 1840
95 Ga0081539_10002449 3300005985 Bacteria 26184
96 Ga0075365_10120481 3300006038 Bacteria 1809
97 Ga0075365_10124493 3300006038 Bacteria 1780
98 Ga0075363_100030012 3300006048 Bacteria 2811
99 Ga0075364_10008825 3300006051 Bacteria 6032
100 Ga0075364_10043224 3300006051 Bacteria 2929
101 Ga0075364_10089408 3300006051 Bacteria 2042
102 Ga0075364_10179343 3300006051 Bacteria 1433
103 Ga0075432_10005819 3300006058 Bacteria 4194
104 Ga0070715_10000011 3300006163 Bacteria 183857
105 Ga0070712_100005453 3300006175 Bacteria 7879
106 Ga0075367_10025710 3300006178 Bacteria 3332
107 Ga0075367_10063831 3300006178 Bacteria 2202
108 Ga0075367_10240290 3300006178 Bacteria 1135
109 Ga0068871_100369014 3300006358 Bacteria 1273
110 Ga0075430_100116382 3300006846 Bacteria 2228
111 Ga0075431_100114830 3300006847 Bacteria 2779
112 Ga0075433_10000057 3300006852 Bacteria 48581
113 Ga0075433_10023839 3300006852 Bacteria 5156
114 Ga0075433_10151342 3300006852 Bacteria 2064
115 Ga0068865_100000019 3300006881 Bacteria 105996
116 Ga0068865_100015861 3300006881 Bacteria 4810
117 Ga0111539_10070682 3300009094 Bacteria 4120
118 Ga0105245_10000012 3300009098 Bacteria 267151
119 Ga0105245_10000667 3300009098 Bacteria 31104
120 Ga0105245_10390224 3300009098 Bacteria 1389
121 Ga0105247_10000204 3300009101 Bacteria 58153
122 Ga0114129_10189081 3300009147 Bacteria 2797
123 Ga0105243_10005945 3300009148 Bacteria 9453
124 Ga0105243_10130509 3300009148 Bacteria 2131
125 Ga0105241_10218177 3300009174 Bacteria 1602
126 Ga0105242_10000104 3300009176 Bacteria 60125
127 Ga0105242_10002841 3300009176 Bacteria 13567
128 Ga0105242_10157988 3300009176 Bacteria 1982
129 Ga0105242_10371333 3300009176 Bacteria 1327
130 Ga0105248_10535560 3300009177 Bacteria 1321
131 Ga0105237_10383921 3300009545 Bacteria 1409
132 Ga0105238_10000172 3300009551 Bacteria 70799
133 Ga0105249_10020953 3300009553 Bacteria 5848
134 Ga0105239_10044284 3300010375 Bacteria 4879
135 Ga0105239_10133808 3300010375 Bacteria 2760
136 Ga0105246_10343824 3300011119 Bacteria 1220
137 Ga0105246_10657888 3300011119 Bacteria 913
138 Ga0157371_10019526 3300013102 Bacteria 4995
139 Ga0157370_10481258 3300013104 Bacteria 1141
140 Ga0157369_10000135 3300013105 Bacteria 105364
141 Ga0157374_10006572 3300013296 Bacteria 9872
142 Ga0157374_10546464 3300013296 Bacteria 1166
143 Ga0163162_10926538 3300013306 Bacteria 983
144 Ga0157372_10000394 3300013307 Bacteria 48255
145 Ga0157372_10066613 3300013307 Bacteria 4046
146 Ga0157375_10000416 3300013308 Bacteria 38766
147 Ga0157375_10017389 3300013308 Bacteria 6487
148 Ga0157375_10027156 3300013308 Bacteria 5347
149 Ga0163163_10116270 3300014325 Bacteria 2706
150 Ga0157380_10000009 3300014326 Bacteria 142155
151 Ga0157380_10011512 3300014326 Bacteria 6393
152 Ga0157380_10030238 3300014326 Bacteria 4147
153 Ga0157379_10021257 3300014968 Bacteria 5743
154 Ga0157379_10116378 3300014968 Bacteria 2404
155 Ga0157376_10012408 3300014969 Bacteria 6325
156 Ga0163161_10000018 3300017792 Bacteria 228801
157 Ga0163161_10028350 3300017792 Bacteria 3976
158 Ga0207656_10000105 3300025321 Bacteria 31356
159 Ga0207656_10038937 3300025321 Bacteria 2008
160 Ga0207656_10054025 3300025321 Bacteria 1745
161 Ga0207642_10000001 3300025899 Bacteria 714030
162 Ga0207642_10000043 3300025899 Bacteria 35963
163 Ga0207710_10000457 3300025900 Bacteria 26204
164 Ga0207688_10071169 3300025901 Bacteria 1974
165 Ga0207685_10000001 3300025905 Bacteria 604473
166 Ga0207705_10069384 3300025909 Bacteria 2553
167 Ga0207705_10115790 3300025909 Bacteria 1984
168 Ga0207693_10007793 3300025915 Bacteria 8787
169 Ga0207693_10160613 3300025915 Bacteria 1768
170 Ga0207663_10007488 3300025916 Bacteria 5663
171 Ga0207663_10041913 3300025916 Bacteria 2793
172 Ga0207657_10064428 3300025919 Bacteria 3128
173 Ga0207649_10000005 3300025920 Bacteria 356179
174 Ga0207652_10000142 3300025921 Bacteria 76696
175 Ga0207681_10483244 3300025923 Bacteria 1012
176 Ga0207694_10000004 3300025924 Bacteria 967075
177 Ga0207659_10000014 3300025926 Bacteria 168481
178 Ga0207687_10000011 3300025927 Bacteria 388349
179 Ga0207687_10000037 3300025927 Bacteria 120493
