F456160

General Info

Members Datasets Scaffolds Average Seq Length
504 247 1008 190

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10170922|Ga0081455_101709222
Length 226
Sequence VRVRGDFVRAHVRVLSDLQGHCLRLTCTRFAGTLGRMSQLDAIGGDVEAALEDINVPSYVIDPHGVIRWVNTAARNIVGDVRGKQFSSIVSPEDRRRAREVFAQKISGTAAVTDAEFVLVGKNGDRVLVDVSSVPLLRGDQVIGVFGQAFYEEEIEAPNAHPALTPRQTEVLHMLEKGLSTKQIADELHLSRETVRNHVRHLLHALGAKSRLEAVAVARRDYYVSG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 14.48
Rhizosphere 84.33
Stem 0
Stem Tuber 0
Unclassified 19.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10170922 3300005937 Bacteria 1656
2 JGI24744J21845_10010127 3300002077 Archaea 1933
3 Ga0070683_100006649 3300005329 Bacteria 9710
4 Ga0070683_100104060 3300005329 Unclassified 2675
5 Ga0070683_100146043 3300005329 Unclassified 2241
6 Ga0068869_100470129 3300005334 Bacteria 1045
7 Ga0070680_100154740 3300005336 Archaea 1926
8 Ga0068868_100073054 3300005338 Bacteria 2738
9 Ga0068868_100109842 3300005338 Bacteria 2240
10 Ga0068868_100221452 3300005338 Unclassified 1584
11 Ga0070689_100011134 3300005340 Bacteria 6436
12 Ga0070687_100043091 3300005343 Archaea 2291
13 Ga0070668_100396752 3300005347 Unclassified 1177
14 Ga0070669_100157713 3300005353 Archaea 1761
15 Ga0070669_100550437 3300005353 Bacteria 962
16 Ga0070671_100026242 3300005355 Bacteria 4787
17 Ga0070671_100451155 3300005355 Unclassified 1103
18 Ga0070673_100211078 3300005364 Unclassified 1677
19 Ga0070688_100165158 3300005365 Archaea 1524
20 Ga0070688_100248121 3300005365 Unclassified 1266
21 Ga0070714_100014140 3300005435 Bacteria 6408
22 Ga0070714_100358764 3300005435 Bacteria 1370
23 Ga0070713_100444738 3300005436 Bacteria 1216
24 Ga0070710_10002680 3300005437 Bacteria 8461
25 Ga0070710_10033839 3300005437 Bacteria 2777
26 Ga0070710_10379494 3300005437 Bacteria 942
27 Ga0070711_100011924 3300005439 Bacteria 5410
28 Ga0070711_100139652 3300005439 Archaea 1815
29 Ga0070700_100000417 3300005441 Bacteria 21796
30 Ga0070700_100129756 3300005441 Bacteria 1700
31 Ga0070694_100010474 3300005444 Bacteria 5722
32 Ga0070694_100099188 3300005444 Bacteria 2058
33 Ga0070678_100004501 3300005456 Bacteria 7910
34 Ga0070662_100647362 3300005457 Bacteria 891
35 Ga0070681_11034465 3300005458 Unclassified 741
36 Ga0068867_100880293 3300005459 Unclassified 804
37 Ga0070685_10028858 3300005466 Archaea 3078
38 Ga0070707_100001869 3300005468 Bacteria 20252
39 Ga0070698_100359764 3300005471 Bacteria 1387
40 Ga0070679_100026369 3300005530 Bacteria 5709
41 Ga0070684_100006178 3300005535 Bacteria 9240
42 Ga0070684_100160435 3300005535 Bacteria 2040
43 Ga0070684_100302660 3300005535 Unclassified 1467
44 Ga0070684_100412251 3300005535 Unclassified 1246
45 Ga0068853_100004140 3300005539 Bacteria 11179
46 Ga0070672_101140885 3300005543 Unclassified 693
47 Ga0070686_100099753 3300005544 Archaea 1959
48 Ga0070686_100353839 3300005544 Unclassified 1104
49 Ga0070695_100209617 3300005545 Unclassified 1398
50 Ga0070696_100048722 3300005546 Archaea 2941
51 Ga0070693_100020893 3300005547 Bacteria 3461
52 Ga0070693_100141471 3300005547 Archaea 1515
53 Ga0070665_100037704 3300005548 Bacteria 4859
54 Ga0070665_101115558 3300005548 Unclassified 800
55 Ga0070704_100085856 3300005549 Archaea 2330
56 Ga0070704_100349509 3300005549 Bacteria 1248
57 Ga0070704_100400303 3300005549 Unclassified 1171
58 Ga0068855_100071723 3300005563 Bacteria 4027
59 Ga0068857_100028215 3300005577 Bacteria 4952
60 Ga0068857_100125609 3300005577 Bacteria 2311
61 Ga0068857_100511379 3300005577 Unclassified 1128
62 Ga0068857_100665975 3300005577 Unclassified 987
63 Ga0068857_100705945 3300005577 Bacteria 958
64 Ga0068856_100013744 3300005614 Bacteria 7828
65 Ga0068856_100088003 3300005614 Bacteria 3088
66 Ga0068856_100450269 3300005614 Bacteria 1308
67 Ga0068856_100479721 3300005614 Bacteria 1264
68 Ga0068852_100009100 3300005616 Bacteria 7351
69 Ga0068859_100156873 3300005617 Bacteria 2354
70 Ga0068864_100163773 3300005618 Unclassified 2023
71 Ga0068866_10011156 3300005718 Archaea 3876
72 Ga0068866_10437778 3300005718 Unclassified 852
73 Ga0068861_100120245 3300005719 Bacteria 2118
74 Ga0068861_100264580 3300005719 Archaea 1474
75 Ga0081455_10003312 3300005937 Bacteria 18633
76 Ga0081455_10014086 3300005937 Bacteria 7859
77 Ga0081455_10023806 3300005937 Bacteria 5689
78 Ga0081455_10031241 3300005937 Bacteria 4822
79 Ga0081538_10030805 3300005981 Bacteria 3633
80 Ga0081538_10160913 3300005981 Bacteria 998
81 Ga0081540_1001091 3300005983 Bacteria 24073
82 Ga0081540_1002114 3300005983 Bacteria 16550
83 Ga0070717_10020676 3300006028 Bacteria 5181
84 Ga0070717_10107284 3300006028 Unclassified 2378
85 Ga0075365_10158599 3300006038 Bacteria 1576
86 Ga0075365_10201525 3300006038 Unclassified 1394
