F456271

General Info

Members Datasets Scaffolds Average Seq Length
504 245 1008 323

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_16708_c1|nmdc:mga05p37_16708_c1_3687_4733
Length 348
Sequence MPSQSGPESAFVADKPFGGGPLGAPGTVEGRALARKVLETEAAAILALVDRLDARFDCAVQLLLQCKGRVILTGMGKSGIICQKIAATLSSTGTASFFLHPAEAMHGDLGVIRGDDVVIALSYSGETDELLRLLESIRRLGAKLIAITGGPASTLAQAADVALDCSVAEEACPMNLVPTASTTAALAIGDALAMTLLVEKGFRQEDFANLHPGGKIGKRLMRVSALMHSGKQCPIVRTETRMRDVIYEMSSKGLGMTCVVDGDDVLLGIITDGDLRRRMERGTEILDLTAADVMTRNPIAVSPDTLAAEALNIMEQRKITAIVVADADQAPRVAGVVHLHDLWRLEMF

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
168 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 2.58
Rhizosphere 95.44
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_16708_c1 3300050507 Bacteria 8844
2 Ga0065712_10116129 3300005290 Bacteria 1740
3 Ga0065712_10136681 3300005290 Bacteria 1491
4 Ga0065715_10041229 3300005293 Bacteria 1092
5 Ga0070658_10125321 3300005327 Bacteria 2137
6 Ga0070676_10127162 3300005328 Bacteria 1607
7 Ga0070683_100201845 3300005329 Bacteria 1888
8 Ga0068869_100070458 3300005334 Bacteria 2587
9 Ga0068869_100348737 3300005334 Bacteria 1206
10 Ga0070666_10016739 3300005335 Bacteria 4694
11 Ga0070680_100068639 3300005336 Bacteria 2910
12 Ga0068868_100119246 3300005338 Bacteria 2151
13 Ga0068868_100134555 3300005338 Bacteria 2025
14 Ga0068868_100191021 3300005338 Bacteria 1703
15 Ga0070660_100032966 3300005339 Bacteria 3901
16 Ga0070691_10001081 3300005341 Bacteria 11289
17 Ga0070668_100259686 3300005347 Bacteria 1444
18 Ga0070669_100073654 3300005353 Bacteria 2530
19 Ga0070675_100001125 3300005354 Bacteria 19310
20 Ga0070675_100030018 3300005354 Bacteria 4387
21 Ga0070671_100012471 3300005355 Bacteria 6843
22 Ga0070671_100049537 3300005355 Bacteria 3494
23 Ga0070674_100002729 3300005356 Bacteria 9764
24 Ga0070673_100102408 3300005364 Bacteria 2361
25 Ga0070673_100122252 3300005364 Bacteria 2174
26 Ga0070673_100346856 3300005364 Bacteria 1317
27 Ga0070673_100455276 3300005364 Bacteria 1152
28 Ga0070688_100041542 3300005365 Bacteria 2824
29 Ga0070688_100138921 3300005365 Bacteria 1648
30 Ga0070659_100127559 3300005366 Bacteria 2065
31 Ga0070667_100004898 3300005367 Bacteria 11215
32 Ga0070667_100194485 3300005367 Bacteria 1798
33 Ga0070709_10017425 3300005434 Bacteria 4120
34 Ga0070713_100028496 3300005436 Bacteria 4410
35 Ga0070701_10001830 3300005438 Bacteria 8046
36 Ga0070711_100074170 3300005439 Bacteria 2406
37 Ga0070705_100001314 3300005440 Bacteria 13321
38 Ga0070705_100029176 3300005440 Bacteria 3031
39 Ga0070700_100001496 3300005441 Bacteria 11632
40 Ga0070694_100003841 3300005444 Bacteria 8975
41 Ga0070708_100025380 3300005445 Bacteria 5066
42 Ga0070708_100142447 3300005445 Bacteria 2224
43 Ga0070678_100150675 3300005456 Bacteria 1873
44 Ga0070662_100083365 3300005457 Bacteria 2386
45 Ga0070662_100149275 3300005457 Bacteria 1818
46 Ga0068867_100024164 3300005459 Bacteria 4355
47 Ga0068867_100092604 3300005459 Bacteria 2296
48 Ga0068867_100324171 3300005459 Bacteria 1277
49 Ga0070706_100188670 3300005467 Bacteria 1926
50 Ga0070707_100046718 3300005468 Bacteria 4144
51 Ga0070707_100575084 3300005468 Bacteria 1089
52 Ga0070698_100058391 3300005471 Bacteria 3901
53 Ga0070698_100229144 3300005471 Bacteria 1791
54 Ga0070679_100025481 3300005530 Bacteria 5805
55 Ga0070679_100043229 3300005530 Bacteria 4488
56 Ga0070684_100105093 3300005535 Bacteria 2527
57 Ga0070684_100290842 3300005535 Bacteria 1498
58 Ga0070697_100210647 3300005536 Bacteria 1654
59 Ga0070672_100056015 3300005543 Bacteria 3090
60 Ga0070672_100211092 3300005543 Bacteria 1626
61 Ga0070686_100001857 3300005544 Bacteria 11778
62 Ga0070695_100007402 3300005545 Bacteria 6512
63 Ga0070696_100009529 3300005546 Bacteria 6500
64 Ga0070696_100197976 3300005546 Bacteria 1498
65 Ga0070665_100000114 3300005548 Bacteria 151271
66 Ga0070665_100014083 3300005548 Bacteria 8038
67 Ga0070665_100138593 3300005548 Bacteria 2436
68 Ga0070704_100046941 3300005549 Bacteria 3016
69 Ga0070704_100220743 3300005549 Bacteria 1541
70 Ga0070704_100234113 3300005549 Bacteria 1500
71 Ga0068855_100007855 3300005563 Bacteria 12890
72 Ga0068855_100527750 3300005563 Bacteria 1280
73 Ga0068854_100010165 3300005578 Bacteria 6097
74 Ga0068854_100024065 3300005578 Bacteria 4166
75 Ga0068854_100266721 3300005578 Bacteria 1373
76 Ga0070702_100040715 3300005615 Bacteria 2601
77 Ga0070702_100091819 3300005615 Bacteria 1843
78 Ga0068852_100162054 3300005616 Bacteria 2089
79 Ga0068859_100014186 3300005617 Bacteria 7991
80 Ga0068859_100313296 3300005617 Bacteria 1663
81 Ga0068859_100345753 3300005617 Bacteria 1582
82 Ga0068864_100030833 3300005618 Bacteria 4546
83 Ga0068866_10010088 3300005718 Bacteria 4039
84 Ga0068866_10153419 3300005718 Bacteria 1336
85 Ga0068861_100001397 3300005719 Bacteria 15173