180 Ga0207687_10000133 3300025927 Bacteria 49874
181 Ga0207687_10024106 3300025927 Bacteria 4062
182 Ga0207700_10000008 3300025928 Bacteria 341717
183 Ga0207644_10055043 3300025931 Bacteria 2867
184 Ga0207690_10007884 3300025932 Bacteria 6325
185 Ga0207706_10000062 3300025933 Bacteria 109344
186 Ga0207686_10000063 3300025934 Bacteria 96427
187 Ga0207686_10002024 3300025934 Bacteria 11182
188 Ga0207709_10011504 3300025935 Bacteria 4881
189 Ga0207709_10084739 3300025935 Bacteria 2053
190 Ga0207709_10288584 3300025935 Bacteria 1215
191 Ga0207670_10098068 3300025936 Bacteria 2088
192 Ga0207669_10000002 3300025937 Bacteria 377651
193 Ga0207669_10000115 3300025937 Bacteria 40041
194 Ga0207704_10000009 3300025938 Bacteria 198266
195 Ga0207704_10016173 3300025938 Bacteria 3826
196 Ga0207691_10000609 3300025940 Bacteria 35618
197 Ga0207691_10006232 3300025940 Bacteria 11519
198 Ga0207711_10000024 3300025941 Bacteria 293596
199 Ga0207711_10661568 3300025941 Bacteria 974
200 Ga0207661_10002334 3300025944 Bacteria 13072
201 Ga0207661_10005500 3300025944 Bacteria 8935
202 Ga0207661_10022695 3300025944 Bacteria 4731
203 Ga0207661_10228323 3300025944 Bacteria 1647
204 Ga0207679_10060095 3300025945 Bacteria 2823
205 Ga0207651_10007070 3300025960 Bacteria 5955
206 Ga0207712_10000037 3300025961 Bacteria 195906
207 Ga0207668_10013744 3300025972 Bacteria 4994
208 Ga0207668_10016721 3300025972 Bacteria 4584
209 Ga0207668_10309422 3300025972 Bacteria 1307
210 Ga0207640_10000125 3300025981 Bacteria 58750
211 Ga0207677_10000464 3300026023 Bacteria 27017
212 Ga0207677_10000750 3300026023 Bacteria 18704
213 Ga0207703_10000128 3300026035 Bacteria 91359
214 Ga0207703_10000237 3300026035 Bacteria 62874
215 Ga0207703_10078733 3300026035 Bacteria 2740
216 Ga0207703_10164930 3300026035 Bacteria 1943
217 Ga0207678_10003203 3300026067 Bacteria 14799
218 Ga0207678_10109396 3300026067 Bacteria 2357
219 Ga0207708_10003661 3300026075 Bacteria 11345
220 Ga0207702_10000099 3300026078 Bacteria 100461
221 Ga0207702_10009477 3300026078 Bacteria 8181
222 Ga0207702_10014398 3300026078 Bacteria 6566
223 Ga0207641_10000265 3300026088 Bacteria 66346
224 Ga0207641_10082768 3300026088 Bacteria 2789
225 Ga0207648_10001245 3300026089 Bacteria 28507
226 Ga0207648_10021381 3300026089 Bacteria 5815
227 Ga0207676_10000048 3300026095 Bacteria 147853
228 Ga0207674_10040596 3300026116 Bacteria 4820
229 Ga0207675_100293394 3300026118 Bacteria 1582
230 Ga0207675_100498179 3300026118 Bacteria 1212
231 Ga0207683_10004976 3300026121 Bacteria 11427
232 Ga0207683_10074396 3300026121 Bacteria 3005
233 Ga0207683_10136323 3300026121 Bacteria 2209
234 Ga0207683_10140933 3300026121 Bacteria 2172
235 Ga0207698_10000038 3300026142 Bacteria 101918
236 Ga0207698_10009191 3300026142 Bacteria 6286
237 Ga0207698_10040963 3300026142 Bacteria 3448
238 Ga0207428_10023109 3300027907 Bacteria 5233
239 Ga0207428_10356540 3300027907 Bacteria 1075
240 Ga0268266_10000020 3300028379 Bacteria 527065
241 Ga0268266_10220540 3300028379 Bacteria 1743
242 Ga0268266_10466443 3300028379 Bacteria 1202
243 Ga0268265_10006759 3300028380 Bacteria 7761
244 Ga0268265_10524466 3300028380 Bacteria 1120
245 Ga0268264_10058769 3300028381 Bacteria 3221
246 Ga0268264_10210359 3300028381 Unclassified 1785
247 Ga0265337_1000126 3300028556 Bacteria 38633
248 Ga0265326_10000144 3300028558 Bacteria 37151
249 Ga0265319_1000266 3300028563 Bacteria 39456
250 Ga0265322_10000009 3300028654 Bacteria 170768
251 Ga0265336_10001523 3300028666 Bacteria 10447
252 Ga0265338_10001825 3300028800 Bacteria 33381
253 Ga0265324_10001496 3300029957 Bacteria 13252
254 Ga0265332_10028318 3300031238 Bacteria 2453
255 Ga0265320_10000024 3300031240 Bacteria 170768
256 Ga0265329_10006777 3300031242 Bacteria 4507
257 Ga0265339_10046250 3300031249 Bacteria 2393
258 Ga0265331_10000894 3300031250 Bacteria 24175
259 Ga0265327_10000227 3300031251 Bacteria 114777
260 Ga0265316_10011534 3300031344 Bacteria 7959
261 Ga0265314_10000570 3300031711 Bacteria 46890
262 Ga0316576_10043938 3300031727 Bacteria 3227
263 Ga0307406_10061715 3300031901 Bacteria 2422