87 Ga0075432_10003179 3300006058 Bacteria 5538
88 Ga0070715_10143377 3300006163 Unclassified 1163
89 Ga0070716_100054682 3300006173 Archaea 2281
90 Ga0070712_100009760 3300006175 Bacteria 6049
91 Ga0070712_100013467 3300006175 Bacteria 5227
92 Ga0070712_100153037 3300006175 Bacteria 1773
93 Ga0068871_100008081 3300006358 Bacteria 7554
94 Ga0068871_100258254 3300006358 Bacteria 1519
95 Ga0068871_100751734 3300006358 Unclassified 896
96 Ga0075428_100308269 3300006844 Unclassified 1702
97 Ga0075428_100332674 3300006844 Bacteria 1631
98 Ga0075430_100127513 3300006846 Unclassified 2121
99 Ga0075433_10039459 3300006852 Bacteria 4083
100 Ga0075433_10255265 3300006852 Unclassified 1555
101 Ga0075434_100153050 3300006871 Bacteria 2326
102 Ga0068865_100005655 3300006881 Bacteria 7590
103 Ga0075436_100017495 3300006914 Bacteria 4908
104 Ga0075436_100106214 3300006914 Unclassified 1958
105 Ga0097620_100156879 3300006931 Bacteria 2354
106 Ga0075435_100005982 3300007076 Bacteria 8562
107 Ga0075435_100172081 3300007076 Unclassified 1827
108 Ga0075435_100195712 3300007076 Bacteria 1712
109 Ga0105240_10725792 3300009093 Bacteria 1082
110 Ga0111539_10281361 3300009094 Bacteria 1936
111 Ga0111539_10312091 3300009094 Unclassified 1830
112 Ga0111539_10677804 3300009094 Bacteria 1200
113 Ga0111539_10911807 3300009094 Unclassified 1022
114 Ga0105245_10022177 3300009098 Bacteria 5575
115 Ga0105245_10026644 3300009098 Bacteria 5089
116 Ga0105245_10327529 3300009098 Bacteria 1511
117 Ga0105247_10049997 3300009101 Archaea 2572
118 Ga0114129_10220280 3300009147 Bacteria 2560
119 Ga0114129_10594506 3300009147 Bacteria 1434
120 Ga0114129_10845266 3300009147 Bacteria 1164
121 Ga0114129_10851174 3300009147 Bacteria 1159
122 Ga0114129_10996404 3300009147 Bacteria 1055
123 Ga0105243_10013324 3300009148 Bacteria 6218
124 Ga0105243_10102594 3300009148 Bacteria 2377
125 Ga0105243_10387152 3300009148 Bacteria 1295
126 Ga0105243_10585924 3300009148 Bacteria 1071
127 Ga0105241_10168348 3300009174 Bacteria 1808
128 Ga0105242_10002666 3300009176 Bacteria 13986
129 Ga0105242_10183381 3300009176 Bacteria 1848
130 Ga0105242_10424006 3300009176 Bacteria 1247
131 Ga0105248_10225898 3300009177 Bacteria 2107
132 Ga0105237_10191817 3300009545 Archaea 2043
133 Ga0105238_10087937 3300009551 Bacteria 3094
134 Ga0105249_10006664 3300009553 Bacteria 10054
135 Ga0105249_10904529 3300009553 Bacteria 950
136 Ga0105239_10064242 3300010375 Bacteria 4029
137 Ga0105246_10009651 3300011119 Bacteria 5947
138 Ga0157369_10315281 3300013105 Archaea 1626
139 Ga0157374_10126975 3300013296 Archaea 2466
140 Ga0157374_10532000 3300013296 Unclassified 1182
141 Ga0157378_10013330 3300013297 Bacteria 7184
142 Ga0163162_10001287 3300013306 Bacteria 23443
143 Ga0157372_10900484 3300013307 Unclassified 1026
144 Ga0157375_10006871 3300013308 Bacteria 9924
145 Ga0157375_10057377 3300013308 Bacteria 3849
146 Ga0157375_10356599 3300013308 Bacteria 1628
147 Ga0163163_10186074 3300014325 Unclassified 2125
148 Ga0163163_10507839 3300014325 Unclassified 1267
149 Ga0163163_10620905 3300014325 Bacteria 1144
150 Ga0157380_10000973 3300014326 Bacteria 18149
151 Ga0157377_10226481 3300014745 Unclassified 1200
152 Ga0157377_10251451 3300014745 Unclassified 1146
153 Ga0157376_10030667 3300014969 Bacteria 4297
154 Ga0157376_10081225 3300014969 Unclassified 2783
155 Ga0157376_10511110 3300014969 Bacteria 1182
156 Ga0207692_10014190 3300025898 Bacteria 3476
157 Ga0207692_10016314 3300025898 Archaea 3286
158 Ga0207647_10165673 3300025904 Bacteria 1288
159 Ga0207685_10110605 3300025905 Bacteria 1190
160 Ga0207685_10195584 3300025905 Archaea 947
161 Ga0207699_10122995 3300025906 Bacteria 1681
162 Ga0207693_10001122 3300025915 Bacteria 24030
163 Ga0207693_10002743 3300025915 Bacteria 15254
164 Ga0207693_10809773 3300025915 Bacteria 722
165 Ga0207663_10018270 3300025916 Unclassified 3926
166 Ga0207663_10242553 3300025916 Bacteria 1322
167 Ga0207657_10006374 3300025919 Bacteria 12256
168 Ga0207652_10185945 3300025921 Archaea 1868
169 Ga0207646_10000129 3300025922 Bacteria 102411
170 Ga0207646_10233968 3300025922 Unclassified 1660
171 Ga0207687_10167253 3300025927 Archaea 1693
172 Ga0207687_10171607 3300025927 Unclassified 1673
173 Ga0207700_10636254 3300025928 Unclassified 951
174 Ga0207664_10631228 3300025929 Archaea 962
175 Ga0207644_10722071 3300025931 Unclassified 831
176 Ga0207690_10256338 3300025932 Archaea 1353
177 Ga0207686_10654979 3300025934 Bacteria 831
178 Ga0207709_10013314 3300025935 Bacteria 4538
179 Ga0207709_10204444 3300025935 Unclassified 1413
180 Ga0207670_10419436 3300025936 Archaea 1073
181 Ga0207669_10412415 3300025937 Bacteria 1061
182 Ga0207704_10060458 3300025938 Archaea 2344
183 Ga0207665_10014242 3300025939 Bacteria 5234
184 Ga0207691_10180427 3300025940 Unclassified 1845