86 Ga0068861_100036631 3300005719 Bacteria 3643
87 Ga0068861_100097598 3300005719 Bacteria 2331
88 Ga0068861_100106119 3300005719 Bacteria 2243
89 Ga0068861_100347536 3300005719 Bacteria 1300
90 Ga0068861_100457237 3300005719 Bacteria 1145
91 Ga0068863_100003994 3300005841 Bacteria 14562
92 Ga0068863_100120582 3300005841 Bacteria 2500
93 Ga0068863_100350835 3300005841 Bacteria 1437
94 Ga0068858_100000761 3300005842 Bacteria 33790
95 Ga0068858_100007567 3300005842 Bacteria 10492
96 Ga0068858_100048637 3300005842 Bacteria 3928
97 Ga0068858_100589638 3300005842 Bacteria 1078
98 Ga0068860_100120173 3300005843 Bacteria 2515
99 Ga0068860_100176456 3300005843 Bacteria 2065
100 Ga0068862_100000343 3300005844 Bacteria 50391
101 Ga0068862_100025130 3300005844 Bacteria 5000
102 Ga0068862_100054545 3300005844 Bacteria 3422
103 Ga0068862_100108009 3300005844 Bacteria 2440
104 Ga0081539_10011075 3300005985 Bacteria 7207
105 Ga0070717_10059812 3300006028 Bacteria 3154
106 Ga0070717_10470118 3300006028 Bacteria 1135
107 Ga0075368_10103880 3300006042 Bacteria 1168
108 Ga0070716_100017576 3300006173 Bacteria 3710
109 Ga0070716_100042379 3300006173 Bacteria 2541
110 Ga0075367_10011253 3300006178 Bacteria 4726
111 Ga0075367_10215139 3300006178 Bacteria 1202
112 Ga0075366_10010282 3300006195 Bacteria 5250
113 Ga0097621_100000066 3300006237 Bacteria 54619
114 Ga0097621_100003865 3300006237 Bacteria 10377
115 Ga0097621_100011699 3300006237 Bacteria 6477
116 Ga0097621_100135923 3300006237 Bacteria 2097
117 Ga0068871_100000170 3300006358 Bacteria 43522
118 Ga0068871_100016674 3300006358 Bacteria 5541
119 Ga0075428_100000108 3300006844 Bacteria 70319
120 Ga0075428_100032880 3300006844 Bacteria 5727
121 Ga0075428_100062654 3300006844 Bacteria 4071
122 Ga0075428_100103786 3300006844 Bacteria 3100
123 Ga0075430_100043470 3300006846 Bacteria 3797
124 Ga0075430_100094261 3300006846 Bacteria 2503
125 Ga0075431_100052275 3300006847 Bacteria 4212
126 Ga0075431_100055778 3300006847 Bacteria 4076
127 Ga0075431_100200466 3300006847 Bacteria 2042
128 Ga0075433_10033716 3300006852 Bacteria 4391
129 Ga0075433_10039685 3300006852 Bacteria 4072
130 Ga0075433_10094658 3300006852 Bacteria 2643
131 Ga0075434_100013487 3300006871 Bacteria 7781
132 Ga0075434_100056443 3300006871 Bacteria 3902
133 Ga0075434_100061081 3300006871 Bacteria 3748
134 Ga0075434_100106969 3300006871 Bacteria 2807
135 Ga0075434_100193581 3300006871 Bacteria 2054
136 Ga0075436_100001888 3300006914 Bacteria 14395
137 Ga0075436_100005597 3300006914 Bacteria 8621
138 Ga0075436_100039290 3300006914 Bacteria 3266
139 Ga0075436_100143058 3300006914 Bacteria 1681
140 Ga0075436_100166813 3300006914 Bacteria 1554
141 Ga0097620_100014186 3300006931 Bacteria 7991
142 Ga0097620_100313295 3300006931 Bacteria 1663
143 Ga0097620_100345752 3300006931 Bacteria 1582
144 Ga0075435_100001969 3300007076 Bacteria 13393
145 Ga0075435_100002082 3300007076 Bacteria 13131
146 Ga0075435_100068091 3300007076 Bacteria 2899
147 Ga0075435_100309533 3300007076 Bacteria 1351
148 Ga0105240_10360214 3300009093 Bacteria 1648
149 Ga0111539_10000001 3300009094 Bacteria 1035431
150 Ga0111539_10001440 3300009094 Bacteria 31737
151 Ga0111539_10004657 3300009094 Bacteria 17928
152 Ga0111539_10008383 3300009094 Bacteria 13151
153 Ga0111539_10022916 3300009094 Bacteria 7668
154 Ga0111539_10043543 3300009094 Bacteria 5380
155 Ga0111539_10230546 3300009094 Bacteria 2156
156 Ga0111539_10387939 3300009094 Bacteria 1626
157 Ga0111539_10712853 3300009094 Bacteria 1168
158 Ga0105247_10007600 3300009101 Bacteria 6638
159 Ga0105247_10037110 3300009101 Bacteria 2973
160 Ga0114129_10001367 3300009147 Bacteria 32804
161 Ga0114129_10008634 3300009147 Bacteria 14527
162 Ga0114129_10029691 3300009147 Bacteria 7742
163 Ga0114129_10035583 3300009147 Bacteria 7035
164 Ga0114129_10052953 3300009147 Bacteria 5694
165 Ga0114129_10091638 3300009147 Bacteria 4211
166 Ga0114129_10141969 3300009147 Bacteria 3291
167 Ga0114129_10185611 3300009147 Bacteria 2827
168 Ga0114129_10196086 3300009147 Bacteria 2738
169 Ga0114129_10200768 3300009147 Bacteria 2701
170 Ga0114129_10272558 3300009147 Bacteria 2264
171 Ga0114129_10513233 3300009147 Bacteria 1564
172 Ga0114129_10747665 3300009147 Bacteria 1252
173 Ga0105243_10011387 3300009148 Bacteria 6731
174 Ga0105243_10029935 3300009148 Bacteria 4189
175 Ga0105243_10454146 3300009148 Bacteria 1203
176 Ga0105242_10015839 3300009176 Bacteria 5857
177 Ga0105242_10045751 3300009176 Bacteria 3548
178 Ga0105242_10059278 3300009176 Bacteria 3140
179 Ga0105242_10356893 3300009176 Bacteria 1352
180 Ga0105242_10555040 3300009176 Bacteria 1102
181 Ga0105248_10021247 3300009177 Bacteria 7192
182 Ga0105248_10027819 3300009177 Bacteria 6295
183 Ga0105248_10125247 3300009177 Bacteria 2898