264 Ga0307409_100163269 3300031995 Bacteria 1951
265 Ga0307416_100075046 3300032002 Bacteria 2828
266 Ga0373938_0006564 3300034957 Bacteria 2016
267 Ga0373928_0021674 3300035084 Bacteria 1357
268 Ga0373952_0025555 3300035092 Bacteria 1276
269 Ga0373960_0015345 3300035121 Bacteria 1954
270 Ga0373955_0035092 3300035172 Bacteria 2654
271 Ga0316574_0047376 3300035398 Bacteria 2668
272 Ga0316574_0147054 3300035398 Bacteria 1519
273 Ga0373931_0054609 3300035691 Bacteria 2135
274 Ga0373935_0296480 3300035692 Bacteria 1142
275 Ga0373937_0004944 3300036401 Bacteria 11331
276 Ga0373937_0019366 3300036401 Bacteria 6092
277 Ga0373937_0225252 3300036401 Bacteria 1765
278 Ga0316584_0005146 3300036712 Bacteria 8734
279 Ga0316584_0189026 3300036712 Bacteria 1523
280 Ga0395905_0753325 3300037471 Bacteria 876
281 Ga0395905_0784091 3300037471 Bacteria 856
282 Ga0451845_0446808 3300041501 Bacteria 1100
283 Ga0439460_0016868 3300042461 Bacteria 1950
284 Ga0466965_0075139 3300044683 Bacteria 1704
285 Ga0466963_0000066 3300044694 Bacteria 35983
286 Ga0466963_0017682 3300044694 Bacteria 4446
287 Ga0466957_0000177 3300044842 Bacteria 28545
288 Ga0466957_0020814 3300044842 Bacteria 3859
289 Ga0466960_0081366 3300044901 Bacteria 1633
290 Ga0466967_0000005 3300045976 Bacteria 149543
291 Ga0495592_0000600 3300046454 Bacteria 25385
292 Ga0495603_0000074 3300046455 Bacteria 43833
293 Ga0495603_0001114 3300046455 Bacteria 15620
294 Ga0495603_0007031 3300046455 Bacteria 6755
295 Ga0495629_0000055 3300046459 Bacteria 105268
296 Ga0495629_0007135 3300046459 Bacteria 8234
297 Ga0495629_0070157 3300046459 Bacteria 2445
298 Ga0495641_0000020 3300046461 Bacteria 115404
299 Ga0495641_0000836 3300046461 Bacteria 26232
300 Ga0495641_0194088 3300046461 Bacteria 910
301 Ga0495582_0000013 3300046473 Bacteria 110372
302 Ga0495639_0038097 3300046475 Bacteria 2158
303 Ga0495662_0000021 3300046476 Bacteria 54969
304 Ga0495662_0000519 3300046476 Bacteria 17584
305 Ga0495594_0000007 3300046499 Bacteria 160047
306 Ga0495606_0000057 3300046507 Bacteria 197956
307 Ga0495608_0000079 3300046511 Bacteria 71469
308 Ga0495608_0000454 3300046511 Bacteria 28561
309 Ga0495608_0011521 3300046511 Bacteria 6153
310 Ga0495608_0160960 3300046511 Bacteria 1427
311 Ga0495616_0044440 3300046513 Bacteria 2253
312 Ga0495618_0000058 3300046514 Bacteria 79638
313 Ga0495620_0000747 3300046515 Bacteria 19970
314 Ga0495628_0005800 3300046516 Bacteria 10818
315 Ga0495628_0047787 3300046516 Bacteria 3393
316 Ga0495628_0057582 3300046516 Bacteria 3057
317 Ga0495630_0000011 3300046517 Bacteria 232063
318 Ga0495630_0001022 3300046517 Bacteria 19352
319 Ga0495630_0026698 3300046517 Bacteria 4278
320 Ga0495630_0031936 3300046517 Bacteria 3921
321 Ga0495630_0148710 3300046517 Bacteria 1782
322 Ga0495630_0395698 3300046517 Bacteria 1058
323 Ga0495644_0004879 3300046523 Bacteria 5267
324 Ga0495644_0014600 3300046523 Bacteria 3008
325 Ga0495652_0000003 3300046529 Bacteria 597094
326 Ga0495652_0008884 3300046529 Bacteria 9145
327 Ga0495652_0090943 3300046529 Bacteria 2496
328 Ga0495640_0049503 3300046533 Bacteria 2897
329 Ga0495640_0183835 3300046533 Bacteria 1331
330 Ga0495587_0133953 3300046536 Bacteria 1416
331 Ga0495598_0068130 3300046537 Bacteria 1115
332 Ga0495621_0012598 3300046539 Bacteria 2638
333 Ga0495621_0026232 3300046539 Bacteria 1964
334 Ga0495597_0042809 3300046542 Bacteria 2018
335 Ga0495645_0200656 3300046543 Bacteria 1353
336 Ga0495622_0001428 3300046557 Bacteria 12073
337 Ga0495667_0000022 3300046559 Bacteria 176919
338 Ga0495667_0052960 3300046559 Bacteria 2673
339 Ga0495667_0160373 3300046559 Bacteria 1447
340 Ga0495656_0000196 3300046615 Bacteria 21672
341 Ga0495634_0000437 3300046642 Bacteria 41521
342 Ga0495634_0001221 3300046642 Bacteria 23712
343 Ga0495634_0002077 3300046642 Bacteria 16918
344 Ga0495634_0125684 3300046642 Bacteria 1639
345 Ga0495625_0000787 3300046660 Bacteria 43981
346 Ga0495635_0000026 3300046663 Bacteria 142517
347 Ga0495635_0013315 3300046663 Bacteria 5756
348 Ga0495588_0001678 3300046674 Bacteria 9433
349 Ga0495657_0000070 3300046675 Bacteria 92382
