F456148

General Info

Members Datasets Scaffolds Average Seq Length
504 210 1008 379

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100021997|Ga0070698_1000219972
Length 419
Sequence MSPLSSPISIDQRRHPISAVGRSHFLDKTSSPEELARQLAFTRREFLRSAAGLALGGTVFSASFGSGLSAASLLGHSGIPAKKRKVVVITFGGGARDQETFAPEGQENIPHLMRELIPQSTFFTQVVNRGILGHYVATASLATGAYETINNFAALPPENPTVFEYFRKDLRRPASDAWVVAPSNGFNRIGESNNRSYGPGLGAGVILPKHLLSAATSGGHSDYEHLLRDNYETPFYTPELGGREFQLQQLEMILKLSVDDFKKHALTLSSPDELSVYIARQLMRQLAPSLLWITMHDIDIAHAGAYSLYIEGIRRTDRLCADLWKTIQSEPEYAGNTTLFILPDFGRDADDDAGGNGFQHHRTGDPLSRTTWLMALGAGVREGVIFDRALQSTDLVPTLGSMMGFSPSLAQGRPIAELL

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 3.17
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 20.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100021997 3300005471 Bacteria 6676
2 JGI25406J46586_10028695 3300003203 Bacteria 2117
3 Ga0070658_10000074 3300005327 Bacteria 95827
4 Ga0070658_10007639 3300005327 Bacteria 8717
5 Ga0070676_10020310 3300005328 Unclassified 3707
6 Ga0070683_100016838 3300005329 Bacteria 6449
7 Ga0070666_10011524 3300005335 Bacteria 5552
8 Ga0070680_100015404 3300005336 Bacteria 5993
9 Ga0070680_100179849 3300005336 Unclassified 1781
10 Ga0070682_100065806 3300005337 Unclassified 2304
11 Ga0070682_100183495 3300005337 Bacteria 1463
12 Ga0068868_100007498 3300005338 Bacteria 7772
13 Ga0068868_100008502 3300005338 Bacteria 7349
14 Ga0068868_100072833 3300005338 Unclassified 2741
15 Ga0070660_100023717 3300005339 Bacteria 4547
16 Ga0070660_100059289 3300005339 Unclassified 2968
17 Ga0070687_100172209 3300005343 Unclassified 1289
18 Ga0070661_100046644 3300005344 Bacteria 3170
19 Ga0070661_100064779 3300005344 Unclassified 2686
20 Ga0070661_100118954 3300005344 Bacteria 1977
21 Ga0070661_100284105 3300005344 Unclassified 1284
22 Ga0070668_100016586 3300005347 Bacteria 5506
23 Ga0070675_100008543 3300005354 Bacteria 7949
24 Ga0070675_100229761 3300005354 Unclassified 1618
25 Ga0070671_100003141 3300005355 Bacteria 12873
26 Ga0070674_100020890 3300005356 Unclassified 4193
27 Ga0070673_100012544 3300005364 Bacteria 5822
28 Ga0070659_100039687 3300005366 Bacteria 3676
29 Ga0070659_100079681 3300005366 Bacteria 2614
30 Ga0070667_100001492 3300005367 Bacteria 20969
31 Ga0070709_10005083 3300005434 Bacteria 7108
32 Ga0070709_10047844 3300005434 Unclassified 2666
33 Ga0070714_100026773 3300005435 Bacteria 4768
34 Ga0070714_100124882 3300005435 Bacteria 2293
35 Ga0070714_100155278 3300005435 Bacteria 2065
36 Ga0070714_100370180 3300005435 Bacteria 1349
37 Ga0070713_100000604 3300005436 Bacteria 22818
38 Ga0070713_100048152 3300005436 Unclassified 3508
39 Ga0070713_100062615 3300005436 Bacteria 3116
40 Ga0070713_100137426 3300005436 Unclassified 2161
41 Ga0070713_100187583 3300005436 Unclassified 1862
42 Ga0070711_100000332 3300005439 Bacteria 24301
43 Ga0070711_100017785 3300005439 Bacteria 4529
44 Ga0070705_100032060 3300005440 Bacteria 2916
45 Ga0070708_100106906 3300005445 Bacteria 2568
46 Ga0070663_100077077 3300005455 Bacteria 2439
47 Ga0070663_100102755 3300005455 Unclassified 2135
48 Ga0070678_100002412 3300005456 Bacteria 10239
49 Ga0070662_100011520 3300005457 Bacteria 5835
50 Ga0070681_10000149 3300005458 Bacteria 53023
51 Ga0070681_10004955 3300005458 Bacteria 12805
52 Ga0070681_10016164 3300005458 Bacteria 7440
53 Ga0070681_10064143 3300005458 Bacteria 3645
54 Ga0068867_100026087 3300005459 Bacteria 4194
55 Ga0068867_100087403 3300005459 Bacteria 2360
56 Ga0070706_100000969 3300005467 Bacteria 31311
57 Ga0070706_100058033 3300005467 Bacteria 3572
58 Ga0070707_100036601 3300005468 Bacteria 4683
59 Ga0070699_100128077 3300005518 Bacteria 2236
60 Ga0070699_100147497 3300005518 Unclassified 2079
61 Ga0070679_100009265 3300005530 Bacteria 9306
62 Ga0070679_100015240 3300005530 Bacteria 7385
63 Ga0070679_100098481 3300005530 Bacteria 2911
64 Ga0070679_100173637 3300005530 Unclassified 2128
65 Ga0070684_100001091 3300005535 Bacteria 19447
66 Ga0070684_100011843 3300005535 Bacteria 6962
67 Ga0070684_100013111 3300005535 Bacteria 6672
68 Ga0070684_100056494 3300005535 Bacteria 3426
69 Ga0070684_100160730 3300005535 Unclassified 2038
70 Ga0070684_100279814 3300005535 Bacteria 1528
71 Ga0070697_100000980 3300005536 Bacteria 21560
72 Ga0070697_100082097 3300005536 Unclassified 2656