184 Ga0105248_10132324 3300009177 Bacteria 2814
185 Ga0105248_10150831 3300009177 Bacteria 2622
186 Ga0105248_10160333 3300009177 Bacteria 2537
187 Ga0105248_10226985 3300009177 Bacteria 2102
188 Ga0105248_10266627 3300009177 Bacteria 1928
189 Ga0105248_10269290 3300009177 Bacteria 1918
190 Ga0105248_10697422 3300009177 Bacteria 1145
191 Ga0105237_10132969 3300009545 Bacteria 2482
192 Ga0105249_10191582 3300009553 Bacteria 1996
193 Ga0105249_10313208 3300009553 Bacteria 1578
194 Ga0163162_10044785 3300013306 Bacteria 4432
195 Ga0163162_10241941 3300013306 Bacteria 1935
196 Ga0157372_10182681 3300013307 Bacteria 2428
197 Ga0163163_10005222 3300014325 Bacteria 11201
198 Ga0163163_10054390 3300014325 Bacteria 3955
199 Ga0163163_10199311 3300014325 Bacteria 2050
200 Ga0157380_10170408 3300014326 Bacteria 1902
201 Ga0157380_10197531 3300014326 Bacteria 1782
202 Ga0157380_10312766 3300014326 Bacteria 1452
203 Ga0157379_10083672 3300014968 Bacteria 2860
204 Ga0157376_10019477 3300014969 Bacteria 5232
205 Ga0157376_10038828 3300014969 Bacteria 3877
206 Ga0157376_10063002 3300014969 Bacteria 3122
207 Ga0157376_10076491 3300014969 Bacteria 2860
208 Ga0157376_10216419 3300014969 Bacteria 1771
209 Ga0207710_10041597 3300025900 Bacteria 2039
210 Ga0207699_10047251 3300025906 Bacteria 2523
211 Ga0207645_10000802 3300025907 Bacteria 26290
212 Ga0207645_10005752 3300025907 Bacteria 8947
213 Ga0207645_10053489 3300025907 Bacteria 2580
214 Ga0207705_10082523 3300025909 Bacteria 2344
215 Ga0207707_10146346 3300025912 Bacteria 2065
216 Ga0207695_10115098 3300025913 Bacteria 2664
217 Ga0207695_10123157 3300025913 Bacteria 2559
218 Ga0207695_10157746 3300025913 Bacteria 2203
219 Ga0207662_10051424 3300025918 Bacteria 2452
220 Ga0207662_10148810 3300025918 Bacteria 1488
221 Ga0207657_10015006 3300025919 Bacteria 7523
222 Ga0207652_10039804 3300025921 Bacteria 3990
223 Ga0207652_10147658 3300025921 Bacteria 2105
224 Ga0207646_10063295 3300025922 Bacteria 3303
225 Ga0207646_10178232 3300025922 Bacteria 1919
226 Ga0207646_10281606 3300025922 Bacteria 1502
227 Ga0207681_10014159 3300025923 Bacteria 4949
228 Ga0207681_10020674 3300025923 Bacteria 4175
229 Ga0207681_10119095 3300025923 Bacteria 1933
230 Ga0207681_10155509 3300025923 Bacteria 1718
231 Ga0207659_10000918 3300025926 Bacteria 17553
232 Ga0207687_10354120 3300025927 Bacteria 1197
233 Ga0207664_10253004 3300025929 Bacteria 1538
234 Ga0207644_10133194 3300025931 Bacteria 1905
235 Ga0207690_10028639 3300025932 Bacteria 3532
236 Ga0207706_10046548 3300025933 Bacteria 3840
237 Ga0207706_10051795 3300025933 Bacteria 3625
238 Ga0207706_10079599 3300025933 Bacteria 2881
239 Ga0207706_10343396 3300025933 Bacteria 1298
240 Ga0207706_10426166 3300025933 Unclassified 1149
241 Ga0207686_10003167 3300025934 Bacteria 8856
242 Ga0207686_10006109 3300025934 Bacteria 6470
243 Ga0207709_10077339 3300025935 Bacteria 2133
244 Ga0207670_10277892 3300025936 Bacteria 1304
245 Ga0207669_10031547 3300025937 Bacteria 2962
246 Ga0207669_10055761 3300025937 Bacteria 2395
247 Ga0207669_10163940 3300025937 Bacteria 1574
248 Ga0207704_10030247 3300025938 Bacteria 3033
249 Ga0207704_10308660 3300025938 Bacteria 1215
250 Ga0207665_10053476 3300025939 Bacteria 2722
251 Ga0207691_10236552 3300025940 Bacteria 1580
252 Ga0207711_10015131 3300025941 Bacteria 6407
253 Ga0207711_10023851 3300025941 Bacteria 5122
254 Ga0207711_10028851 3300025941 Bacteria 4674
255 Ga0207711_10043611 3300025941 Bacteria 3827
256 Ga0207711_10102304 3300025941 Bacteria 2536
257 Ga0207711_10215339 3300025941 Bacteria 1755
258 Ga0207711_10321412 3300025941 Bacteria 1430
259 Ga0207689_10042602 3300025942 Bacteria 3754
260 Ga0207689_10079854 3300025942 Bacteria 2688
261 Ga0207689_10131665 3300025942 Bacteria 2058
262 Ga0207661_10129304 3300025944 Bacteria 2161
263 Ga0207661_10237900 3300025944 Bacteria 1615
264 Ga0207661_10352003 3300025944 Bacteria 1329
265 Ga0207667_10310570 3300025949 Bacteria 1610
266 Ga0207651_10003153 3300025960 Bacteria 8044
267 Ga0207651_10474271 3300025960 Bacteria 1077
268 Ga0207712_10040818 3300025961 Bacteria 3187
269 Ga0207712_10148438 3300025961 Bacteria 1808
270 Ga0207712_10256730 3300025961 Bacteria 1415
271 Ga0207668_10192863 3300025972 Bacteria 1616
272 Ga0207640_10001184 3300025981 Bacteria 14256
273 Ga0207640_10028496 3300025981 Bacteria 3416
274 Ga0207640_10029023 3300025981 Bacteria 3390
275 Ga0207658_10149494 3300025986 Bacteria 1901
276 Ga0207677_10036402 3300026023 Bacteria 3207
277 Ga0207677_10172520 3300026023 Bacteria 1693
278 Ga0207677_10183692 3300026023 Bacteria 1647
279 Ga0207703_10067812 3300026035 Bacteria 2937
280 Ga0207703_10088906 3300026035 Bacteria 2593
281 Ga0207703_10156586 3300026035 Bacteria 1991
282 Ga0207678_10027292 3300026067 Bacteria 4979