185 Ga0207711_10471870 3300025941 Bacteria 1169
186 Ga0207689_10278561 3300025942 Unclassified 1385
187 Ga0207661_10019871 3300025944 Bacteria 5012
188 Ga0207661_10068126 3300025944 Unclassified 2897
189 Ga0207661_10112723 3300025944 Unclassified 2303
190 Ga0207712_10191696 3300025961 Bacteria 1614
191 Ga0207668_10024861 3300025972 Bacteria 3871
192 Ga0207668_10350206 3300025972 Unclassified 1235
193 Ga0207677_10033037 3300026023 Bacteria 3332
194 Ga0207639_10281526 3300026041 Archaea 1462
195 Ga0207708_10000580 3300026075 Bacteria 28286
196 Ga0207708_10149744 3300026075 Unclassified 1836
197 Ga0207702_10026508 3300026078 Bacteria 4811
198 Ga0207702_10032578 3300026078 Bacteria 4349
199 Ga0207702_10397898 3300026078 Bacteria 1328
200 Ga0207702_10544442 3300026078 Bacteria 1135
201 Ga0207702_10693668 3300026078 Bacteria 1003
202 Ga0207648_10001312 3300026089 Bacteria 27662
203 Ga0207648_10308872 3300026089 Bacteria 1419
204 Ga0207676_10189124 3300026095 Unclassified 1810
205 Ga0207674_10008326 3300026116 Bacteria 11996
206 Ga0207674_10219910 3300026116 Bacteria 1847
207 Ga0207674_10232418 3300026116 Bacteria 1792
208 Ga0207675_100094317 3300026118 Bacteria 2815
209 Ga0207675_100132349 3300026118 Bacteria 2365
210 Ga0207675_100152793 3300026118 Archaea 2198
211 Ga0207683_10000753 3300026121 Bacteria 29409
212 Ga0207698_10039097 3300026142 Bacteria 3511
213 Ga0209998_10013942 3300027717 Bacteria 1676
214 Ga0207428_10003189 3300027907 Bacteria 16058
215 Ga0207428_10141381 3300027907 Unclassified 1837
216 Ga0207428_10657602 3300027907 Unclassified 752
217 Ga0307405_10233189 3300031731 Bacteria 1358
218 Ga0307413_10777951 3300031824 Bacteria 802
219 Ga0307410_10102205 3300031852 Bacteria 2056
220 Ga0307406_10264357 3300031901 Bacteria 1303
221 Ga0307409_100010991 3300031995 Bacteria 5673
222 Ga0307409_100012132 3300031995 Bacteria 5475
223 Ga0307415_100533548 3300032126 Bacteria 1032
224 Ga0373949_0082029 3300035090 Unclassified 861
225 Ga0373932_0086435 3300035112 Bacteria 999
226 Ga0373953_0091241 3300035117 Bacteria 1275
227 Ga0373931_0040759 3300035691 Unclassified 2438
228 Ga0373947_0001195 3300035725 Bacteria 15977
229 Ga0395899_0006793 3300037312 Bacteria 8867
230 Ga0395899_0009079 3300037312 Bacteria 7638
231 Ga0395899_0027644 3300037312 Bacteria 4274
232 Ga0395899_0033898 3300037312 Unclassified 3834
233 Ga0395899_0056381 3300037312 Bacteria 2904
234 Ga0395899_0060288 3300037312 Bacteria 2795
235 Ga0395899_0089559 3300037312 Bacteria 2232
236 Ga0395900_0003423 3300037418 Bacteria 17147
237 Ga0395900_0003445 3300037418 Bacteria 17109
238 Ga0395900_0011765 3300037418 Bacteria 8948
239 Ga0395900_0011883 3300037418 Bacteria 8901
240 Ga0395900_0018193 3300037418 Bacteria 7168
241 Ga0395900_0129460 3300037418 Unclassified 2587
242 Ga0395900_0231475 3300037418 Bacteria 1858
243 Ga0395898_0001871 3300037466 Bacteria 26916
244 Ga0395898_0007369 3300037466 Bacteria 11674
245 Ga0395898_0010211 3300037466 Bacteria 9831
246 Ga0395898_0016052 3300037466 Bacteria 7671
247 Ga0395898_0153356 3300037466 Bacteria 2204
248 Ga0395898_0161772 3300037466 Bacteria 2141
249 Ga0395898_0195646 3300037466 Bacteria 1931
250 Ga0395898_0391852 3300037466 Bacteria 1324
251 Ga0395898_0417225 3300037466 Unclassified 1279
252 Ga0395898_0869217 3300037466 Unclassified 840
253 Ga0395898_1147011 3300037466 Bacteria 709
254 Ga0395905_0004041 3300037471 Bacteria 15395
255 Ga0395905_0004523 3300037471 Bacteria 14404
256 Ga0395905_0015937 3300037471 Bacteria 7142
257 Ga0395905_0047039 3300037471 Bacteria 4045
258 Ga0395905_0047503 3300037471 Bacteria 4023
259 Ga0395905_0285095 3300037471 Bacteria 1538
260 Ga0395905_0466422 3300037471 Unclassified 1161
261 Ga0395905_1015534 3300037471 Unclassified 732
262 Ga0395901_0003237 3300038443 Bacteria 16376
263 Ga0395901_0027482 3300038443 Bacteria 5846
264 Ga0395901_0031831 3300038443 Bacteria 5438
265 Ga0395901_0040568 3300038443 Bacteria 4822
266 Ga0395901_0069468 3300038443 Bacteria 3668
267 Ga0395901_0150754 3300038443 Bacteria 2443
268 Ga0395901_0395502 3300038443 Unclassified 1420
269 Ga0395901_0590958 3300038443 Bacteria 1120
270 Ga0395901_0747307 3300038443 Unclassified 971
271 Ga0451849_1554668 3300041505 Unclassified 802
272 Ga0451853_3484262 3300041512 Bacteria 1210
273 Ga0439448_0001886 3300042005 Bacteria 5576
274 Ga0439448_0096612 3300042005 Bacteria 1001
275 Ga0439455_0068994 3300042012 Unclassified 947
276 Ga0439458_0002917 3300042157 Bacteria 4107
277 Ga0439458_0003118 3300042157 Bacteria 3941
278 Ga0439459_0024336 3300042438 Bacteria 1187
279 Ga0439460_0030731 3300042461 Bacteria 1529
280 Ga0451576_0459488 3300045051 Bacteria 1337
281 Ga0466967_0045309 3300045976 Bacteria 3821
282 Ga0495592_0094199 3300046454 Bacteria 2144