350 Ga0495657_0005989 3300046675 Bacteria 9545
351 Ga0495657_0032127 3300046675 Bacteria 3666
352 Ga0495657_0058088 3300046675 Bacteria 2570
353 Ga0495599_0054277 3300046678 Bacteria 2511
354 Ga0495623_0059068 3300046679 Bacteria 2410
355 Ga0495647_0000046 3300046681 Bacteria 35269
356 Ga0495647_0004979 3300046681 Bacteria 4350
357 Ga0495647_0064705 3300046681 Bacteria 1451
358 Ga0495658_0000009 3300046683 Bacteria 110421
359 Ga0495658_0021783 3300046683 Bacteria 3383
360 Ga0495669_0000083 3300046684 Bacteria 62876
361 Ga0495613_0000187 3300046689 Bacteria 60818
362 Ga0495624_0000258 3300046690 Bacteria 41999
363 Ga0495624_0000307 3300046690 Bacteria 38620
364 Ga0495624_0050314 3300046690 Bacteria 2640
365 Ga0495624_0153378 3300046690 Bacteria 1409
366 Ga0495649_0000587 3300046694 Bacteria 30555
367 Ga0495600_0002958 3300046809 Bacteria 9907
368 Ga0495600_0117896 3300046809 Bacteria 1727
369 Ga0495600_0198679 3300046809 Bacteria 1288
370 Ga0495604_0000413 3300047317 Bacteria 38567
371 Ga0495604_0000416 3300047317 Bacteria 38302
372 Ga0495604_0026460 3300047317 Bacteria 4618
373 Ga0495674_0001198 3300047319 Bacteria 25096
374 Ga0495676_0002179 3300047321 Bacteria 17345
375 Ga0495676_0005294 3300047321 Bacteria 11811
376 Ga0495680_0000407 3300047322 Bacteria 48143
377 Ga0495680_0000671 3300047322 Bacteria 38307
378 Ga0495680_0050756 3300047322 Bacteria 3242
379 Ga0495680_0076664 3300047322 Bacteria 2534
380 Ga0495675_0000141 3300047444 Bacteria 50168
381 Ga0495675_0044052 3300047444 Bacteria 2842
382 Ga0495675_0161369 3300047444 Bacteria 1380
383 Ga0495679_009986 3300047446 Bacteria 3761
384 Ga0495685_001974 3300047447 Bacteria 6365
385 Ga0495681_0047207 3300047470 Bacteria 2050
386 Ga0495684_0083900 3300047471 Bacteria 2417
387 Ga0495686_0000011 3300047472 Bacteria 514750
388 Ga0495686_0019193 3300047472 Bacteria 4572
389 Ga0495602_0000009 3300048088 Bacteria 258991
390 Ga0496100_0000007 3300048903 Bacteria 261266
391 Ga0496100_0000012 3300048903 Bacteria 182426
392 Ga0496101_0000010 3300048904 Bacteria 281990
393 Ga0496101_0000013 3300048904 Bacteria 261266
394 Ga0496102_0000045 3300048905 Bacteria 186726
395 Ga0496103_0000050 3300048906 Bacteria 152034
396 Ga0496104_0000002 3300048907 Bacteria 686017
397 Ga0496104_0000013 3300048907 Bacteria 397163
398 Ga0496105_0000001 3300048908 Bacteria 1328178
399 Ga0496105_0000006 3300048908 Bacteria 393578
400 Ga0496105_0017293 3300048908 Bacteria 5777
401 Ga0496106_0000006 3300048909 Bacteria 251855
402 Ga0496106_0000017 3300048909 Bacteria 181561
403 Ga0496106_0000174 3300048909 Bacteria 46312
404 Ga0496106_0013342 3300048909 Bacteria 6065
405 Ga0496107_0000007 3300048910 Bacteria 257113
406 Ga0496107_0000012 3300048910 Bacteria 181629
407 Ga0496107_0057788 3300048910 Bacteria 2804
408 Ga0496108_0000001 3300048911 Bacteria 919044
409 Ga0496108_0000094 3300048911 Bacteria 93075
410 Ga0496108_0003686 3300048911 Bacteria 12290
411 Ga0496108_0053012 3300048911 Bacteria 3400
412 Ga0496109_0000006 3300048912 Bacteria 325513
413 Ga0496109_0000024 3300048912 Bacteria 174723
414 Ga0496109_0000248 3300048912 Bacteria 51780
415 Ga0496109_0000285 3300048912 Bacteria 48300
416 Ga0496109_0076927 3300048912 Bacteria 3070
417 Ga0496109_0261458 3300048912 Bacteria 1630
418 Ga0496110_0000338 3300048913 Bacteria 31275
419 Ga0496110_0006448 3300048913 Bacteria 9295
420 Ga0496110_0107810 3300048913 Bacteria 2500
421 Ga0496111_0000199 3300048914 Bacteria 27930
422 Ga0496111_0092199 3300048914 Bacteria 2220
423 Ga0496111_0100245 3300048914 Bacteria 2127
424 Ga0496111_0228657 3300048914 Bacteria 1382
425 Ga0496112_0000003 3300048915 Bacteria 660147
426 Ga0496112_0001779 3300048915 Bacteria 16928
427 Ga0496113_0000080 3300048916 Bacteria 42084
428 Ga0496113_0240844 3300048916 Bacteria 1443
429 Ga0496114_0000003 3300048917 Bacteria 630981
430 Ga0496114_0005054 3300048917 Bacteria 10284
431 Ga0496115_0000071 3300048918 Bacteria 91922
432 Ga0496115_0005551 3300048918 Bacteria 9180
433 Ga0496119_0008717 3300048922 Bacteria 8853
434 Ga0496119_0039729 3300048922 Bacteria 3021
435 Ga0496120_0001289 3300048923 Bacteria 31223