283 Ga0207708_10003693 3300026075 Bacteria 11298
284 Ga0207708_10032219 3300026075 Bacteria 3981
285 Ga0207641_10063297 3300026088 Bacteria 3159
286 Ga0207641_10107861 3300026088 Bacteria 2464
287 Ga0207648_10017009 3300026089 Bacteria 6627
288 Ga0207648_10041242 3300026089 Bacteria 4053
289 Ga0207648_10078692 3300026089 Bacteria 2876
290 Ga0207648_10083764 3300026089 Bacteria 2781
291 Ga0207648_10114164 3300026089 Bacteria 2373
292 Ga0207676_10021942 3300026095 Bacteria 4690
293 Ga0207675_100004573 3300026118 Bacteria 13347
294 Ga0207675_100036702 3300026118 Bacteria 4571
295 Ga0207675_100040892 3300026118 Bacteria 4331
296 Ga0207675_100086851 3300026118 Bacteria 2937
297 Ga0207675_100267713 3300026118 Bacteria 1658
298 Ga0207683_10077910 3300026121 Bacteria 2936
299 Ga0207683_10141006 3300026121 Bacteria 2172
300 Ga0209983_1007563 3300027665 Bacteria 2226
301 Ga0209971_1007393 3300027682 Bacteria 2606
302 Ga0207428_10000002 3300027907 Bacteria 854851
303 Ga0207428_10016482 3300027907 Bacteria 6355
304 Ga0207428_10028884 3300027907 Bacteria 4603
305 Ga0268266_10005118 3300028379 Bacteria 12357
306 Ga0268266_10350447 3300028379 Bacteria 1387
307 Ga0268266_10798809 3300028379 Bacteria 911
308 Ga0268265_10000315 3300028380 Bacteria 53210
309 Ga0268265_10014972 3300028380 Bacteria 5296
310 Ga0268265_10025473 3300028380 Bacteria 4199
311 Ga0268265_10097610 3300028380 Bacteria 2364
312 Ga0268265_10116673 3300028380 Bacteria 2191
313 Ga0268265_10261491 3300028380 Bacteria 1539
314 Ga0268264_10050010 3300028381 Bacteria 3479
315 Ga0268264_10051074 3300028381 Bacteria 3445
316 Ga0268264_10281486 3300028381 Bacteria 1558
317 Ga0307408_100027719 3300031548 Bacteria 3907
318 Ga0265314_10058390 3300031711 Bacteria 2644
319 Ga0307416_100070551 3300032002 Bacteria 2898
320 Ga0307416_100369766 3300032002 Bacteria 1459
321 Ga0307415_100024908 3300032126 Bacteria 3746
322 Ga0373948_0001206 3300034817 Bacteria 3520
323 Ga0373958_0004597 3300034819 Bacteria 2051
324 Ga0373938_0001662 3300034957 Bacteria 3567
325 Ga0373926_0088402 3300035083 Bacteria 1150
326 Ga0373929_0000663 3300035085 Bacteria 6619
327 Ga0373940_0001959 3300035088 Bacteria 3887
328 Ga0373944_0074878 3300035089 Bacteria 1109
329 Ga0373949_0002150 3300035090 Bacteria 5173
330 Ga0373951_0000754 3300035091 Bacteria 8843
331 Ga0373952_0000302 3300035092 Bacteria 8220
332 Ga0373923_0038993 3300035111 Bacteria 1949
333 Ga0373932_0012217 3300035112 Bacteria 2111
334 Ga0373939_0002036 3300035114 Bacteria 4823
335 Ga0373939_0017875 3300035114 Bacteria 1890
336 Ga0373941_0001621 3300035115 Bacteria 4793
337 Ga0373953_0128332 3300035117 Bacteria 1080
338 Ga0373943_0005796 3300035170 Bacteria 5548
339 Ga0373946_0008087 3300035171 Bacteria 3861
340 Ga0373955_0030745 3300035172 Bacteria 2807
341 Ga0373955_0231679 3300035172 Bacteria 1105
342 Ga0373942_0000284 3300035207 Bacteria 13775
343 Ga0373961_0000364 3300035241 Bacteria 19453
344 Ga0373962_0023541 3300035242 Bacteria 1641
345 Ga0373931_0050267 3300035691 Bacteria 2218
346 Ga0373931_0165584 3300035691 Bacteria 1299
347 Ga0373935_0029568 3300035692 Bacteria 3391
348 Ga0373935_0033928 3300035692 Bacteria 3179
349 Ga0373927_0116204 3300035695 Bacteria 1744
350 Ga0373947_0006634 3300035725 Bacteria 6717
351 Ga0373937_0395541 3300036401 Bacteria 1311
352 Ga0373925_0009186 3300037068 Bacteria 7199
353 Ga0373925_0055419 3300037068 Bacteria 2968
354 Ga0451849_0160923 3300041505 Bacteria 5903
355 Ga0450921_001204 3300042123 Bacteria 1507
356 Ga0451577_0062732 3300042876 Bacteria 3314
357 Ga0466963_0039122 3300044694 Bacteria 3105
358 Ga0453684_0144098 3300044712 Bacteria 2840
359 Ga0451576_0005014 3300045051 Bacteria 16823
360 Ga0466967_0271728 3300045976 Bacteria 1624
361 Ga0495592_0072476 3300046454 Bacteria 2506
362 Ga0495629_0025099 3300046459 Bacteria 4239
363 Ga0495629_0103052 3300046459 Bacteria 1991
364 Ga0495580_0045080 3300046472 Bacteria 3133
365 Ga0495582_0017467 3300046473 Bacteria 3926
366 Ga0495582_0125529 3300046473 Bacteria 1448
367 Ga0495639_0001920 3300046475 Bacteria 9225
368 Ga0495585_0156760 3300046492 Bacteria 1184
369 Ga0495594_0071087 3300046499 Bacteria 1935
370 Ga0495608_0035263 3300046511 Bacteria 3375
371 Ga0495628_0077312 3300046516 Bacteria 2589
372 Ga0495630_0001943 3300046517 Bacteria 14387
373 Ga0495587_0128325 3300046536 Bacteria 1450
374 Ga0495645_0003879 3300046543 Bacteria 10185
375 Ga0495645_0116158 3300046543 Bacteria 1889
376 Ga0495622_0008970 3300046557 Bacteria 4635
377 Ga0495633_0064217 3300046558 Bacteria 1717
378 Ga0495667_0154896 3300046559 Bacteria 1475
379 Ga0495634_0243096 3300046642 Bacteria 1103
380 Ga0495635_0066993 3300046663 Bacteria 2463
381 Ga0495647_0025299 3300046681 Bacteria 2168
382 Ga0495658_0011622 3300046683 Bacteria 4435
383 Ga0495658_0030083 3300046683 Unclassified 2946