283 Ga0495603_0040908 3300046455 Bacteria 2773
284 Ga0495603_0059544 3300046455 Bacteria 2258
285 Ga0495603_0150904 3300046455 Unclassified 1350
286 Ga0495629_0059428 3300046459 Bacteria 2672
287 Ga0495641_0056006 3300046461 Bacteria 1788
288 Ga0495641_0197682 3300046461 Bacteria 901
289 Ga0495651_0243544 3300046462 Bacteria 1232
290 Ga0495651_0321397 3300046462 Unclassified 1032
291 Ga0495582_0025681 3300046473 Bacteria 3226
292 Ga0495582_0252780 3300046473 Bacteria 1011
293 Ga0495582_0370735 3300046473 Unclassified 825
294 Ga0495639_0321852 3300046475 Bacteria 773
295 Ga0495662_0195401 3300046476 Unclassified 997
296 Ga0495664_0116305 3300046477 Bacteria 1616
297 Ga0495664_0228050 3300046477 Bacteria 1127
298 Ga0495584_0026451 3300046491 Bacteria 2939
299 Ga0495584_0086241 3300046491 Bacteria 1582
300 Ga0495584_0090968 3300046491 Bacteria 1539
301 Ga0495585_0242622 3300046492 Bacteria 902
302 Ga0495594_0100997 3300046499 Bacteria 1623
303 Ga0495616_0048914 3300046513 Unclassified 2122
304 Ga0495620_0106834 3300046515 Archaea 1112
305 Ga0495628_0132305 3300046516 Bacteria 1907
306 Ga0495628_0309818 3300046516 Bacteria 1167
307 Ga0495637_0034906 3300046520 Bacteria 2200
308 Ga0495637_0088470 3300046520 Bacteria 1225
309 Ga0495637_0228204 3300046520 Bacteria 676
310 Ga0495663_0065505 3300046525 Bacteria 1148
311 Ga0495663_0078806 3300046525 Bacteria 1058
312 Ga0495642_0139601 3300046528 Bacteria 1046
313 Ga0495642_0158688 3300046528 Unclassified 980
314 Ga0495642_0219127 3300046528 Unclassified 831
315 Ga0495652_0453650 3300046529 Bacteria 897
316 Ga0495665_0027989 3300046531 Bacteria 3025
317 Ga0495665_0201779 3300046531 Unclassified 1031
318 Ga0495586_0034659 3300046535 Bacteria 2711
319 Ga0495609_0144755 3300046538 Bacteria 1013
320 Ga0495609_0290068 3300046538 Unclassified 668
321 Ga0495645_0017163 3300046543 Bacteria 5185
322 Ga0495633_0252384 3300046558 Bacteria 805
323 Ga0495667_0049704 3300046559 Unclassified 2768
324 Ga0495656_0023224 3300046615 Unclassified 2439
325 Ga0495656_0037685 3300046615 Bacteria 1999
326 Ga0495668_0040711 3300046616 Bacteria 2591
327 Ga0495635_0126000 3300046663 Bacteria 1747
328 Ga0495659_0065483 3300046664 Bacteria 1352
329 Ga0495659_0082407 3300046664 Bacteria 1223
330 Ga0495659_0095416 3300046664 Bacteria 1146
331 Ga0495657_0017999 3300046675 Bacteria 5121
332 Ga0495657_0097432 3300046675 Bacteria 1878
333 Ga0495599_0081641 3300046678 Bacteria 2019
334 Ga0495647_0043101 3300046681 Bacteria 1725
335 Ga0495658_0006787 3300046683 Bacteria 5635
336 Ga0495613_0147338 3300046689 Bacteria 1680
337 Ga0495624_0059929 3300046690 Bacteria 2387
338 Ga0495624_0154666 3300046690 Unclassified 1402
339 Ga0495670_0208852 3300046691 Bacteria 1035
340 Ga0495589_0123492 3300046794 Bacteria 1246
341 Ga0495589_0148800 3300046794 Bacteria 1119
342 Ga0495589_0176062 3300046794 Bacteria 1016
343 Ga0495581_0001921 3300047315 Bacteria 11653
344 Ga0495581_0016609 3300047315 Bacteria 4278
345 Ga0495604_0098691 3300047317 Bacteria 2151
346 Ga0495636_0124998 3300047318 Unclassified 1141
347 Ga0495636_0268215 3300047318 Unclassified 793
348 Ga0495636_0402924 3300047318 Bacteria 652
349 Ga0495674_0014091 3300047319 Bacteria 7492
350 Ga0495674_0477763 3300047319 Bacteria 999
351 Ga0495674_0507217 3300047319 Bacteria 964
352 Ga0495676_0019160 3300047321 Bacteria 6021
353 Ga0495676_0074411 3300047321 Bacteria 2601
354 Ga0495676_0134878 3300047321 Bacteria 1777
355 Ga0495676_0287836 3300047321 Unclassified 1111
356 Ga0495676_0458921 3300047321 Bacteria 840
357 Ga0495676_0612246 3300047321 Unclassified 709
358 Ga0495680_0009806 3300047322 Bacteria 8589
359 Ga0495680_0022908 3300047322 Bacteria 5201
360 Ga0495683_0084448 3300047323 Bacteria 1545
361 Ga0495684_0227686 3300047471 Bacteria 1364
362 Ga0495602_0138337 3300048088 Bacteria 1931
363 Ga0496100_0003885 3300048903 Bacteria 7842
364 Ga0496100_0004877 3300048903 Bacteria 7170
365 Ga0496100_0135530 3300048903 Unclassified 1739
366 Ga0496101_0002705 3300048904 Bacteria 10876
367 Ga0496101_0020322 3300048904 Bacteria 4542
368 Ga0496101_0120352 3300048904 Bacteria 1984
369 Ga0496102_0008943 3300048905 Bacteria 8595
370 Ga0496103_0027426 3300048906 Archaea 3451
371 Ga0496103_0075696 3300048906 Bacteria 2111
372 Ga0496104_0011664 3300048907 Bacteria 7878
373 Ga0496104_0015038 3300048907 Bacteria 7002
374 Ga0496104_0149548 3300048907 Bacteria 2242
375 Ga0496104_0260709 3300048907 Unclassified 1646
376 Ga0496105_0005816 3300048908 Bacteria 9408
377 Ga0496105_0052016 3300048908 Bacteria 3382
378 Ga0496105_0053916 3300048908 Bacteria 3321
379 Ga0496105_0109059 3300048908 Unclassified 2285
380 Ga0496105_0392116 3300048908 Archaea 1103
381 Ga0496105_0491500 3300048908 Bacteria 964
382 Ga0496106_0009053 3300048909 Bacteria 7360