73 Ga0068853_100013405 3300005539 Bacteria 6692
74 Ga0068853_100053076 3300005539 Bacteria 3491
75 Ga0068853_100127463 3300005539 Bacteria 2275
76 Ga0068853_100147950 3300005539 Bacteria 2112
77 Ga0070672_100018349 3300005543 Bacteria 5056
78 Ga0070693_100066752 3300005547 Bacteria 2106
79 Ga0070665_100008524 3300005548 Bacteria 10371
80 Ga0070665_100079860 3300005548 Unclassified 3277
81 Ga0070665_100223752 3300005548 Bacteria 1882
82 Ga0068855_100000665 3300005563 Bacteria 41970
83 Ga0068855_100002794 3300005563 Bacteria 21488
84 Ga0068855_100004052 3300005563 Bacteria 17878
85 Ga0068855_100006534 3300005563 Bacteria 14179
86 Ga0068855_100015376 3300005563 Bacteria 9214
87 Ga0068855_100017254 3300005563 Bacteria 8688
88 Ga0068855_100033705 3300005563 Bacteria 6110
89 Ga0068855_100073703 3300005563 Bacteria 3966
90 Ga0068855_100080769 3300005563 Bacteria 3770
91 Ga0068855_100085721 3300005563 Unclassified 3644
92 Ga0068855_100097911 3300005563 Bacteria 3379
93 Ga0068855_100103565 3300005563 Unclassified 3274
94 Ga0070664_100018585 3300005564 Bacteria 5713
95 Ga0070664_100043940 3300005564 Bacteria 3772
96 Ga0068857_100000281 3300005577 Bacteria 34884
97 Ga0068857_100017890 3300005577 Bacteria 6215
98 Ga0068857_100093051 3300005577 Unclassified 2699
99 Ga0068854_100004358 3300005578 Bacteria 8923
100 Ga0068854_100011621 3300005578 Bacteria 5741
101 Ga0068854_100035179 3300005578 Bacteria 3504
102 Ga0068854_100121108 3300005578 Unclassified 1986
103 Ga0068856_100000062 3300005614 Bacteria 100769
104 Ga0068856_100003896 3300005614 Bacteria 14973
105 Ga0068856_100012679 3300005614 Bacteria 8161
106 Ga0068856_100017210 3300005614 Bacteria 7005
107 Ga0068856_100021519 3300005614 Bacteria 6268
108 Ga0068856_100023136 3300005614 Bacteria 6044
109 Ga0068856_100065331 3300005614 Bacteria 3596
110 Ga0068856_100076430 3300005614 Bacteria 3318
111 Ga0068852_100005772 3300005616 Bacteria 8883
112 Ga0068852_100011993 3300005616 Bacteria 6555
113 Ga0068852_100030588 3300005616 Bacteria 4435
114 Ga0068859_100003559 3300005617 Bacteria 15865
115 Ga0068859_100095658 3300005617 Unclassified 3023
116 Ga0068864_100002079 3300005618 Bacteria 16540
117 Ga0068864_100090091 3300005618 Unclassified 2704
118 Ga0068866_10013381 3300005718 Bacteria 3599
119 Ga0068866_10021124 3300005718 Unclassified 2994
120 Ga0068866_10159119 3300005718 Unclassified 1315
121 Ga0068863_100008890 3300005841 Bacteria 9809
122 Ga0068863_100040867 3300005841 Unclassified 4409
123 Ga0068863_100085791 3300005841 Bacteria 2983
124 Ga0068863_100095739 3300005841 Unclassified 2818
125 Ga0068858_100001572 3300005842 Bacteria 23404
126 Ga0068858_100016378 3300005842 Bacteria 6961
127 Ga0068858_100061749 3300005842 Bacteria 3465
128 Ga0068858_100253145 3300005842 Bacteria 1673
129 Ga0081540_1022117 3300005983 Unclassified 3761
130 Ga0081539_10016163 3300005985 Bacteria 5357
131 Ga0070717_10007004 3300006028 Bacteria 8343
132 Ga0070717_10007022 3300006028 Bacteria 8335
133 Ga0070717_10340088 3300006028 Bacteria 1340
134 Ga0070716_100000127 3300006173 Bacteria 30225
135 Ga0070716_100003388 3300006173 Bacteria 7496
136 Ga0070716_100004078 3300006173 Bacteria 6931
137 Ga0070716_100047004 3300006173 Unclassified 2432
138 Ga0070712_100000034 3300006175 Bacteria 68379
139 Ga0070712_100001048 3300006175 Bacteria 16690
140 Ga0070712_100001302 3300006175 Bacteria 15095
141 Ga0070712_100027912 3300006175 Unclassified 3772
142 Ga0097621_100000397 3300006237 Bacteria 30368
143 Ga0097621_100001719 3300006237 Bacteria 14973
144 Ga0097621_100079291 3300006237 Unclassified 2729
145 Ga0097621_100153544 3300006237 Unclassified 1975
146 Ga0068871_100000408 3300006358 Bacteria 29699
147 Ga0068871_100000533 3300006358 Bacteria 25986
148 Ga0068871_100057016 3300006358 Bacteria 3177
149 Ga0068871_100064071 3300006358 Bacteria 3008
150 Ga0068871_100156140 3300006358 Unclassified 1948
151 Ga0075434_100001429 3300006871 Bacteria 20057
152 Ga0075434_100031017 3300006871 Bacteria 5269
153 Ga0075434_100031991 3300006871 Bacteria 5186
154 Ga0075434_100040177 3300006871 Unclassified 4634
155 Ga0075434_100044948 3300006871 Unclassified 4381
156 Ga0068865_100074193 3300006881 Bacteria 2422
157 Ga0075436_100001245 3300006914 Bacteria 17312
158 Ga0075436_100084327 3300006914 Bacteria 2205