384 Ga0495658_0054719 3300046683 Bacteria 2271
385 Ga0495613_0005250 3300046689 Bacteria 9732
386 Ga0495613_0192651 3300046689 Bacteria 1440
387 Ga0495613_0229391 3300046689 Bacteria 1301
388 Ga0495581_0004997 3300047315 Bacteria 7681
389 Ga0495674_0034999 3300047319 Bacteria 4535
390 Ga0495676_0008166 3300047321 Bacteria 9602
391 Ga0495680_0079617 3300047322 Bacteria 2477
392 Ga0495675_0237963 3300047444 Bacteria 1097
393 Ga0495684_0000174 3300047471 Bacteria 48736
394 Ga0495684_0015904 3300047471 Bacteria 5794
395 Ga0496102_0462778 3300048905 Bacteria 1189
396 Ga0496106_0098370 3300048909 Bacteria 2267
397 Ga0496106_0166817 3300048909 Bacteria 1743
398 Ga0496108_0076993 3300048911 Bacteria 2820
399 Ga0496109_0116200 3300048912 Bacteria 2490
400 Ga0496109_0185569 3300048912 Bacteria 1954
401 Ga0496112_0033032 3300048915 Bacteria 5025
402 Ga0496112_0189183 3300048915 Bacteria 2021
403 Ga0496112_0217688 3300048915 Bacteria 1866
404 Ga0496114_0000105 3300048917 Bacteria 60923
405 Ga0496114_0096570 3300048917 Bacteria 2516
406 Ga0496114_0401097 3300048917 Bacteria 1214
407 Ga0496114_0469853 3300048917 Bacteria 1113
408 Ga0501036_0145280 3300049572 Bacteria 2001
409 Ga0501036_0384821 3300049572 Bacteria 1171
410 Ga0501038_0037889 3300049574 Bacteria 4225
411 Ga0501039_0006038 3300049575 Bacteria 9194
412 Ga0501039_0023078 3300049575 Bacteria 4773
413 Ga0501040_0030184 3300049576 Bacteria 3661
414 Ga0501040_0136281 3300049576 Bacteria 1728
415 Ga0501041_0026882 3300049577 Bacteria 3465
416 Ga0501042_0010107 3300049578 Bacteria 6312
417 Ga0501042_0016995 3300049578 Bacteria 5010
418 Ga0501042_0030305 3300049578 Bacteria 3820
419 Ga0501043_0168068 3300049579 Bacteria 1712
420 Ga0501048_0013092 3300049582 Bacteria 6158
421 Ga0501048_0040451 3300049582 Bacteria 3341
422 Ga0501048_0195421 3300049582 Bacteria 1434
423 Ga0501067_0013705 3300049583 Bacteria 4490
424 Ga0501068_0104107 3300049584 Bacteria 1761
425 Ga0501070_0384357 3300049586 Bacteria 1137
426 Ga0501072_0024017 3300049588 Bacteria 4739
427 Ga0501072_0111023 3300049588 Unclassified 2183
428 Ga0501073_0159089 3300049589 Bacteria 1565
429 Ga0501073_0289461 3300049589 Bacteria 1130
430 Ga0501074_0091234 3300049590 Bacteria 2182
431 Ga0501075_0009227 3300049591 Bacteria 6897
432 Ga0501075_0130384 3300049591 Bacteria 1915
433 Ga0501076_0013912 3300049592 Bacteria 6042
434 Ga0501077_0000162 3300049593 Bacteria 37776
435 Ga0501077_0028214 3300049593 Bacteria 3567
436 Ga0501077_0122023 3300049593 Bacteria 1652
437 Ga0501079_0005806 3300049741 Bacteria 9227
438 Ga0501079_0049794 3300049741 Bacteria 3234
439 Ga0501080_0027202 3300049742 Bacteria 5319
440 Ga0501080_0065597 3300049742 Bacteria 3377
441 Ga0501080_0168084 3300049742 Bacteria 2024
442 Ga0501081_0046305 3300049743 Bacteria 2989
443 Ga0501045_0061427 3300049824 Bacteria 2756
444 nmdc:mga0k408_36528_c1 3300050493 Bacteria 2820
445 nmdc:mga06z11_8914_c1 3300050494 Bacteria 4206
446 nmdc:mga05p37_1036_c1 3300050507 Bacteria 31681
447 nmdc:mga05p37_10839_c1 3300050507 Bacteria 10822
448 nmdc:mga05p37_124475_c1 3300050507 Bacteria 3166
449 nmdc:mga05p37_134595_c1 3300050507 Bacteria 3032
450 nmdc:mga05p37_154075_c1 3300050507 Bacteria 2809
451 nmdc:mga05p37_160277_c1 3300050507 Bacteria 2748
452 nmdc:mga05p37_166011_c1 3300050507 Bacteria 2694
453 nmdc:mga05p37_404068_c1 3300050507 Bacteria 1594
454 nmdc:mga05p37_4703_c1 3300050507 Bacteria 15946
455 nmdc:mga05p37_59539_c1 3300050507 Bacteria 3640
456 nmdc:mga05p37_78972_c1 3300050507 Bacteria 4052
457 nmdc:mga09592_55360_c1 3300050508 Bacteria 3352
458 nmdc:mga0qj67_252244_c1 3300050509 Bacteria 1432
459 nmdc:mga06r32_26256_c1 3300050510 Bacteria 5428
460 nmdc:mga06r32_5663_c1 3300050510 Bacteria 11244
461 nmdc:mga06r32_64117_c1 3300050510 Bacteria 3542
462 nmdc:mga08y16_306479_c1 3300050511 Bacteria 1636
463 nmdc:mga08y16_31309_c1 3300050511 Bacteria 5596
464 nmdc:mga08y16_32739_c1 3300050511 Bacteria 5466
465 nmdc:mga08y16_3591_c1 3300050511 Bacteria 16109
466 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
467 nmdc:mga08y16_4269_c1 3300050511 Bacteria 14915
468 nmdc:mga08y16_45157_c1 3300050511 Bacteria 4616
469 nmdc:mga08y16_556585_c1 3300050511 Unclassified 1160
470 nmdc:mga0n895_16719_c1 3300050512 Bacteria 6740
471 nmdc:mga0n895_25323_c1 3300050512 Bacteria 5605
472 nmdc:mga0n895_3220_c2 3300050512 Bacteria 8352
473 nmdc:mga0n895_4659_c1 3300050512 Bacteria 11311
474 nmdc:mga0n895_51341_c1 3300050512 Bacteria 4045
475 nmdc:mga0rr50_114_c1 3300050513 Bacteria 44678
476 nmdc:mga0rr50_136962_c1 3300050513 Bacteria 1966
477 nmdc:mga0rr50_504_c1 3300050513 Bacteria 20788
478 nmdc:mga08x19_135828_c1 3300050514 Bacteria 1658
479 nmdc:mga08x19_233425_c1 3300050514 Bacteria 1267
480 nmdc:mga08x19_271_c1 3300050514 Bacteria 39236