436 Ga0496120_0016966 3300048923 Bacteria 4738
437 Ga0496124_0082885 3300048927 Bacteria 2632
438 Ga0496125_0101436 3300048928 Bacteria 2118
439 Ga0501036_0443888 3300049572 Bacteria 1081
440 Ga0501039_0444680 3300049575 Bacteria 1018
441 Ga0501040_0102147 3300049576 Bacteria 2001
442 Ga0501041_0087426 3300049577 Bacteria 1924
443 Ga0501042_0112150 3300049578 Bacteria 1963
444 Ga0501042_0254227 3300049578 Bacteria 1268
445 Ga0501048_0359660 3300049582 Bacteria 1038
446 Ga0501070_0131692 3300049586 Bacteria 2065
447 Ga0501072_0083457 3300049588 Bacteria 2533
448 Ga0501075_0059342 3300049591 Bacteria 2881
449 Ga0501076_0091544 3300049592 Bacteria 2446
450 Ga0501076_0140334 3300049592 Bacteria 1963
451 Ga0501076_0243921 3300049592 Bacteria 1470
452 Ga0501077_0228819 3300049593 Bacteria 1182
453 Ga0501081_0173557 3300049743 Bacteria 1557
454 Ga0501081_0244451 3300049743 Bacteria 1309
455 Ga0501081_0341931 3300049743 Bacteria 1102
456 Ga0501081_0378105 3300049743 Bacteria 1046
457 Ga0501045_0106654 3300049824 Bacteria 2076
458 Ga0501045_0269139 3300049824 Bacteria 1269
459 nmdc:mga03n38_22686_c1 3300050490 Bacteria 2544
460 nmdc:mga00v17_150101_c1 3300050491 Bacteria 1497
461 nmdc:mga00v17_198319_c1 3300050491 Bacteria 1297
462 nmdc:mga00v17_278282_c1 3300050491 Unclassified 1086
463 nmdc:mga00v17_412522_c1 3300050491 Bacteria 877
464 nmdc:mga00v17_53771_c1 3300050491 Bacteria 2455
465 nmdc:mga0yw44_198991_c1 3300050492 Bacteria 1323
466 nmdc:mga0yw44_234336_c1 3300050492 Bacteria 1219
467 nmdc:mga06z11_113616_c1 3300050494 Bacteria 1502
468 nmdc:mga06z11_159015_c1 3300050494 Bacteria 1290
469 nmdc:mga06z11_80202_c1 3300050494 Bacteria 1749
470 nmdc:mga05p37_110010_c1 3300050507 Bacteria 3389
471 nmdc:mga05p37_125194_c1 3300050507 Bacteria 3156
472 nmdc:mga06r32_359057_c1 3300050510 Bacteria 1441
473 nmdc:mga08y16_31607_c1 3300050511 Bacteria 5567
474 nmdc:mga08y16_822860_c1 3300050511 Bacteria 920
475 nmdc:mga0a205_1066_c1 3300050515 Bacteria 22781
476 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
477 nmdc:mga0a205_209474_c1 3300050515 Bacteria 1838
478 Ga0495601_0000031 3300053077 Bacteria 105493
479 Ga0495601_0000196 3300053077 Bacteria 32072
480 Ga0495601_0003093 3300053077 Bacteria 9498
481 Ga0495601_0007574 3300053077 Bacteria 6374
482 Ga0495601_0085311 3300053077 Bacteria 2029
483 Ga0495612_0002445 3300053078 Bacteria 7650
484 Ga0495612_0003277 3300053078 Bacteria 6713
485 Ga0495612_0004435 3300053078 Bacteria 5823
486 Ga0495612_0006550 3300053078 Bacteria 4785
487 Ga0495655_0000004 3300053083 Bacteria 293683
488 Ga0495655_0015259 3300053083 Bacteria 1629
489 Ga0495595_0000004 3300053084 Bacteria 260821
490 Ga0495595_0002283 3300053084 Bacteria 7462
491 Ga0495619_0000042 3300053085 Bacteria 112453
492 Ga0495619_0000061 3300053085 Bacteria 88943
493 Ga0495619_0000098 3300053085 Bacteria 64979
494 Ga0495619_0000173 3300053085 Bacteria 47525
495 Ga0495619_0010227 3300053085 Bacteria 5909
496 Ga0495619_0017174 3300053085 Bacteria 4583
497 Ga0495619_0138206 3300053085 Bacteria 1676
498 Ga0500566_0014173 3300053094 Bacteria 4686
499 Ga0500641_0026087 3300053096 Bacteria 2266
500 Ga0500554_044484 3300053102 Bacteria 1376
501 Ga0500614_001653 3300053123 Bacteria 5226
502 Ga0500628_000004 3300053129 Bacteria 202098
503 Ga0501084_0133801 3300054114 Bacteria 2087
504 Ga0530510_0158437 3300061734 Bacteria 1674
505 Ga0530510_0336909 3300061734 Bacteria 1132
506 Ga0105243_10354867
507 JGI24740J21852_10022227
508 JGI25407J50210_10003221
509 JGI25407J50210_10042348
510 Ga0070677_10196247
511 Ga0070682_100000077
512 Ga0070682_100001318
513 Ga0070682_100001328
514 Ga0070682_100084665
515 Ga0068868_100000467
516 Ga0068868_100001513
517 Ga0068868_100037478
518 Ga0070660_100014211
519 Ga0070691_10000014
520 Ga0070691_10039353
521 Ga0070661_100000116
522 Ga0070661_100035547
523 Ga0070692_10004638
524 Ga0070675_100000008
525 Ga0070674_100000001
526 Ga0070674_100000103
527 Ga0070673_100006761
528 Ga0070688_100000066
529 Ga0070688_100091188
530 Ga0070659_100002304
531 Ga0070659_100098312
532 Ga0070659_100141931
533 Ga0070667_100185915