159 Ga0097620_100003559 3300006931 Bacteria 15865
160 Ga0097620_100095655 3300006931 Unclassified 3023
161 Ga0075435_100024139 3300007076 Unclassified 4714
162 Ga0075435_100091934 3300007076 Bacteria 2505
163 Ga0099794_10020114 3300007265 Bacteria 3018
164 Ga0099794_10105217 3300007265 Unclassified 1411
165 Ga0105240_10000002 3300009093 Bacteria 1924170
166 Ga0105240_10007375 3300009093 Bacteria 15997
167 Ga0105240_10007417 3300009093 Bacteria 15932
168 Ga0105240_10007543 3300009093 Bacteria 15767
169 Ga0105240_10020944 3300009093 Bacteria 8705
170 Ga0105240_10060351 3300009093 Unclassified 4728
171 Ga0105240_10150547 3300009093 Bacteria 2772
172 Ga0105240_10201389 3300009093 Bacteria 2333
173 Ga0105240_10211378 3300009093 Bacteria 2267
174 Ga0105240_10268627 3300009093 Bacteria 1965
175 Ga0105247_10092785 3300009101 Bacteria 1918
176 Ga0105243_10268175 3300009148 Bacteria 1531
177 Ga0105241_10005610 3300009174 Bacteria 9265
178 Ga0105241_10009613 3300009174 Bacteria 7108
179 Ga0105241_10055805 3300009174 Bacteria 3027
180 Ga0105241_10068136 3300009174 Bacteria 2756
181 Ga0105242_10042658 3300009176 Unclassified 3665
182 Ga0105242_10062195 3300009176 Unclassified 3072
183 Ga0105242_10353894 3300009176 Bacteria 1357
184 Ga0105248_10000006 3300009177 Bacteria 595060
185 Ga0105248_10104443 3300009177 Unclassified 3194
186 Ga0105248_10112228 3300009177 Unclassified 3075
187 Ga0105248_10116379 3300009177 Bacteria 3015
188 Ga0105237_10006035 3300009545 Bacteria 13560
189 Ga0105237_10067438 3300009545 Bacteria 3572
190 Ga0105237_10182329 3300009545 Bacteria 2099
191 Ga0105237_10277301 3300009545 Bacteria 1679
192 Ga0105238_10000465 3300009551 Bacteria 42640
193 Ga0105238_10088797 3300009551 Unclassified 3077
194 Ga0105238_10305824 3300009551 Bacteria 1574
195 Ga0105249_10167021 3300009553 Unclassified 2131
196 Ga0105239_10023676 3300010375 Bacteria 6760
197 Ga0105239_10105455 3300010375 Unclassified 3122
198 Ga0105246_10025255 3300011119 Unclassified 3872
199 Ga0157373_10028413 3300013100 Unclassified 4034
200 Ga0157371_10023759 3300013102 Bacteria 4481
201 Ga0157371_10073861 3300013102 Unclassified 2415
202 Ga0157371_10082729 3300013102 Bacteria 2273
203 Ga0157370_10006716 3300013104 Bacteria 12626
204 Ga0157370_10008095 3300013104 Bacteria 11381
205 Ga0157370_10010889 3300013104 Bacteria 9552
206 Ga0157370_10020529 3300013104 Bacteria 6596
207 Ga0157370_10029942 3300013104 Bacteria 5336
208 Ga0157370_10039327 3300013104 Bacteria 4571
209 Ga0157370_10229551 3300013104 Bacteria 1718
210 Ga0157370_10401202 3300013104 Unclassified 1262
211 Ga0157369_10000159 3300013105 Bacteria 95759
212 Ga0157369_10000711 3300013105 Bacteria 42778
213 Ga0157369_10001181 3300013105 Bacteria 32573
214 Ga0157369_10005800 3300013105 Bacteria 14361
215 Ga0157369_10010315 3300013105 Bacteria 10656
216 Ga0157369_10098295 3300013105 Unclassified 3122
217 Ga0157369_10494982 3300013105 Bacteria 1265
218 Ga0157374_10000062 3300013296 Bacteria 112028
219 Ga0157374_10000143 3300013296 Bacteria 64852
220 Ga0157374_10013101 3300013296 Bacteria 7232
221 Ga0157374_10037613 3300013296 Bacteria 4443
222 Ga0157374_10125584 3300013296 Bacteria 2480
223 Ga0157378_10000009 3300013297 Bacteria 161557
224 Ga0157378_10000345 3300013297 Bacteria 45724
225 Ga0157378_10000437 3300013297 Bacteria 40470
226 Ga0157378_10003843 3300013297 Bacteria 13288
227 Ga0157378_10010908 3300013297 Bacteria 7948
228 Ga0157378_10025690 3300013297 Bacteria 5187
229 Ga0157378_10152329 3300013297 Bacteria 2155
230 Ga0163162_10005740 3300013306 Bacteria 12002
231 Ga0157372_10000140 3300013307 Bacteria 79310
232 Ga0157372_10000709 3300013307 Bacteria 36654
233 Ga0157372_10004964 3300013307 Bacteria 14130
234 Ga0157372_10008669 3300013307 Bacteria 10801
235 Ga0157372_10008976 3300013307 Bacteria 10627
236 Ga0157372_10009805 3300013307 Bacteria 10187
237 Ga0157372_10011908 3300013307 Bacteria 9266
238 Ga0157372_10027204 3300013307 Bacteria 6226
239 Ga0157372_10028731 3300013307 Bacteria 6071
240 Ga0157372_10046194 3300013307 Bacteria 4834
241 Ga0157372_10049877 3300013307 Bacteria 4656
242 Ga0157372_10069938 3300013307 Bacteria 3948
243 Ga0157372_10276771 3300013307 Bacteria 1951
244 Ga0157375_10049126 3300013308 Unclassified 4132
245 Ga0157375_10296308 3300013308 Unclassified 1781