481 nmdc:mga08x19_27869_c1 3300050514 Bacteria 3535
482 nmdc:mga08x19_35403_c1 3300050514 Bacteria 3159
483 nmdc:mga0a205_13438_c1 3300050515 Bacteria 7623
484 nmdc:mga0a205_274997_c1 3300050515 Bacteria 1560
485 nmdc:mga0a205_48666_c1 3300050515 Bacteria 4092
486 Ga0495601_0003027 3300053077 Bacteria 9582
487 Ga0495601_0014872 3300053077 Bacteria 4698
488 Ga0495601_0026903 3300053077 Bacteria 3555
489 Ga0495601_0038671 3300053077 Bacteria 2984
490 Ga0495595_0030475 3300053084 Bacteria 2420
491 Ga0495595_0073027 3300053084 Bacteria 1624
492 Ga0495595_0091494 3300053084 Bacteria 1460
493 Ga0495619_0009731 3300053085 Bacteria 6061
494 Ga0495619_0015238 3300053085 Bacteria 4861
495 Ga0495619_0073958 3300053085 Bacteria 2284
496 Ga0500555_000424 3300053103 Bacteria 17586
497 Ga0500616_0000167 3300053153 Bacteria 109823
498 Ga0500645_000331 3300053730 Bacteria 33681
499 Ga0501084_0042637 3300054114 Bacteria 3795
500 Ga0501082_0000116 3300060353 Bacteria 62872
501 Ga0501082_0206221 3300060353 Bacteria 1710
502 Ga0501082_0394372 3300060353 Bacteria 1208
503 Ga0530510_0010960 3300061734 Bacteria 6360
504 Ga0530510_0041213 3300061734 Bacteria 3333
505 nmdc:mga05p37_16708_c1
506 Ga0065712_10116129
507 Ga0065712_10136681
508 Ga0065715_10041229
509 Ga0070658_10125321
510 Ga0070676_10127162
511 Ga0070683_100201845
512 Ga0068869_100070458
513 Ga0068869_100348737
514 Ga0070666_10016739
515 Ga0070680_100068639
516 Ga0068868_100119246
517 Ga0068868_100134555
518 Ga0068868_100191021
519 Ga0070660_100032966
520 Ga0070691_10001081
521 Ga0070668_100259686
522 Ga0070669_100073654
523 Ga0070675_100001125
524 Ga0070675_100030018
525 Ga0070671_100012471
526 Ga0070671_100049537
527 Ga0070674_100002729
528 Ga0070673_100102408
529 Ga0070673_100122252
530 Ga0070673_100346856
531 Ga0070673_100455276
532 Ga0070688_100041542
533 Ga0070688_100138921
534 Ga0070659_100127559
535 Ga0070667_100004898
536 Ga0070667_100194485
537 Ga0070709_10017425
538 Ga0070713_100028496
539 Ga0070701_10001830
540 Ga0070711_100074170
541 Ga0070705_100001314
542 Ga0070705_100029176
543 Ga0070700_100001496
544 Ga0070694_100003841
545 Ga0070708_100025380
546 Ga0070708_100142447
547 Ga0070678_100150675
548 Ga0070662_100083365
549 Ga0070662_100149275
550 Ga0068867_100024164
551 Ga0068867_100092604
552 Ga0068867_100324171
553 Ga0070706_100188670
554 Ga0070707_100046718
555 Ga0070707_100575084
556 Ga0070698_100058391
557 Ga0070698_100229144
558 Ga0070679_100025481
559 Ga0070679_100043229
560 Ga0070684_100105093
561 Ga0070684_100290842
562 Ga0070697_100210647
563 Ga0070672_100056015
564 Ga0070672_100211092
565 Ga0070686_100001857
566 Ga0070695_100007402
567 Ga0070696_100009529
568 Ga0070696_100197976
569 Ga0070665_100000114
570 Ga0070665_100014083
571 Ga0070665_100138593
572 Ga0070704_100046941
573 Ga0070704_100220743
574 Ga0070704_100234113
575 Ga0068855_100007855
576 Ga0068855_100527750
577 Ga0068854_100010165
578 Ga0068854_100024065
579 Ga0068854_100266721
580 Ga0070702_100040715
581 Ga0070702_100091819
582 Ga0068852_100162054
583 Ga0068859_100014186
584 Ga0068859_100313296
585 Ga0068859_100345753
586 Ga0068864_100030833
587 Ga0068866_10010088
588 Ga0068866_10153419
589 Ga0068861_100001397
590 Ga0068861_100036631
591 Ga0068861_100097598
592 Ga0068861_100106119
593 Ga0068861_100347536
594 Ga0068861_100457237
595 Ga0068863_100003994
596 Ga0068863_100120582
597 Ga0068863_100350835
598 Ga0068858_100000761
599 Ga0068858_100007567
600 Ga0068858_100048637
601 Ga0068858_100589638
602 Ga0068860_100120173
603 Ga0068860_100176456
604 Ga0068862_100000343
605 Ga0068862_100025130
606 Ga0068862_100054545
607 Ga0068862_100108009
608 Ga0081539_10011075
609 Ga0070717_10059812
610 Ga0070717_10470118
611 Ga0075368_10103880
612 Ga0070716_100017576
613 Ga0070716_100042379
614 Ga0075367_10011253
615 Ga0075367_10215139
616 Ga0075366_10010282
617 Ga0097621_100000066
618 Ga0097621_100003865
619 Ga0097621_100011699
620 Ga0097621_100135923
621 Ga0068871_100000170
622 Ga0068871_100016674
623 Ga0075428_100000108
624 Ga0075428_100032880
625 Ga0075428_100062654
626 Ga0075428_100103786
627 Ga0075430_100043470
628 Ga0075430_100094261
629 Ga0075431_100052275
630 Ga0075431_100055778
631 Ga0075431_100200466
632 Ga0075433_10033716
633 Ga0075433_10039685
634 Ga0075433_10094658
635 Ga0075434_100013487
636 Ga0075434_100056443
637 Ga0075434_100061081
638 Ga0075434_100106969
639 Ga0075434_100193581
640 Ga0075436_100001888
641 Ga0075436_100005597
642 Ga0075436_100039290
643 Ga0075436_100143058
644 Ga0075436_100166813
645 Ga0097620_100014186
646 Ga0097620_100313295
647 Ga0097620_100345752
648 Ga0075435_100001969
649 Ga0075435_100002082
650 Ga0075435_100068091
651 Ga0075435_100309533
652 Ga0105240_10360214
653 Ga0111539_10000001
654 Ga0111539_10001440
655 Ga0111539_10004657
656 Ga0111539_10008383