534 Ga0070714_100322059
535 Ga0070713_100000143
536 Ga0070713_100145144
537 Ga0070711_100029842
538 Ga0070694_100026490
539 Ga0070663_100001653
540 Ga0070663_100141911
541 Ga0070678_100175192
542 Ga0070662_100000015
543 Ga0070681_10367973
544 Ga0068867_100011631
545 Ga0070685_10000955
546 Ga0070685_10001592
547 Ga0070685_10282960
548 Ga0070685_10330911
549 Ga0070679_100000069
550 Ga0070684_100100439
551 Ga0070684_100116455
552 Ga0070684_100355703
553 Ga0068853_100001637
554 Ga0068853_100009484
555 Ga0068853_100509508
556 Ga0070672_100000175
557 Ga0070672_100066204
558 Ga0070686_100248764
559 Ga0070695_100160618
560 Ga0070693_100002066
561 Ga0070693_100065997
562 Ga0070665_100000068
563 Ga0070665_100009304
564 Ga0070704_100181785
565 Ga0070704_100748967
566 Ga0070664_100013584
567 Ga0070664_100080117
568 Ga0068854_100000472
569 Ga0068854_100052020
570 Ga0068856_100000210
571 Ga0068856_100003586
572 Ga0068856_100040363
573 Ga0070702_100004066
574 Ga0068852_100000005
575 Ga0068852_100013318
576 Ga0068864_100000024
577 Ga0068864_100476141
578 Ga0068866_10000014
579 Ga0068866_10000184
580 Ga0068861_100117213
581 Ga0068851_10005373
582 Ga0068851_10074185
583 Ga0068851_10278272
584 Ga0068863_100000136
585 Ga0068863_100005789
586 Ga0068863_100080857
587 Ga0068858_100000088
588 Ga0068858_100149848
589 Ga0068860_100143846
590 Ga0068862_100001623
591 Ga0081455_10007263
592 Ga0081455_10026626
593 Ga0081455_10032691
594 Ga0081538_10000044
595 Ga0081538_10000296
596 Ga0081538_10009039
597 Ga0081538_10012794
598 Ga0081540_1000296
599 Ga0081540_1059232
600 Ga0081539_10002449
601 Ga0075365_10120481
602 Ga0075365_10124493
603 Ga0075363_100030012
604 Ga0075364_10008825
605 Ga0075364_10043224
606 Ga0075364_10089408
607 Ga0075364_10179343
608 Ga0075432_10005819
609 Ga0070715_10000011
610 Ga0070712_100005453
611 Ga0075367_10025710
612 Ga0075367_10063831
613 Ga0075367_10240290
614 Ga0068871_100369014
615 Ga0075430_100116382
616 Ga0075431_100114830
617 Ga0075433_10000057
618 Ga0075433_10023839
619 Ga0075433_10151342
620 Ga0068865_100000019
621 Ga0068865_100015861
622 Ga0111539_10070682
623 Ga0105245_10000012
624 Ga0105245_10000667
625 Ga0105245_10390224
626 Ga0105247_10000204
627 Ga0114129_10189081
628 Ga0105243_10005945
629 Ga0105243_10130509
630 Ga0105241_10218177
631 Ga0105242_10000104
632 Ga0105242_10002841
633 Ga0105242_10157988
634 Ga0105242_10371333
635 Ga0105248_10535560
636 Ga0105237_10383921
637 Ga0105238_10000172
638 Ga0105249_10020953
639 Ga0105239_10044284
640 Ga0105239_10133808
641 Ga0105246_10343824
642 Ga0105246_10657888
643 Ga0157371_10019526
644 Ga0157370_10481258
645 Ga0157369_10000135
646 Ga0157374_10006572
647 Ga0157374_10546464
648 Ga0163162_10926538
649 Ga0157372_10000394
650 Ga0157372_10066613
651 Ga0157375_10000416
652 Ga0157375_10017389
653 Ga0157375_10027156
654 Ga0163163_10116270
655 Ga0157380_10000009
656 Ga0157380_10011512
657 Ga0157380_10030238
658 Ga0157379_10021257
659 Ga0157379_10116378
660 Ga0157376_10012408
661 Ga0163161_10000018
662 Ga0163161_10028350
663 Ga0207656_10000105
664 Ga0207656_10038937
665 Ga0207656_10054025
666 Ga0207642_10000001
667 Ga0207642_10000043
668 Ga0207710_10000457
669 Ga0207688_10071169
670 Ga0207685_10000001
671 Ga0207705_10069384
672 Ga0207705_10115790
673 Ga0207693_10007793
674 Ga0207693_10160613
675 Ga0207663_10007488
676 Ga0207663_10041913
677 Ga0207657_10064428
678 Ga0207649_10000005
679 Ga0207652_10000142
680 Ga0207681_10483244
681 Ga0207694_10000004
682 Ga0207659_10000014
683 Ga0207687_10000011
684 Ga0207687_10000037
685 Ga0207687_10000133
686 Ga0207687_10024106
687 Ga0207700_10000008
688 Ga0207644_10055043
689 Ga0207690_10007884
690 Ga0207706_10000062
691 Ga0207686_10000063
692 Ga0207686_10002024
693 Ga0207709_10011504
694 Ga0207709_10084739
695 Ga0207709_10288584
696 Ga0207670_10098068
697 Ga0207669_10000002
698 Ga0207669_10000115
699 Ga0207704_10000009
700 Ga0207704_10016173
701 Ga0207691_10000609
702 Ga0207691_10006232
703 Ga0207711_10000024
704 Ga0207711_10661568
705 Ga0207661_10002334
706 Ga0207661_10005500
707 Ga0207661_10022695
708 Ga0207661_10228323
709 Ga0207679_10060095