246 Ga0157379_10004279 3300014968 Bacteria 12195
247 Ga0157379_10021771 3300014968 Bacteria 5679
248 Ga0157379_10036197 3300014968 Bacteria 4401
249 Ga0157376_10000004 3300014969 Bacteria 508493
250 Ga0157376_10000782 3300014969 Bacteria 20783
251 Ga0157376_10020396 3300014969 Bacteria 5126
252 Ga0157376_10056143 3300014969 Bacteria 3288
253 Ga0157376_10069226 3300014969 Bacteria 2991
254 Ga0157376_10080688 3300014969 Unclassified 2791
255 Ga0213872_10000758 3300021361 Bacteria 23809
256 Ga0213872_10003660 3300021361 Bacteria 8427
257 Ga0213874_10017283 3300021377 Bacteria 1933
258 Ga0213876_10040052 3300021384 Bacteria 2475
259 Ga0213875_10013240 3300021388 Bacteria 4057
260 Ga0213875_10020211 3300021388 Bacteria 3195
261 Ga0213875_10032295 3300021388 Bacteria 2474
262 Ga0213871_10011039 3300021441 Bacteria 2064
263 Ga0209233_1004434 3300025261 Bacteria 4773
264 Ga0207680_10041744 3300025903 Bacteria 2679
265 Ga0207647_10038785 3300025904 Unclassified 3010
266 Ga0207647_10042100 3300025904 Bacteria 2867
267 Ga0207699_10011476 3300025906 Bacteria 4476
268 Ga0207699_10037837 3300025906 Unclassified 2761
269 Ga0207699_10110552 3300025906 Bacteria 1760
270 Ga0207645_10006409 3300025907 Bacteria 8450
271 Ga0207705_10000034 3300025909 Bacteria 216943
272 Ga0207705_10000445 3300025909 Bacteria 35598
273 Ga0207684_10003216 3300025910 Bacteria 16036
274 Ga0207654_10002672 3300025911 Bacteria 9054
275 Ga0207654_10013483 3300025911 Bacteria 4206
276 Ga0207707_10005618 3300025912 Bacteria 10969
277 Ga0207707_10044775 3300025912 Unclassified 3857
278 Ga0207707_10215090 3300025912 Unclassified 1673
279 Ga0207695_10000002 3300025913 Bacteria 2188391
280 Ga0207695_10006367 3300025913 Bacteria 15358
281 Ga0207695_10010056 3300025913 Bacteria 11617
282 Ga0207695_10013036 3300025913 Bacteria 9929
283 Ga0207695_10040271 3300025913 Bacteria 5013
284 Ga0207695_10090136 3300025913 Bacteria 3082
285 Ga0207695_10111836 3300025913 Bacteria 2710
286 Ga0207695_10111924 3300025913 Bacteria 2709
287 Ga0207695_10158090 3300025913 Bacteria 2200
288 Ga0207693_10000012 3300025915 Bacteria 154708
289 Ga0207693_10000032 3300025915 Bacteria 115651
290 Ga0207693_10000087 3300025915 Bacteria 82834
291 Ga0207693_10002109 3300025915 Bacteria 17352
292 Ga0207693_10111679 3300025915 Bacteria 2144
293 Ga0207663_10000318 3300025916 Bacteria 21010
294 Ga0207663_10011099 3300025916 Bacteria 4824
295 Ga0207660_10121510 3300025917 Unclassified 1978
296 Ga0207657_10004722 3300025919 Bacteria 14377
297 Ga0207657_10008243 3300025919 Bacteria 10606
298 Ga0207657_10027477 3300025919 Bacteria 5211
299 Ga0207649_10010177 3300025920 Bacteria 5163
300 Ga0207652_10013147 3300025921 Bacteria 6700
301 Ga0207652_10020702 3300025921 Bacteria 5421
302 Ga0207652_10112506 3300025921 Bacteria 2416
303 Ga0207652_10309448 3300025921 Unclassified 1426
304 Ga0207694_10002542 3300025924 Bacteria 14811
305 Ga0207650_10059022 3300025925 Unclassified 2858
306 Ga0207659_10076493 3300025926 Unclassified 2460
307 Ga0207659_10259598 3300025926 Unclassified 1413
308 Ga0207700_10000459 3300025928 Bacteria 23930
309 Ga0207700_10000925 3300025928 Bacteria 16851
310 Ga0207700_10137468 3300025928 Bacteria 2003
311 Ga0207700_10147875 3300025928 Unclassified 1939
312 Ga0207664_10051595 3300025929 Bacteria 3249
313 Ga0207664_10070731 3300025929 Unclassified 2809
314 Ga0207690_10025330 3300025932 Bacteria 3723
315 Ga0207690_10067806 3300025932 Bacteria 2448
316 Ga0207706_10000042 3300025933 Bacteria 125138
317 Ga0207706_10003254 3300025933 Bacteria 15561
318 Ga0207686_10071278 3300025934 Unclassified 2236
319 Ga0207704_10012638 3300025938 Unclassified 4195
320 Ga0207704_10044959 3300025938 Unclassified 2620
321 Ga0207704_10114650 3300025938 Bacteria 1830
322 Ga0207665_10000008 3300025939 Bacteria 173434
323 Ga0207665_10006564 3300025939 Bacteria 7713
324 Ga0207665_10007294 3300025939 Bacteria 7315
325 Ga0207665_10009392 3300025939 Bacteria 6417
326 Ga0207665_10022677 3300025939 Bacteria 4133
327 Ga0207665_10044533 3300025939 Unclassified 2970
328 Ga0207665_10143879 3300025939 Bacteria 1703
329 Ga0207691_10125982 3300025940 Unclassified 2266
330 Ga0207711_10000007 3300025941 Bacteria 759410
331 Ga0207711_10042083 3300025941 Unclassified 3891
332 Ga0207711_10064322 3300025941 Unclassified 3168