657 Ga0111539_10022916
658 Ga0111539_10043543
659 Ga0111539_10230546
660 Ga0111539_10387939
661 Ga0111539_10712853
662 Ga0105247_10007600
663 Ga0105247_10037110
664 Ga0114129_10001367
665 Ga0114129_10008634
666 Ga0114129_10029691
667 Ga0114129_10035583
668 Ga0114129_10052953
669 Ga0114129_10091638
670 Ga0114129_10141969
671 Ga0114129_10185611
672 Ga0114129_10196086
673 Ga0114129_10200768
674 Ga0114129_10272558
675 Ga0114129_10513233
676 Ga0114129_10747665
677 Ga0105243_10011387
678 Ga0105243_10029935
679 Ga0105243_10454146
680 Ga0105242_10015839
681 Ga0105242_10045751
682 Ga0105242_10059278
683 Ga0105242_10356893
684 Ga0105242_10555040
685 Ga0105248_10021247
686 Ga0105248_10027819
687 Ga0105248_10125247
688 Ga0105248_10132324
689 Ga0105248_10150831
690 Ga0105248_10160333
691 Ga0105248_10226985
692 Ga0105248_10266627
693 Ga0105248_10269290
694 Ga0105248_10697422
695 Ga0105237_10132969
696 Ga0105249_10191582
697 Ga0105249_10313208
698 Ga0163162_10044785
699 Ga0163162_10241941
700 Ga0157372_10182681
701 Ga0163163_10005222
702 Ga0163163_10054390
703 Ga0163163_10199311
704 Ga0157380_10170408
705 Ga0157380_10197531
706 Ga0157380_10312766
707 Ga0157379_10083672
708 Ga0157376_10019477
709 Ga0157376_10038828
710 Ga0157376_10063002
711 Ga0157376_10076491
712 Ga0157376_10216419
713 Ga0207710_10041597
714 Ga0207699_10047251
715 Ga0207645_10000802
716 Ga0207645_10005752
717 Ga0207645_10053489
718 Ga0207705_10082523
719 Ga0207707_10146346
720 Ga0207695_10115098
721 Ga0207695_10123157
722 Ga0207695_10157746
723 Ga0207662_10051424
724 Ga0207662_10148810
725 Ga0207657_10015006
726 Ga0207652_10039804
727 Ga0207652_10147658
728 Ga0207646_10063295
729 Ga0207646_10178232
730 Ga0207646_10281606
731 Ga0207681_10014159
732 Ga0207681_10020674
733 Ga0207681_10119095
734 Ga0207681_10155509
735 Ga0207659_10000918
736 Ga0207687_10354120
737 Ga0207664_10253004
738 Ga0207644_10133194
739 Ga0207690_10028639
740 Ga0207706_10046548
741 Ga0207706_10051795
742 Ga0207706_10079599
743 Ga0207706_10343396
744 Ga0207706_10426166
745 Ga0207686_10003167
746 Ga0207686_10006109
747 Ga0207709_10077339
748 Ga0207670_10277892
749 Ga0207669_10031547
750 Ga0207669_10055761
751 Ga0207669_10163940
752 Ga0207704_10030247
753 Ga0207704_10308660
754 Ga0207665_10053476
755 Ga0207691_10236552
756 Ga0207711_10015131
757 Ga0207711_10023851
758 Ga0207711_10028851
759 Ga0207711_10043611
760 Ga0207711_10102304
761 Ga0207711_10215339
762 Ga0207711_10321412
763 Ga0207689_10042602
764 Ga0207689_10079854
765 Ga0207689_10131665
766 Ga0207661_10129304
767 Ga0207661_10237900
768 Ga0207661_10352003
769 Ga0207667_10310570
770 Ga0207651_10003153
771 Ga0207651_10474271
772 Ga0207712_10040818
773 Ga0207712_10148438
774 Ga0207712_10256730
775 Ga0207668_10192863
776 Ga0207640_10001184
777 Ga0207640_10028496
778 Ga0207640_10029023
779 Ga0207658_10149494
780 Ga0207677_10036402
781 Ga0207677_10172520
782 Ga0207677_10183692
783 Ga0207703_10067812
784 Ga0207703_10088906
785 Ga0207703_10156586
786 Ga0207678_10027292
787 Ga0207708_10003693
788 Ga0207708_10032219
789 Ga0207641_10063297
790 Ga0207641_10107861
791 Ga0207648_10017009
792 Ga0207648_10041242
793 Ga0207648_10078692
794 Ga0207648_10083764
795 Ga0207648_10114164
796 Ga0207676_10021942
797 Ga0207675_100004573
798 Ga0207675_100036702
799 Ga0207675_100040892
800 Ga0207675_100086851
801 Ga0207675_100267713
802 Ga0207683_10077910
803 Ga0207683_10141006
804 Ga0209983_1007563
805 Ga0209971_1007393
806 Ga0207428_10000002
807 Ga0207428_10016482
808 Ga0207428_10028884
809 Ga0268266_10005118
810 Ga0268266_10350447
811 Ga0268266_10798809
812 Ga0268265_10000315
813 Ga0268265_10014972
814 Ga0268265_10025473
815 Ga0268265_10097610
816 Ga0268265_10116673
817 Ga0268265_10261491
818 Ga0268264_10050010
819 Ga0268264_10051074
820 Ga0268264_10281486
821 Ga0307408_100027719
822 Ga0265314_10058390
823 Ga0307416_100070551
824 Ga0307416_100369766
825 Ga0307415_100024908
826 Ga0373948_0001206
827 Ga0373958_0004597
828 Ga0373938_0001662
829 Ga0373926_0088402
830 Ga0373929_0000663
831 Ga0373940_0001959
832 Ga0373944_0074878
833 Ga0373949_0002150
834 Ga0373951_0000754
835 Ga0373952_0000302
836 Ga0373923_0038993
837 Ga0373932_0012217
838 Ga0373939_0002036
839 Ga0373939_0017875
840 Ga0373941_0001621
841 Ga0373953_0128332
842 Ga0373943_0005796
843 Ga0373946_0008087
844 Ga0373955_0030745
845 Ga0373955_0231679
846 Ga0373942_0000284
847 Ga0373961_0000364
848 Ga0373962_0023541
849 Ga0373931_0050267
850 Ga0373931_0165584
851 Ga0373935_0029568
852 Ga0373935_0033928
853 Ga0373927_0116204
854 Ga0373947_0006634
855 Ga0373937_0395541
856 Ga0373925_0009186
857 Ga0373925_0055419
858 Ga0451849_0160923
859 Ga0450921_001204
860 Ga0451577_0062732
861 Ga0466963_0039122
862 Ga0453684_0144098
863 Ga0451576_0005014
864 Ga0466967_0271728
865 Ga0495592_0072476
866 Ga0495629_0025099