710 Ga0207651_10007070
711 Ga0207712_10000037
712 Ga0207668_10013744
713 Ga0207668_10016721
714 Ga0207668_10309422
715 Ga0207640_10000125
716 Ga0207677_10000464
717 Ga0207677_10000750
718 Ga0207703_10000128
719 Ga0207703_10000237
720 Ga0207703_10078733
721 Ga0207703_10164930
722 Ga0207678_10003203
723 Ga0207678_10109396
724 Ga0207708_10003661
725 Ga0207702_10000099
726 Ga0207702_10009477
727 Ga0207702_10014398
728 Ga0207641_10000265
729 Ga0207641_10082768
730 Ga0207648_10001245
731 Ga0207648_10021381
732 Ga0207676_10000048
733 Ga0207674_10040596
734 Ga0207675_100293394
735 Ga0207675_100498179
736 Ga0207683_10004976
737 Ga0207683_10074396
738 Ga0207683_10136323
739 Ga0207683_10140933
740 Ga0207698_10000038
741 Ga0207698_10009191
742 Ga0207698_10040963
743 Ga0207428_10023109
744 Ga0207428_10356540
745 Ga0268266_10000020
746 Ga0268266_10220540
747 Ga0268266_10466443
748 Ga0268265_10006759
749 Ga0268265_10524466
750 Ga0268264_10058769
751 Ga0268264_10210359
752 Ga0265337_1000126
753 Ga0265326_10000144
754 Ga0265319_1000266
755 Ga0265322_10000009
756 Ga0265336_10001523
757 Ga0265338_10001825
758 Ga0265324_10001496
759 Ga0265332_10028318
760 Ga0265320_10000024
761 Ga0265329_10006777
762 Ga0265339_10046250
763 Ga0265331_10000894
764 Ga0265327_10000227
765 Ga0265316_10011534
766 Ga0265314_10000570
767 Ga0316576_10043938
768 Ga0307406_10061715
769 Ga0307409_100163269
770 Ga0307416_100075046
771 Ga0373938_0006564
772 Ga0373928_0021674
773 Ga0373952_0025555
774 Ga0373960_0015345
775 Ga0373955_0035092
776 Ga0316574_0047376
777 Ga0316574_0147054
778 Ga0373931_0054609
779 Ga0373935_0296480
780 Ga0373937_0004944
781 Ga0373937_0019366
782 Ga0373937_0225252
783 Ga0316584_0005146
784 Ga0316584_0189026
785 Ga0395905_0753325
786 Ga0395905_0784091
787 Ga0451845_0446808
788 Ga0439460_0016868
789 Ga0466965_0075139
790 Ga0466963_0000066
791 Ga0466963_0017682
792 Ga0466957_0000177
793 Ga0466957_0020814
794 Ga0466960_0081366
795 Ga0466967_0000005
796 Ga0495592_0000600
797 Ga0495603_0000074
798 Ga0495603_0001114
799 Ga0495603_0007031
800 Ga0495629_0000055
801 Ga0495629_0007135
802 Ga0495629_0070157
803 Ga0495641_0000020
804 Ga0495641_0000836
805 Ga0495641_0194088
806 Ga0495582_0000013
807 Ga0495639_0038097
808 Ga0495662_0000021
809 Ga0495662_0000519
810 Ga0495594_0000007
811 Ga0495606_0000057
812 Ga0495608_0000079
813 Ga0495608_0000454
814 Ga0495608_0011521
815 Ga0495608_0160960
816 Ga0495616_0044440
817 Ga0495618_0000058
818 Ga0495620_0000747
819 Ga0495628_0005800
820 Ga0495628_0047787
821 Ga0495628_0057582
822 Ga0495630_0000011
823 Ga0495630_0001022
824 Ga0495630_0026698
825 Ga0495630_0031936
826 Ga0495630_0148710
827 Ga0495630_0395698
828 Ga0495644_0004879
829 Ga0495644_0014600
830 Ga0495652_0000003
831 Ga0495652_0008884
832 Ga0495652_0090943
833 Ga0495640_0049503
834 Ga0495640_0183835
835 Ga0495587_0133953
836 Ga0495598_0068130
837 Ga0495621_0012598
838 Ga0495621_0026232
839 Ga0495597_0042809
840 Ga0495645_0200656
841 Ga0495622_0001428
842 Ga0495667_0000022
843 Ga0495667_0052960
844 Ga0495667_0160373
845 Ga0495656_0000196
846 Ga0495634_0000437
847 Ga0495634_0001221
848 Ga0495634_0002077
849 Ga0495634_0125684
850 Ga0495625_0000787
851 Ga0495635_0000026
852 Ga0495635_0013315
853 Ga0495588_0001678
854 Ga0495657_0000070
855 Ga0495657_0005989
856 Ga0495657_0032127
857 Ga0495657_0058088
858 Ga0495599_0054277
859 Ga0495623_0059068
860 Ga0495647_0000046
861 Ga0495647_0004979
862 Ga0495647_0064705
863 Ga0495658_0000009
864 Ga0495658_0021783
865 Ga0495669_0000083
866 Ga0495613_0000187
867 Ga0495624_0000258
868 Ga0495624_0000307
869 Ga0495624_0050314
870 Ga0495624_0153378
871 Ga0495649_0000587
872 Ga0495600_0002958
873 Ga0495600_0117896
874 Ga0495600_0198679
875 Ga0495604_0000413
876 Ga0495604_0000416
877 Ga0495604_0026460
878 Ga0495674_0001198
879 Ga0495676_0002179
880 Ga0495676_0005294
881 Ga0495680_0000407
882 Ga0495680_0000671
883 Ga0495680_0050756
884 Ga0495680_0076664
885 Ga0495675_0000141
886 Ga0495675_0044052
887 Ga0495675_0161369
888 Ga0495679_009986
889 Ga0495685_001974
890 Ga0495681_0047207
891 Ga0495684_0083900
892 Ga0495686_0000011
893 Ga0495686_0019193