333 Ga0207689_10059430 3300025942 Bacteria 3144
334 Ga0207661_10005780 3300025944 Bacteria 8723
335 Ga0207661_10037550 3300025944 Unclassified 3789
336 Ga0207661_10123755 3300025944 Unclassified 2206
337 Ga0207679_10009605 3300025945 Bacteria 6202
338 Ga0207679_10015822 3300025945 Bacteria 4998
339 Ga0207667_10000841 3300025949 Bacteria 39629
340 Ga0207667_10001005 3300025949 Bacteria 35997
341 Ga0207667_10001309 3300025949 Bacteria 31216
342 Ga0207667_10003454 3300025949 Bacteria 19510
343 Ga0207667_10014208 3300025949 Bacteria 9085
344 Ga0207667_10053593 3300025949 Unclassified 4244
345 Ga0207667_10110090 3300025949 Bacteria 2841
346 Ga0207667_10128174 3300025949 Unclassified 2614
347 Ga0207667_10209104 3300025949 Bacteria 2000
348 Ga0207667_10353187 3300025949 Unclassified 1499
349 Ga0207651_10043653 3300025960 Unclassified 2994
350 Ga0207668_10149589 3300025972 Unclassified 1806
351 Ga0207668_10163135 3300025972 Unclassified 1739
352 Ga0207640_10033787 3300025981 Bacteria 3186
353 Ga0207640_10138821 3300025981 Bacteria 1768
354 Ga0207677_10006051 3300026023 Bacteria 6600
355 Ga0207677_10036676 3300026023 Bacteria 3198
356 Ga0207703_10004217 3300026035 Bacteria 11848
357 Ga0207703_10018348 3300026035 Bacteria 5463
358 Ga0207703_10045493 3300026035 Bacteria 3531
359 Ga0207703_10048426 3300026035 Unclassified 3431
360 Ga0207639_10011383 3300026041 Bacteria 6178
361 Ga0207678_10005183 3300026067 Bacteria 11681
362 Ga0207678_10008713 3300026067 Bacteria 8932
363 Ga0207678_10034148 3300026067 Bacteria 4430
364 Ga0207678_10037140 3300026067 Bacteria 4239
365 Ga0207702_10000733 3300026078 Bacteria 35124
366 Ga0207702_10002408 3300026078 Bacteria 17804
367 Ga0207702_10011469 3300026078 Bacteria 7385
368 Ga0207702_10044027 3300026078 Bacteria 3750
369 Ga0207702_10061046 3300026078 Unclassified 3214
370 Ga0207702_10082272 3300026078 Bacteria 2799
371 Ga0207702_10099447 3300026078 Bacteria 2564
372 Ga0207702_10139414 3300026078 Unclassified 2192
373 Ga0207641_10006994 3300026088 Bacteria 9438
374 Ga0207641_10007367 3300026088 Bacteria 9162
375 Ga0207641_10100450 3300026088 Bacteria 2548
376 Ga0207648_10032073 3300026089 Bacteria 4642
377 Ga0207648_10256596 3300026089 Bacteria 1559
378 Ga0207676_10003353 3300026095 Bacteria 11350
379 Ga0207676_10027216 3300026095 Unclassified 4258
380 Ga0207674_10003141 3300026116 Bacteria 20369
381 Ga0207674_10003483 3300026116 Bacteria 19220
382 Ga0207674_10121782 3300026116 Bacteria 2576
383 Ga0207674_10208226 3300026116 Unclassified 1905
384 Ga0207683_10001284 3300026121 Bacteria 22716
385 Ga0207698_10006635 3300026142 Bacteria 7238
386 Ga0207698_10021285 3300026142 Bacteria 4481
387 Ga0207698_10059877 3300026142 Unclassified 2959
388 Ga0268266_10000366 3300028379 Bacteria 69519
389 Ga0268266_10005591 3300028379 Bacteria 11676
390 Ga0268266_10020813 3300028379 Bacteria 5594
391 Ga0268266_10042139 3300028379 Unclassified 3898
392 Ga0265338_10004299 3300028800 Bacteria 19334
393 Ga0265338_10063045 3300028800 Unclassified 3235
394 Ga0265762_1000029 3300030760 Bacteria 16030
395 Ga0265320_10004250 3300031240 Bacteria 9407
396 Ga0265325_10006906 3300031241 Bacteria 6851
397 Ga0265329_10038405 3300031242 Unclassified 1540
398 Ga0265339_10033750 3300031249 Bacteria 2879
399 Ga0265316_10152221 3300031344 Unclassified 1732
400 Ga0265314_10011283 3300031711 Bacteria 7390
401 Ga0307510_10032315 3300033180 Bacteria 5897
402 Ga0307510_10050696 3300033180 Bacteria 4400
403 Ga0373943_0141214 3300035170 Bacteria 1298
404 Ga0373947_0050160 3300035725 Bacteria 2509
405 Ga0373937_0004896 3300036401 Bacteria 11384
406 Ga0373937_0273803 3300036401 Bacteria 1594
407 Ga0395900_0371408 3300037418 Unclassified 1400
408 Ga0395898_0128753 3300037466 Unclassified 2425
409 Ga0436364_0011216 3300037853 Bacteria 9403
410 Ga0436364_0118817 3300037853 Bacteria 5322
411 Ga0436364_0178906 3300037853 Bacteria 8619
412 Ga0436364_1144642 3300037853 Bacteria 2879
413 Ga0436364_1243158 3300037853 Bacteria 3904
414 Ga0436365_1355351 3300039437 Bacteria 2263
415 Ga0436365_1684423 3300039437 Bacteria 2719
416 Ga0436365_1901564 3300039437 Bacteria 1843
417 Ga0436361_0902439 3300039447 Bacteria 94295
418 Ga0436361_1096304 3300039447 Bacteria 2998
419 Ga0436361_1130897 3300039447 Bacteria 9725
420 Ga0436363_0043325 3300039450 Bacteria 1418