383 Ga0496106_0013090 3300048909 Bacteria 6123
384 Ga0496106_0028269 3300048909 Bacteria 4176
385 Ga0496106_0036178 3300048909 Archaea 3693
386 Ga0496107_0004163 3300048910 Bacteria 9763
387 Ga0496107_0009627 3300048910 Bacteria 6703
388 Ga0496107_0041334 3300048910 Bacteria 3310
389 Ga0496107_0192870 3300048910 Bacteria 1514
390 Ga0496108_0001267 3300048911 Bacteria 19765
391 Ga0496108_0045585 3300048911 Unclassified 3662
392 Ga0496108_0059577 3300048911 Unclassified 3210
393 Ga0496108_0069366 3300048911 Bacteria 2974
394 Ga0496108_0079690 3300048911 Bacteria 2773
395 Ga0496108_0297806 3300048911 Bacteria 1405
396 Ga0496109_0000974 3300048912 Bacteria 23675
397 Ga0496109_0007115 3300048912 Bacteria 9450
398 Ga0496109_0014750 3300048912 Bacteria 6798
399 Ga0496109_0017155 3300048912 Bacteria 6339
400 Ga0496109_0065036 3300048912 Bacteria 3339
401 Ga0496109_0097789 3300048912 Bacteria 2721
402 Ga0496109_0121343 3300048912 Bacteria 2435
403 Ga0496109_0150028 3300048912 Bacteria 2182
404 Ga0496109_0184504 3300048912 Bacteria 1960
405 Ga0496109_0221790 3300048912 Unclassified 1778
406 Ga0496109_0310074 3300048912 Bacteria 1489
407 Ga0496110_0001708 3300048913 Bacteria 16160
408 Ga0496110_0088618 3300048913 Bacteria 2764
409 Ga0496110_0111058 3300048913 Bacteria 2464
410 Ga0496110_0167476 3300048913 Bacteria 1993
411 Ga0496110_0591872 3300048913 Bacteria 1007
412 Ga0496110_0668913 3300048913 Bacteria 939
413 Ga0496111_0002021 3300048914 Bacteria 12073
414 Ga0496111_0002525 3300048914 Bacteria 11038
415 Ga0496111_0064418 3300048914 Bacteria 2659
416 Ga0496111_0190570 3300048914 Bacteria 1524
417 Ga0496111_0237012 3300048914 Bacteria 1355
418 Ga0496111_0568746 3300048914 Bacteria 831
419 Ga0496112_0082357 3300048915 Bacteria 3182
420 Ga0496112_0238323 3300048915 Archaea 1772
421 Ga0496112_0244426 3300048915 Unclassified 1747
422 Ga0496113_0122797 3300048916 Unclassified 2032
423 Ga0496113_0177602 3300048916 Bacteria 1687
424 Ga0496113_0212595 3300048916 Archaea 1540
425 Ga0496114_0008538 3300048917 Bacteria 8119
426 Ga0496114_0015740 3300048917 Bacteria 6086
427 Ga0496114_0077125 3300048917 Bacteria 2809
428 Ga0496114_0121838 3300048917 Unclassified 2243
429 Ga0496114_0287438 3300048917 Bacteria 1450
430 Ga0496114_0470139 3300048917 Unclassified 1113
431 Ga0496114_0839023 3300048917 Bacteria 799
432 Ga0496115_0087286 3300048918 Bacteria 2545
433 Ga0496115_0103743 3300048918 Bacteria 2333
434 Ga0496115_0396209 3300048918 Bacteria 1121
435 Ga0496115_0686240 3300048918 Bacteria 806
436 Ga0501031_0010048 3300049568 Bacteria 6166
437 Ga0501036_0012352 3300049572 Bacteria 7072
438 Ga0501038_0006012 3300049574 Bacteria 11228
439 Ga0501038_0026259 3300049574 Bacteria 5188
440 Ga0501039_0005413 3300049575 Bacteria 9655
441 Ga0501039_0017225 3300049575 Bacteria 5542
442 Ga0501040_0010172 3300049576 Bacteria 6150
443 Ga0501040_0020431 3300049576 Bacteria 4412
444 Ga0501041_0028631 3300049577 Bacteria 3360
445 Ga0501042_0031968 3300049578 Bacteria 3724
446 Ga0501042_0055547 3300049578 Bacteria 2826
447 Ga0501043_0121239 3300049579 Bacteria 2051
448 Ga0501046_0016986 3300049580 Bacteria 6086
449 Ga0501046_0045720 3300049580 Bacteria 3477
450 Ga0501048_0007659 3300049582 Bacteria 8186
451 Ga0501068_0049261 3300049584 Bacteria 2544
452 Ga0501068_0049347 3300049584 Bacteria 2542
453 Ga0501069_0034580 3300049585 Bacteria 2783
454 Ga0501071_0019587 3300049587 Bacteria 4696
455 Ga0501071_0087968 3300049587 Bacteria 2279
456 Ga0501072_0000804 3300049588 Bacteria 23097
457 Ga0501072_0006266 3300049588 Bacteria 9065
458 Ga0501074_0050937 3300049590 Bacteria 2988
459 Ga0501076_0000707 3300049592 Bacteria 21502
460 Ga0501076_0024524 3300049592 Bacteria 4662
461 Ga0501077_0006451 3300049593 Bacteria 7202
462 Ga0501079_0002479 3300049741 Bacteria 13411
463 Ga0501079_0063738 3300049741 Bacteria 2843
464 Ga0501080_0092906 3300049742 Bacteria 2802
465 Ga0501081_0000170 3300049743 Bacteria 30468
466 Ga0501081_0008296 3300049743 Bacteria 6741
467 Ga0501035_0243746 3300049822 Bacteria 1528
468 Ga0501045_0001350 3300049824 Bacteria 16283
469 Ga0501045_0071286 3300049824 Bacteria 2557
470 nmdc:mga0yw44_199705_c1 3300050492 Unclassified 1320
471 nmdc:mga0yw44_21574_c1 3300050492 Bacteria 3595
472 nmdc:mga05p37_292160_c1 3300050507 Unclassified 1940
473 nmdc:mga05p37_994025_c1 3300050507 Bacteria 892
474 nmdc:mga06r32_55835_c1 3300050510 Bacteria 3789
475 nmdc:mga08y16_1417145_c1 3300050511 Bacteria 658
476 nmdc:mga08y16_391711_c1 3300050511 Unclassified 1423
477 nmdc:mga08y16_6316_c1 3300050511 Bacteria 12429
478 nmdc:mga0n895_125792_c1 3300050512 Bacteria 2587
479 nmdc:mga0n895_18247_c1 3300050512 Bacteria 6487
480 nmdc:mga0n895_31890_c1 3300050512 Bacteria 5052
481 nmdc:mga0rr50_22820_c1 3300050513 Bacteria 4302