894 Ga0495602_0000009
895 Ga0496100_0000007
896 Ga0496100_0000012
897 Ga0496101_0000010
898 Ga0496101_0000013
899 Ga0496102_0000045
900 Ga0496103_0000050
901 Ga0496104_0000002
902 Ga0496104_0000013
903 Ga0496105_0000001
904 Ga0496105_0000006
905 Ga0496105_0017293
906 Ga0496106_0000006
907 Ga0496106_0000017
908 Ga0496106_0000174
909 Ga0496106_0013342
910 Ga0496107_0000007
911 Ga0496107_0000012
912 Ga0496107_0057788
913 Ga0496108_0000001
914 Ga0496108_0000094
915 Ga0496108_0003686
916 Ga0496108_0053012
917 Ga0496109_0000006
918 Ga0496109_0000024
919 Ga0496109_0000248
920 Ga0496109_0000285
921 Ga0496109_0076927
922 Ga0496109_0261458
923 Ga0496110_0000338
924 Ga0496110_0006448
925 Ga0496110_0107810
926 Ga0496111_0000199
927 Ga0496111_0092199
928 Ga0496111_0100245
929 Ga0496111_0228657
930 Ga0496112_0000003
931 Ga0496112_0001779
932 Ga0496113_0000080
933 Ga0496113_0240844
934 Ga0496114_0000003
935 Ga0496114_0005054
936 Ga0496115_0000071
937 Ga0496115_0005551
938 Ga0496119_0008717
939 Ga0496119_0039729
940 Ga0496120_0001289
941 Ga0496120_0016966
942 Ga0496124_0082885
943 Ga0496125_0101436
944 Ga0501036_0443888
945 Ga0501039_0444680
946 Ga0501040_0102147
947 Ga0501041_0087426
948 Ga0501042_0112150
949 Ga0501042_0254227
950 Ga0501048_0359660
951 Ga0501070_0131692
952 Ga0501072_0083457
953 Ga0501075_0059342
954 Ga0501076_0091544
955 Ga0501076_0140334
956 Ga0501076_0243921
957 Ga0501077_0228819
958 Ga0501081_0173557
959 Ga0501081_0244451
960 Ga0501081_0341931
961 Ga0501081_0378105
962 Ga0501045_0106654
963 Ga0501045_0269139
964 nmdc:mga03n38_22686_c1
965 nmdc:mga00v17_150101_c1
966 nmdc:mga00v17_198319_c1
967 nmdc:mga00v17_278282_c1
968 nmdc:mga00v17_412522_c1
969 nmdc:mga00v17_53771_c1
970 nmdc:mga0yw44_198991_c1
971 nmdc:mga0yw44_234336_c1
972 nmdc:mga06z11_113616_c1
973 nmdc:mga06z11_159015_c1
974 nmdc:mga06z11_80202_c1
975 nmdc:mga05p37_110010_c1
976 nmdc:mga05p37_125194_c1
977 nmdc:mga06r32_359057_c1
978 nmdc:mga08y16_31607_c1
979 nmdc:mga08y16_822860_c1
980 nmdc:mga0a205_1066_c1
981 nmdc:mga0a205_1_c2
982 nmdc:mga0a205_209474_c1
983 Ga0495601_0000031
984 Ga0495601_0000196
985 Ga0495601_0003093
986 Ga0495601_0007574
987 Ga0495601_0085311
988 Ga0495612_0002445
989 Ga0495612_0003277
990 Ga0495612_0004435
991 Ga0495612_0006550
992 Ga0495655_0000004
993 Ga0495655_0015259
994 Ga0495595_0000004
995 Ga0495595_0002283
996 Ga0495619_0000042
997 Ga0495619_0000061
998 Ga0495619_0000098
999 Ga0495619_0000173
1000 Ga0495619_0010227
1001 Ga0495619_0017174
1002 Ga0495619_0138206
1003 Ga0500566_0014173
1004 Ga0500641_0026087
1005 Ga0500554_044484
1006 Ga0500614_001653
1007 Ga0500628_000004
1008 Ga0501084_0133801
1009 Ga0530510_0158437
1010 Ga0530510_0336909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

7

216

0.88

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

26

241

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r8c-assembly1.cif.gz_B the structure of human abcg1 0.7969 36 227
8wba-assembly1.cif.gz_A cryo-em structure of the abcg25 bound to chs 0.7919 29 225
7r88-assembly1.cif.gz_B the structure of human abcg5-i529w/abcg8-wt 0.7527 34 223
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.7314 36 224
7jr7-assembly1.cif.gz_A cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.7291 41 227
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7464 35 222 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7348 27 222 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7085 35 221 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6284 27 222 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6217 35 222 3.40.1710.10
ID Description Score Start End GO Terms
AF-X1SJL6-F1-model_v4 ABC transmembrane type-2 domain-containing protein 0.9456 82 227 GO:0043190
GO:0140359
AF-A0A7V9FL22-F1-model_v4 Transport permease protein 0.9371 55 229 GO:0043190
GO:0140359
AF-A0A1V4XGC9-F1-model_v4 ABC-2 type transporter 0.9358 73 229 GO:0043190
GO:0140359
AF-A0A7V9FL22-F1-model_v4 Transport permease protein 0.9219 55 229 GO:0043190
GO:0140359
AF-A0A536TVH4-F1-model_v4 Transport permease protein 0.9189 86 229 GO:0043190
GO:0140359

Map