421 Ga0436363_0839491 3300039450 Bacteria 7691
422 Ga0436363_1111764 3300039450 Unclassified 2514
423 Ga0436362_0562575 3300039453 Bacteria 1328
424 Ga0451576_0332201 3300045051 Bacteria 1591
425 Ga0466967_0005957 3300045976 Bacteria 8557
426 Ga0466967_0056974 3300045976 Bacteria 3448
427 Ga0466967_0326444 3300045976 Bacteria 1481
428 Ga0495629_0023607 3300046459 Bacteria 4381
429 Ga0495651_0043613 3300046462 Bacteria 3479
430 Ga0495651_0056530 3300046462 Bacteria 3014
431 Ga0495650_0000029 3300046471 Bacteria 453466
432 Ga0495650_0025861 3300046471 Bacteria 2741
433 Ga0495580_0008947 3300046472 Bacteria 7914
434 Ga0495580_0011827 3300046472 Bacteria 6734
435 Ga0495580_0182432 3300046472 Bacteria 1449
436 Ga0495582_0002145 3300046473 Bacteria 11036
437 Ga0495630_0022551 3300046517 Bacteria 4650
438 Ga0495630_0216487 3300046517 Bacteria 1462
439 Ga0495648_0104740 3300046524 Bacteria 1553
440 Ga0495665_0090057 3300046531 Bacteria 1612
441 Ga0495640_0064168 3300046533 Bacteria 2484
442 Ga0495587_0017918 3300046536 Bacteria 4392
443 Ga0495645_0012832 3300046543 Bacteria 5915
444 Ga0495625_0000429 3300046660 Bacteria 63350
445 Ga0495635_0049599 3300046663 Bacteria 2893
446 Ga0495646_0024987 3300046680 Bacteria 3759
447 Ga0495646_0154492 3300046680 Bacteria 1274
448 Ga0495658_0151996 3300046683 Bacteria 1422
449 Ga0495613_0199759 3300046689 Bacteria 1410
450 Ga0495600_0038344 3300046809 Bacteria 3118
451 Ga0495581_0039823 3300047315 Bacteria 2721
452 Ga0495604_0103897 3300047317 Bacteria 2083
453 Ga0495674_0081915 3300047319 Bacteria 2767
454 Ga0495674_0098027 3300047319 Bacteria 2497
455 Ga0495672_0004409 3300047320 Bacteria 11544
456 Ga0495675_0202977 3300047444 Bacteria 1206
457 Ga0495684_0163040 3300047471 Bacteria 1662
458 Ga0495684_0254007 3300047471 Bacteria 1278
459 Ga0495686_0000006 3300047472 Bacteria 770778
460 Ga0495602_0170475 3300048088 Bacteria 1690
461 Ga0496101_0056818 3300048904 Unclassified 2829
462 Ga0496102_0001923 3300048905 Bacteria 17876
463 Ga0496104_0015521 3300048907 Bacteria 6899
464 Ga0496104_0227180 3300048907 Bacteria 1779
465 Ga0496106_0211331 3300048909 Bacteria 1546
466 Ga0496107_0160862 3300048910 Unclassified 1664
467 Ga0496112_0021777 3300048915 Bacteria 6099
468 Ga0496112_0071720 3300048915 Bacteria 3423
469 Ga0496114_0054127 3300048917 Unclassified 3346
470 Ga0496114_0068943 3300048917 Bacteria 2969
471 Ga0496115_0007960 3300048918 Bacteria 7825
472 Ga0496115_0023112 3300048918 Unclassified 4823
473 Ga0496115_0058897 3300048918 Bacteria 3092
474 Ga0496115_0062359 3300048918 Bacteria 3007
475 Ga0496115_0090319 3300048918 Unclassified 2502
476 Ga0496115_0141332 3300048918 Bacteria 1986
477 Ga0496126_0000010 3300048929 Bacteria 744888
478 Ga0496126_0002319 3300048929 Bacteria 26104
479 Ga0496126_0003534 3300048929 Bacteria 19653
480 Ga0501047_0001149 3300049581 Bacteria 26253
481 Ga0501070_0057250 3300049586 Bacteria 3231
482 Ga0501070_0125096 3300049586 Bacteria 2125
483 Ga0501073_0037223 3300049589 Bacteria 3456
484 Ga0501074_0179361 3300049590 Bacteria 1511
485 Ga0501080_0269483 3300049742 Bacteria 1550
486 Ga0501035_0015199 3300049822 Bacteria 7105
487 Ga0501044_0015111 3300049823 Bacteria 8319
488 Ga0501044_0073548 3300049823 Bacteria 3474
489 nmdc:mga0n895_117212_c1 3300050512 Bacteria 2682
490 nmdc:mga0n895_1798_c1 3300050512 Bacteria 16290
491 nmdc:mga0n895_21587_c1 3300050512 Bacteria 6025
492 nmdc:mga0n895_26826_c1 3300050512 Bacteria 5463
493 nmdc:mga0rr50_24720_c1 3300050513 Unclassified 4166
494 nmdc:mga0rr50_62942_c1 3300050513 Bacteria 2800
495 nmdc:mga08x19_151434_c1 3300050514 Bacteria 1571
496 nmdc:mga08x19_2116_c1 3300050514 Bacteria 12135
497 nmdc:mga0a205_8763_c4 3300050515 Unclassified 4135
498 Ga0495601_0026509 3300053077 Bacteria 3579
499 Ga0500643_005767 3300053087 Bacteria 5282
500 Ga0500644_0006090 3300053088 Bacteria 3076
501 Ga0500651_0000004 3300053093 Bacteria 389879
502 Ga0500595_000012 3300053119 Bacteria 255472
503 Ga0500595_037099 3300053119 Bacteria 1592
504 Ga0500661_000268 3300055283 Bacteria 9407
505 Ga0070698_100021997
506 JGI25406J46586_10028695
507 Ga0070658_10000074
508 Ga0070658_10007639
509 Ga0070676_10020310
510 Ga0070683_100016838
511 Ga0070666_10011524
512 Ga0070680_100015404
513 Ga0070680_100179849
514 Ga0070682_100065806