482 nmdc:mga0rr50_301775_c1 3300050513 Bacteria 1340
483 nmdc:mga0rr50_578788_c1 3300050513 Archaea 957
484 nmdc:mga0a205_109058_c1 3300050515 Bacteria 2667
485 nmdc:mga0a205_123742_c1 3300050515 Bacteria 2486
486 nmdc:mga0a205_418327_c1 3300050515 Unclassified 1202
487 nmdc:mga0a205_982398_c1 3300050515 Unclassified 691
488 Ga0495601_0002966 3300053077 Bacteria 9655
489 Ga0495601_0288653 3300053077 Unclassified 1069
490 Ga0495601_0300048 3300053077 Bacteria 1046
491 Ga0495601_0525314 3300053077 Bacteria 762
492 Ga0495612_0059000 3300053078 Bacteria 1586
493 Ga0495655_0032031 3300053083 Unclassified 1284
494 Ga0495595_0077027 3300053084 Unclassified 1584
495 Ga0495619_0038019 3300053085 Bacteria 3139
496 Ga0495619_0101499 3300053085 Bacteria 1959
497 Ga0501084_0001878 3300054114 Bacteria 16735
498 Ga0501084_0008033 3300054114 Bacteria 8689
499 Ga0501084_0877642 3300054114 Unclassified 755
500 Ga0501082_0006965 3300060353 Bacteria 9765
501 Ga0501082_0014827 3300060353 Bacteria 6714
502 Ga0530510_0022340 3300061734 Bacteria 4505
503 Ga0530510_0025210 3300061734 Bacteria 4251
504 Ga0530510_0504880 3300061734 Bacteria 917
505 Ga0081455_10170922
506 JGI24744J21845_10010127
507 Ga0070683_100006649
508 Ga0070683_100104060
509 Ga0070683_100146043
510 Ga0068869_100470129
511 Ga0070680_100154740
512 Ga0068868_100073054
513 Ga0068868_100109842
514 Ga0068868_100221452
515 Ga0070689_100011134
516 Ga0070687_100043091
517 Ga0070668_100396752
518 Ga0070669_100157713
519 Ga0070669_100550437
520 Ga0070671_100026242
521 Ga0070671_100451155
522 Ga0070673_100211078
523 Ga0070688_100165158
524 Ga0070688_100248121
525 Ga0070714_100014140
526 Ga0070714_100358764
527 Ga0070713_100444738
528 Ga0070710_10002680
529 Ga0070710_10033839
530 Ga0070710_10379494
531 Ga0070711_100011924
532 Ga0070711_100139652
533 Ga0070700_100000417
534 Ga0070700_100129756
535 Ga0070694_100010474
536 Ga0070694_100099188
537 Ga0070678_100004501
538 Ga0070662_100647362
539 Ga0070681_11034465
540 Ga0068867_100880293
541 Ga0070685_10028858
542 Ga0070707_100001869
543 Ga0070698_100359764
544 Ga0070679_100026369
545 Ga0070684_100006178
546 Ga0070684_100160435
547 Ga0070684_100302660
548 Ga0070684_100412251
549 Ga0068853_100004140
550 Ga0070672_101140885
551 Ga0070686_100099753
552 Ga0070686_100353839
553 Ga0070695_100209617
554 Ga0070696_100048722
555 Ga0070693_100020893
556 Ga0070693_100141471
557 Ga0070665_100037704
558 Ga0070665_101115558
559 Ga0070704_100085856
560 Ga0070704_100349509
561 Ga0070704_100400303
562 Ga0068855_100071723
563 Ga0068857_100028215
564 Ga0068857_100125609
565 Ga0068857_100511379
566 Ga0068857_100665975
567 Ga0068857_100705945
568 Ga0068856_100013744
569 Ga0068856_100088003
570 Ga0068856_100450269
571 Ga0068856_100479721
572 Ga0068852_100009100
573 Ga0068859_100156873
574 Ga0068864_100163773
575 Ga0068866_10011156
576 Ga0068866_10437778
577 Ga0068861_100120245
578 Ga0068861_100264580
579 Ga0081455_10003312
580 Ga0081455_10014086
581 Ga0081455_10023806
582 Ga0081455_10031241
583 Ga0081538_10030805
584 Ga0081538_10160913
585 Ga0081540_1001091
586 Ga0081540_1002114
587 Ga0070717_10020676
588 Ga0070717_10107284
589 Ga0075365_10158599
590 Ga0075365_10201525
591 Ga0075432_10003179
592 Ga0070715_10143377
593 Ga0070716_100054682
594 Ga0070712_100009760
595 Ga0070712_100013467
596 Ga0070712_100153037
597 Ga0068871_100008081
598 Ga0068871_100258254
599 Ga0068871_100751734
600 Ga0075428_100308269
601 Ga0075428_100332674
602 Ga0075430_100127513
603 Ga0075433_10039459
604 Ga0075433_10255265
605 Ga0075434_100153050
606 Ga0068865_100005655
607 Ga0075436_100017495
608 Ga0075436_100106214
609 Ga0097620_100156879
610 Ga0075435_100005982
611 Ga0075435_100172081
612 Ga0075435_100195712
613 Ga0105240_10725792
614 Ga0111539_10281361
615 Ga0111539_10312091
616 Ga0111539_10677804
617 Ga0111539_10911807
618 Ga0105245_10022177
619 Ga0105245_10026644
620 Ga0105245_10327529
621 Ga0105247_10049997
622 Ga0114129_10220280
623 Ga0114129_10594506
624 Ga0114129_10845266
625 Ga0114129_10851174
626 Ga0114129_10996404
627 Ga0105243_10013324
628 Ga0105243_10102594
629 Ga0105243_10387152
630 Ga0105243_10585924
631 Ga0105241_10168348
632 Ga0105242_10002666
633 Ga0105242_10183381
634 Ga0105242_10424006
635 Ga0105248_10225898
636 Ga0105237_10191817
637 Ga0105238_10087937
638 Ga0105249_10006664
639 Ga0105249_10904529
640 Ga0105239_10064242
641 Ga0105246_10009651
642 Ga0157369_10315281
643 Ga0157374_10126975
644 Ga0157374_10532000
645 Ga0157378_10013330
646 Ga0163162_10001287
647 Ga0157372_10900484
648 Ga0157375_10006871
649 Ga0157375_10057377
650 Ga0157375_10356599
651 Ga0163163_10186074
652 Ga0163163_10507839
653 Ga0163163_10620905
654 Ga0157380_10000973
655 Ga0157377_10226481
656 Ga0157377_10251451
657 Ga0157376_10030667
658 Ga0157376_10081225