867 Ga0495629_0103052
868 Ga0495580_0045080
869 Ga0495582_0017467
870 Ga0495582_0125529
871 Ga0495639_0001920
872 Ga0495585_0156760
873 Ga0495594_0071087
874 Ga0495608_0035263
875 Ga0495628_0077312
876 Ga0495630_0001943
877 Ga0495587_0128325
878 Ga0495645_0003879
879 Ga0495645_0116158
880 Ga0495622_0008970
881 Ga0495633_0064217
882 Ga0495667_0154896
883 Ga0495634_0243096
884 Ga0495635_0066993
885 Ga0495647_0025299
886 Ga0495658_0011622
887 Ga0495658_0030083
888 Ga0495658_0054719
889 Ga0495613_0005250
890 Ga0495613_0192651
891 Ga0495613_0229391
892 Ga0495581_0004997
893 Ga0495674_0034999
894 Ga0495676_0008166
895 Ga0495680_0079617
896 Ga0495675_0237963
897 Ga0495684_0000174
898 Ga0495684_0015904
899 Ga0496102_0462778
900 Ga0496106_0098370
901 Ga0496106_0166817
902 Ga0496108_0076993
903 Ga0496109_0116200
904 Ga0496109_0185569
905 Ga0496112_0033032
906 Ga0496112_0189183
907 Ga0496112_0217688
908 Ga0496114_0000105
909 Ga0496114_0096570
910 Ga0496114_0401097
911 Ga0496114_0469853
912 Ga0501036_0145280
913 Ga0501036_0384821
914 Ga0501038_0037889
915 Ga0501039_0006038
916 Ga0501039_0023078
917 Ga0501040_0030184
918 Ga0501040_0136281
919 Ga0501041_0026882
920 Ga0501042_0010107
921 Ga0501042_0016995
922 Ga0501042_0030305
923 Ga0501043_0168068
924 Ga0501048_0013092
925 Ga0501048_0040451
926 Ga0501048_0195421
927 Ga0501067_0013705
928 Ga0501068_0104107
929 Ga0501070_0384357
930 Ga0501072_0024017
931 Ga0501072_0111023
932 Ga0501073_0159089
933 Ga0501073_0289461
934 Ga0501074_0091234
935 Ga0501075_0009227
936 Ga0501075_0130384
937 Ga0501076_0013912
938 Ga0501077_0000162
939 Ga0501077_0028214
940 Ga0501077_0122023
941 Ga0501079_0005806
942 Ga0501079_0049794
943 Ga0501080_0027202
944 Ga0501080_0065597
945 Ga0501080_0168084
946 Ga0501081_0046305
947 Ga0501045_0061427
948 nmdc:mga0k408_36528_c1
949 nmdc:mga06z11_8914_c1
950 nmdc:mga05p37_1036_c1
951 nmdc:mga05p37_10839_c1
952 nmdc:mga05p37_124475_c1
953 nmdc:mga05p37_134595_c1
954 nmdc:mga05p37_154075_c1
955 nmdc:mga05p37_160277_c1
956 nmdc:mga05p37_166011_c1
957 nmdc:mga05p37_404068_c1
958 nmdc:mga05p37_4703_c1
959 nmdc:mga05p37_59539_c1
960 nmdc:mga05p37_78972_c1
961 nmdc:mga09592_55360_c1
962 nmdc:mga0qj67_252244_c1
963 nmdc:mga06r32_26256_c1
964 nmdc:mga06r32_5663_c1
965 nmdc:mga06r32_64117_c1
966 nmdc:mga08y16_306479_c1
967 nmdc:mga08y16_31309_c1
968 nmdc:mga08y16_32739_c1
969 nmdc:mga08y16_3591_c1
970 nmdc:mga08y16_3_c1
971 nmdc:mga08y16_4269_c1
972 nmdc:mga08y16_45157_c1
973 nmdc:mga08y16_556585_c1
974 nmdc:mga0n895_16719_c1
975 nmdc:mga0n895_25323_c1
976 nmdc:mga0n895_3220_c2
977 nmdc:mga0n895_4659_c1
978 nmdc:mga0n895_51341_c1
979 nmdc:mga0rr50_114_c1
980 nmdc:mga0rr50_136962_c1
981 nmdc:mga0rr50_504_c1
982 nmdc:mga08x19_135828_c1
983 nmdc:mga08x19_233425_c1
984 nmdc:mga08x19_271_c1
985 nmdc:mga08x19_27869_c1
986 nmdc:mga08x19_35403_c1
987 nmdc:mga0a205_13438_c1
988 nmdc:mga0a205_274997_c1
989 nmdc:mga0a205_48666_c1
990 Ga0495601_0003027
991 Ga0495601_0014872
992 Ga0495601_0026903
993 Ga0495601_0038671
994 Ga0495595_0030475
995 Ga0495595_0073027
996 Ga0495595_0091494
997 Ga0495619_0009731
998 Ga0495619_0015238
999 Ga0495619_0073958
1000 Ga0500555_000424
1001 Ga0500616_0000167
1002 Ga0500645_000331
1003 Ga0501084_0042637
1004 Ga0501082_0000116
1005 Ga0501082_0206221
1006 Ga0501082_0394372
1007 Ga0530510_0010960
1008 Ga0530510_0041213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

63

195

0.97

PF00571

CBS

CBS domain

290

342

0.93

PF00571

CBS

CBS domain

223

281

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9852 4 174
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9629 4 174
3k2v-assembly1.cif.gz_B structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. 0.9521 188 316
4o9k-assembly1.cif.gz_B crystal structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from methylococcus capsulatus in complex with cmp-kdo 0.95 193 322
3fna-assembly3.cif.gz_B-2 crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.948 190 316
ID Description Score Start End Superfamily
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9701 193 318 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9627 4 191 3.40.50.10490
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9591 193 318 3.10.580.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9473 193 318 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.943 4 191 3.40.50.10490
ID Description Score Start End GO Terms
AF-K1Z903-F1-model_v4 SIS domain-containing protein 0.9972 5 140 GO:0097367
GO:1901135
AF-A0A656SJ60-F1-model_v4 deleted 0.9859 36 117
AF-A0A259R762-F1-model_v4 deleted 0.9835 5 134
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9828 14 159 GO:0097367
GO:1901135
AF-A0A7C1G239-F1-model_v4 SIS domain-containing protein 0.9667 1 106 GO:0097367
GO:1901135

Map