515 Ga0070682_100183495
516 Ga0068868_100007498
517 Ga0068868_100008502
518 Ga0068868_100072833
519 Ga0070660_100023717
520 Ga0070660_100059289
521 Ga0070687_100172209
522 Ga0070661_100046644
523 Ga0070661_100064779
524 Ga0070661_100118954
525 Ga0070661_100284105
526 Ga0070668_100016586
527 Ga0070675_100008543
528 Ga0070675_100229761
529 Ga0070671_100003141
530 Ga0070674_100020890
531 Ga0070673_100012544
532 Ga0070659_100039687
533 Ga0070659_100079681
534 Ga0070667_100001492
535 Ga0070709_10005083
536 Ga0070709_10047844
537 Ga0070714_100026773
538 Ga0070714_100124882
539 Ga0070714_100155278
540 Ga0070714_100370180
541 Ga0070713_100000604
542 Ga0070713_100048152
543 Ga0070713_100062615
544 Ga0070713_100137426
545 Ga0070713_100187583
546 Ga0070711_100000332
547 Ga0070711_100017785
548 Ga0070705_100032060
549 Ga0070708_100106906
550 Ga0070663_100077077
551 Ga0070663_100102755
552 Ga0070678_100002412
553 Ga0070662_100011520
554 Ga0070681_10000149
555 Ga0070681_10004955
556 Ga0070681_10016164
557 Ga0070681_10064143
558 Ga0068867_100026087
559 Ga0068867_100087403
560 Ga0070706_100000969
561 Ga0070706_100058033
562 Ga0070707_100036601
563 Ga0070699_100128077
564 Ga0070699_100147497
565 Ga0070679_100009265
566 Ga0070679_100015240
567 Ga0070679_100098481
568 Ga0070679_100173637
569 Ga0070684_100001091
570 Ga0070684_100011843
571 Ga0070684_100013111
572 Ga0070684_100056494
573 Ga0070684_100160730
574 Ga0070684_100279814
575 Ga0070697_100000980
576 Ga0070697_100082097
577 Ga0068853_100013405
578 Ga0068853_100053076
579 Ga0068853_100127463
580 Ga0068853_100147950
581 Ga0070672_100018349
582 Ga0070693_100066752
583 Ga0070665_100008524
584 Ga0070665_100079860
585 Ga0070665_100223752
586 Ga0068855_100000665
587 Ga0068855_100002794
588 Ga0068855_100004052
589 Ga0068855_100006534
590 Ga0068855_100015376
591 Ga0068855_100017254
592 Ga0068855_100033705
593 Ga0068855_100073703
594 Ga0068855_100080769
595 Ga0068855_100085721
596 Ga0068855_100097911
597 Ga0068855_100103565
598 Ga0070664_100018585
599 Ga0070664_100043940
600 Ga0068857_100000281
601 Ga0068857_100017890
602 Ga0068857_100093051
603 Ga0068854_100004358
604 Ga0068854_100011621
605 Ga0068854_100035179
606 Ga0068854_100121108
607 Ga0068856_100000062
608 Ga0068856_100003896
609 Ga0068856_100012679
610 Ga0068856_100017210
611 Ga0068856_100021519
612 Ga0068856_100023136
613 Ga0068856_100065331
614 Ga0068856_100076430
615 Ga0068852_100005772
616 Ga0068852_100011993
617 Ga0068852_100030588
618 Ga0068859_100003559
619 Ga0068859_100095658
620 Ga0068864_100002079
621 Ga0068864_100090091
622 Ga0068866_10013381
623 Ga0068866_10021124
624 Ga0068866_10159119
625 Ga0068863_100008890
626 Ga0068863_100040867
627 Ga0068863_100085791
628 Ga0068863_100095739
629 Ga0068858_100001572
630 Ga0068858_100016378
631 Ga0068858_100061749
632 Ga0068858_100253145
633 Ga0081540_1022117
634 Ga0081539_10016163
635 Ga0070717_10007004
636 Ga0070717_10007022
637 Ga0070717_10340088
638 Ga0070716_100000127
639 Ga0070716_100003388
640 Ga0070716_100004078
641 Ga0070716_100047004
642 Ga0070712_100000034
643 Ga0070712_100001048
644 Ga0070712_100001302
645 Ga0070712_100027912
646 Ga0097621_100000397
647 Ga0097621_100001719
648 Ga0097621_100079291
649 Ga0097621_100153544
650 Ga0068871_100000408
651 Ga0068871_100000533
652 Ga0068871_100057016
653 Ga0068871_100064071
654 Ga0068871_100156140
655 Ga0075434_100001429
656 Ga0075434_100031017
657 Ga0075434_100031991
658 Ga0075434_100040177
659 Ga0075434_100044948
660 Ga0068865_100074193
661 Ga0075436_100001245
662 Ga0075436_100084327
663 Ga0097620_100003559
664 Ga0097620_100095655
665 Ga0075435_100024139
666 Ga0075435_100091934
667 Ga0099794_10020114
668 Ga0099794_10105217
669 Ga0105240_10000002
670 Ga0105240_10007375
671 Ga0105240_10007417
672 Ga0105240_10007543
673 Ga0105240_10020944
674 Ga0105240_10060351
675 Ga0105240_10150547
676 Ga0105240_10201389
677 Ga0105240_10211378
678 Ga0105240_10268627
679 Ga0105247_10092785
680 Ga0105243_10268175
681 Ga0105241_10005610
682 Ga0105241_10009613
683 Ga0105241_10055805
684 Ga0105241_10068136
685 Ga0105242_10042658
686 Ga0105242_10062195
687 Ga0105242_10353894
688 Ga0105248_10000006
689 Ga0105248_10104443
690 Ga0105248_10112228
691 Ga0105248_10116379
692 Ga0105237_10006035
693 Ga0105237_10067438
694 Ga0105237_10182329