659 Ga0157376_10511110
660 Ga0207692_10014190
661 Ga0207692_10016314
662 Ga0207647_10165673
663 Ga0207685_10110605
664 Ga0207685_10195584
665 Ga0207699_10122995
666 Ga0207693_10001122
667 Ga0207693_10002743
668 Ga0207693_10809773
669 Ga0207663_10018270
670 Ga0207663_10242553
671 Ga0207657_10006374
672 Ga0207652_10185945
673 Ga0207646_10000129
674 Ga0207646_10233968
675 Ga0207687_10167253
676 Ga0207687_10171607
677 Ga0207700_10636254
678 Ga0207664_10631228
679 Ga0207644_10722071
680 Ga0207690_10256338
681 Ga0207686_10654979
682 Ga0207709_10013314
683 Ga0207709_10204444
684 Ga0207670_10419436
685 Ga0207669_10412415
686 Ga0207704_10060458
687 Ga0207665_10014242
688 Ga0207691_10180427
689 Ga0207711_10471870
690 Ga0207689_10278561
691 Ga0207661_10019871
692 Ga0207661_10068126
693 Ga0207661_10112723
694 Ga0207712_10191696
695 Ga0207668_10024861
696 Ga0207668_10350206
697 Ga0207677_10033037
698 Ga0207639_10281526
699 Ga0207708_10000580
700 Ga0207708_10149744
701 Ga0207702_10026508
702 Ga0207702_10032578
703 Ga0207702_10397898
704 Ga0207702_10544442
705 Ga0207702_10693668
706 Ga0207648_10001312
707 Ga0207648_10308872
708 Ga0207676_10189124
709 Ga0207674_10008326
710 Ga0207674_10219910
711 Ga0207674_10232418
712 Ga0207675_100094317
713 Ga0207675_100132349
714 Ga0207675_100152793
715 Ga0207683_10000753
716 Ga0207698_10039097
717 Ga0209998_10013942
718 Ga0207428_10003189
719 Ga0207428_10141381
720 Ga0207428_10657602
721 Ga0307405_10233189
722 Ga0307413_10777951
723 Ga0307410_10102205
724 Ga0307406_10264357
725 Ga0307409_100010991
726 Ga0307409_100012132
727 Ga0307415_100533548
728 Ga0373949_0082029
729 Ga0373932_0086435
730 Ga0373953_0091241
731 Ga0373931_0040759
732 Ga0373947_0001195
733 Ga0395899_0006793
734 Ga0395899_0009079
735 Ga0395899_0027644
736 Ga0395899_0033898
737 Ga0395899_0056381
738 Ga0395899_0060288
739 Ga0395899_0089559
740 Ga0395900_0003423
741 Ga0395900_0003445
742 Ga0395900_0011765
743 Ga0395900_0011883
744 Ga0395900_0018193
745 Ga0395900_0129460
746 Ga0395900_0231475
747 Ga0395898_0001871
748 Ga0395898_0007369
749 Ga0395898_0010211
750 Ga0395898_0016052
751 Ga0395898_0153356
752 Ga0395898_0161772
753 Ga0395898_0195646
754 Ga0395898_0391852
755 Ga0395898_0417225
756 Ga0395898_0869217
757 Ga0395898_1147011
758 Ga0395905_0004041
759 Ga0395905_0004523
760 Ga0395905_0015937
761 Ga0395905_0047039
762 Ga0395905_0047503
763 Ga0395905_0285095
764 Ga0395905_0466422
765 Ga0395905_1015534
766 Ga0395901_0003237
767 Ga0395901_0027482
768 Ga0395901_0031831
769 Ga0395901_0040568
770 Ga0395901_0069468
771 Ga0395901_0150754
772 Ga0395901_0395502
773 Ga0395901_0590958
774 Ga0395901_0747307
775 Ga0451849_1554668
776 Ga0451853_3484262
777 Ga0439448_0001886
778 Ga0439448_0096612
779 Ga0439455_0068994
780 Ga0439458_0002917
781 Ga0439458_0003118
782 Ga0439459_0024336
783 Ga0439460_0030731
784 Ga0451576_0459488
785 Ga0466967_0045309
786 Ga0495592_0094199
787 Ga0495603_0040908
788 Ga0495603_0059544
789 Ga0495603_0150904
790 Ga0495629_0059428
791 Ga0495641_0056006
792 Ga0495641_0197682
793 Ga0495651_0243544
794 Ga0495651_0321397
795 Ga0495582_0025681
796 Ga0495582_0252780
797 Ga0495582_0370735
798 Ga0495639_0321852
799 Ga0495662_0195401
800 Ga0495664_0116305
801 Ga0495664_0228050
802 Ga0495584_0026451
803 Ga0495584_0086241
804 Ga0495584_0090968
805 Ga0495585_0242622
806 Ga0495594_0100997
807 Ga0495616_0048914
808 Ga0495620_0106834
809 Ga0495628_0132305
810 Ga0495628_0309818
811 Ga0495637_0034906
812 Ga0495637_0088470
813 Ga0495637_0228204
814 Ga0495663_0065505
815 Ga0495663_0078806
816 Ga0495642_0139601
817 Ga0495642_0158688
818 Ga0495642_0219127
819 Ga0495652_0453650
820 Ga0495665_0027989
821 Ga0495665_0201779
822 Ga0495586_0034659
823 Ga0495609_0144755
824 Ga0495609_0290068
825 Ga0495645_0017163
826 Ga0495633_0252384
827 Ga0495667_0049704
828 Ga0495656_0023224
829 Ga0495656_0037685
830 Ga0495668_0040711
831 Ga0495635_0126000
832 Ga0495659_0065483
833 Ga0495659_0082407
834 Ga0495659_0095416
835 Ga0495657_0017999
836 Ga0495657_0097432
837 Ga0495599_0081641
838 Ga0495647_0043101
839 Ga0495658_0006787
840 Ga0495613_0147338
841 Ga0495624_0059929
842 Ga0495624_0154666
843 Ga0495670_0208852
844 Ga0495589_0123492
845 Ga0495589_0148800
846 Ga0495589_0176062
847 Ga0495581_0001921
848 Ga0495581_0016609
849 Ga0495604_0098691
850 Ga0495636_0124998
851 Ga0495636_0268215
852 Ga0495636_0402924
853 Ga0495674_0014091
854 Ga0495674_0477763
855 Ga0495674_0507217
856 Ga0495676_0019160
857 Ga0495676_0074411
858 Ga0495676_0134878
859 Ga0495676_0287836
860 Ga0495676_0458921
861 Ga0495676_0612246
862 Ga0495680_0009806
863 Ga0495680_0022908
864 Ga0495683_0084448
865 Ga0495684_0227686
866 Ga0495602_0138337
867 Ga0496100_0003885
868 Ga0496100_0004877
869 Ga0496100_0135530
870 Ga0496101_0002705
871 Ga0496101_0020322
872 Ga0496101_0120352
873 Ga0496102_0008943
874 Ga0496103_0027426
875 Ga0496103_0075696
876 Ga0496104_0011664
877 Ga0496104_0015038
878 Ga0496104_0149548
879 Ga0496104_0260709
880 Ga0496105_0005816
881 Ga0496105_0052016
882 Ga0496105_0053916
883 Ga0496105_0109059
884 Ga0496105_0392116
885 Ga0496105_0491500
886 Ga0496106_0009053
887 Ga0496106_0013090
888 Ga0496106_0028269
889 Ga0496106_0036178
890 Ga0496107_0004163
891 Ga0496107_0009627
892 Ga0496107_0041334
893 Ga0496107_0192870
894 Ga0496108_0001267
895 Ga0496108_0045585
896 Ga0496108_0059577
897 Ga0496108_0069366
898 Ga0496108_0079690
899 Ga0496108_0297806
900 Ga0496109_0000974
901 Ga0496109_0007115
902 Ga0496109_0014750
903 Ga0496109_0017155
904 Ga0496109_0065036
905 Ga0496109_0097789
906 Ga0496109_0121343
907 Ga0496109_0150028
908 Ga0496109_0184504
909 Ga0496109_0221790
910 Ga0496109_0310074
911 Ga0496110_0001708
912 Ga0496110_0088618
913 Ga0496110_0111058
914 Ga0496110_0167476
915 Ga0496110_0591872
916 Ga0496110_0668913
917 Ga0496111_0002021
918 Ga0496111_0002525
919 Ga0496111_0064418
920 Ga0496111_0190570
921 Ga0496111_0237012
922 Ga0496111_0568746
923 Ga0496112_0082357
924 Ga0496112_0238323
925 Ga0496112_0244426
926 Ga0496113_0122797
927 Ga0496113_0177602
928 Ga0496113_0212595
929 Ga0496114_0008538
930 Ga0496114_0015740
931 Ga0496114_0077125
932 Ga0496114_0121838
933 Ga0496114_0287438
934 Ga0496114_0470139
935 Ga0496114_0839023
936 Ga0496115_0087286
937 Ga0496115_0103743
938 Ga0496115_0396209
939 Ga0496115_0686240
940 Ga0501031_0010048
941 Ga0501036_0012352
942 Ga0501038_0006012
943 Ga0501038_0026259
944 Ga0501039_0005413
945 Ga0501039_0017225
946 Ga0501040_0010172
947 Ga0501040_0020431
948 Ga0501041_0028631
949 Ga0501042_0031968
950 Ga0501042_0055547
951 Ga0501043_0121239
952 Ga0501046_0016986
953 Ga0501046_0045720
954 Ga0501048_0007659
955 Ga0501068_0049261
956 Ga0501068_0049347
957 Ga0501069_0034580
958 Ga0501071_0019587
959 Ga0501071_0087968
960 Ga0501072_0000804
961 Ga0501072_0006266
962 Ga0501074_0050937
963 Ga0501076_0000707
964 Ga0501076_0024524
965 Ga0501077_0006451
966 Ga0501079_0002479
967 Ga0501079_0063738
968 Ga0501080_0092906
969 Ga0501081_0000170
970 Ga0501081_0008296
971 Ga0501035_0243746
972 Ga0501045_0001350
973 Ga0501045_0071286
974 nmdc:mga0yw44_199705_c1
975 nmdc:mga0yw44_21574_c1
976 nmdc:mga05p37_292160_c1
977 nmdc:mga05p37_994025_c1
978 nmdc:mga06r32_55835_c1
979 nmdc:mga08y16_1417145_c1
980 nmdc:mga08y16_391711_c1
981 nmdc:mga08y16_6316_c1
982 nmdc:mga0n895_125792_c1
983 nmdc:mga0n895_18247_c1
984 nmdc:mga0n895_31890_c1
985 nmdc:mga0rr50_22820_c1
986 nmdc:mga0rr50_301775_c1
987 nmdc:mga0rr50_578788_c1
988 nmdc:mga0a205_109058_c1
989 nmdc:mga0a205_123742_c1
990 nmdc:mga0a205_418327_c1
991 nmdc:mga0a205_982398_c1
992 Ga0495601_0002966
993 Ga0495601_0288653
994 Ga0495601_0300048
995 Ga0495601_0525314
996 Ga0495612_0059000
997 Ga0495655_0032031
998 Ga0495595_0077027
999 Ga0495619_0038019
1000 Ga0495619_0101499
1001 Ga0501084_0001878
1002 Ga0501084_0008033
1003 Ga0501084_0877642
1004 Ga0501082_0006965
1005 Ga0501082_0014827
1006 Ga0530510_0022340
1007 Ga0530510_0025210
1008 Ga0530510_0504880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

162

218

0.97

PF00989

PAS

PAS fold

45

149

0.95

PF08448

PAS_4

PAS fold

51

149

0.94

PF04545

Sigma70_r4

Sigma-70, region 4

162

207

0.91

PF08281

Sigma70_r4_2

Sigma-70, region 4

156

206

0.91

PF13426

PAS_9

PAS domain

55

149

0.88

PF08279

HTH_11

HTH domain

167

222

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9781 128 187
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9749 128 183
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9661 127 186
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9605 127 187
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9594 128 187
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9909 127 184 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.98 127 184 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9749 128 183 1.10.10.10
af_P0AED5_2_210_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9746 127 184 3.40.50.2300
af_P9WMF9_2_208_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9636 127 182 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2D6CYQ1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9316 13 115 GO:0000155
GO:0016020
GO:0046983
AF-A0A5C9DZM8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9279 11 115 GO:0006355
GO:0016301
AF-A0A3M8SWT3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9264 11 115 GO:0000155
GO:0000156
GO:0007234
GO:0030295
AF-A0A0D8FUD9-F1-model_v4 Phytochrome-like protein cph2 0.9237 11 115 GO:0016020
AF-A0A6P1M963-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9222 11 115 GO:0000155
GO:0005524
GO:0006355

Map