695 Ga0105237_10277301
696 Ga0105238_10000465
697 Ga0105238_10088797
698 Ga0105238_10305824
699 Ga0105249_10167021
700 Ga0105239_10023676
701 Ga0105239_10105455
702 Ga0105246_10025255
703 Ga0157373_10028413
704 Ga0157371_10023759
705 Ga0157371_10073861
706 Ga0157371_10082729
707 Ga0157370_10006716
708 Ga0157370_10008095
709 Ga0157370_10010889
710 Ga0157370_10020529
711 Ga0157370_10029942
712 Ga0157370_10039327
713 Ga0157370_10229551
714 Ga0157370_10401202
715 Ga0157369_10000159
716 Ga0157369_10000711
717 Ga0157369_10001181
718 Ga0157369_10005800
719 Ga0157369_10010315
720 Ga0157369_10098295
721 Ga0157369_10494982
722 Ga0157374_10000062
723 Ga0157374_10000143
724 Ga0157374_10013101
725 Ga0157374_10037613
726 Ga0157374_10125584
727 Ga0157378_10000009
728 Ga0157378_10000345
729 Ga0157378_10000437
730 Ga0157378_10003843
731 Ga0157378_10010908
732 Ga0157378_10025690
733 Ga0157378_10152329
734 Ga0163162_10005740
735 Ga0157372_10000140
736 Ga0157372_10000709
737 Ga0157372_10004964
738 Ga0157372_10008669
739 Ga0157372_10008976
740 Ga0157372_10009805
741 Ga0157372_10011908
742 Ga0157372_10027204
743 Ga0157372_10028731
744 Ga0157372_10046194
745 Ga0157372_10049877
746 Ga0157372_10069938
747 Ga0157372_10276771
748 Ga0157375_10049126
749 Ga0157375_10296308
750 Ga0157379_10004279
751 Ga0157379_10021771
752 Ga0157379_10036197
753 Ga0157376_10000004
754 Ga0157376_10000782
755 Ga0157376_10020396
756 Ga0157376_10056143
757 Ga0157376_10069226
758 Ga0157376_10080688
759 Ga0213872_10000758
760 Ga0213872_10003660
761 Ga0213874_10017283
762 Ga0213876_10040052
763 Ga0213875_10013240
764 Ga0213875_10020211
765 Ga0213875_10032295
766 Ga0213871_10011039
767 Ga0209233_1004434
768 Ga0207680_10041744
769 Ga0207647_10038785
770 Ga0207647_10042100
771 Ga0207699_10011476
772 Ga0207699_10037837
773 Ga0207699_10110552
774 Ga0207645_10006409
775 Ga0207705_10000034
776 Ga0207705_10000445
777 Ga0207684_10003216
778 Ga0207654_10002672
779 Ga0207654_10013483
780 Ga0207707_10005618
781 Ga0207707_10044775
782 Ga0207707_10215090
783 Ga0207695_10000002
784 Ga0207695_10006367
785 Ga0207695_10010056
786 Ga0207695_10013036
787 Ga0207695_10040271
788 Ga0207695_10090136
789 Ga0207695_10111836
790 Ga0207695_10111924
791 Ga0207695_10158090
792 Ga0207693_10000012
793 Ga0207693_10000032
794 Ga0207693_10000087
795 Ga0207693_10002109
796 Ga0207693_10111679
797 Ga0207663_10000318
798 Ga0207663_10011099
799 Ga0207660_10121510
800 Ga0207657_10004722
801 Ga0207657_10008243
802 Ga0207657_10027477
803 Ga0207649_10010177
804 Ga0207652_10013147
805 Ga0207652_10020702
806 Ga0207652_10112506
807 Ga0207652_10309448
808 Ga0207694_10002542
809 Ga0207650_10059022
810 Ga0207659_10076493
811 Ga0207659_10259598
812 Ga0207700_10000459
813 Ga0207700_10000925
814 Ga0207700_10137468
815 Ga0207700_10147875
816 Ga0207664_10051595
817 Ga0207664_10070731
818 Ga0207690_10025330
819 Ga0207690_10067806
820 Ga0207706_10000042
821 Ga0207706_10003254
822 Ga0207686_10071278
823 Ga0207704_10012638
824 Ga0207704_10044959
825 Ga0207704_10114650
826 Ga0207665_10000008
827 Ga0207665_10006564
828 Ga0207665_10007294
829 Ga0207665_10009392
830 Ga0207665_10022677
831 Ga0207665_10044533
832 Ga0207665_10143879
833 Ga0207691_10125982
834 Ga0207711_10000007
835 Ga0207711_10042083
836 Ga0207711_10064322
837 Ga0207689_10059430
838 Ga0207661_10005780
839 Ga0207661_10037550
840 Ga0207661_10123755
841 Ga0207679_10009605
842 Ga0207679_10015822
843 Ga0207667_10000841
844 Ga0207667_10001005
845 Ga0207667_10001309
846 Ga0207667_10003454
847 Ga0207667_10014208
848 Ga0207667_10053593
849 Ga0207667_10110090
850 Ga0207667_10128174
851 Ga0207667_10209104
852 Ga0207667_10353187
853 Ga0207651_10043653
854 Ga0207668_10149589
855 Ga0207668_10163135
856 Ga0207640_10033787
857 Ga0207640_10138821
858 Ga0207677_10006051
859 Ga0207677_10036676
860 Ga0207703_10004217
861 Ga0207703_10018348
862 Ga0207703_10045493
863 Ga0207703_10048426
864 Ga0207639_10011383
865 Ga0207678_10005183
866 Ga0207678_10008713
867 Ga0207678_10034148
868 Ga0207678_10037140
869 Ga0207702_10000733
870 Ga0207702_10002408
871 Ga0207702_10011469
872 Ga0207702_10044027
873 Ga0207702_10061046
874 Ga0207702_10082272
875 Ga0207702_10099447
876 Ga0207702_10139414
877 Ga0207641_10006994
878 Ga0207641_10007367
879 Ga0207641_10100450
880 Ga0207648_10032073
881 Ga0207648_10256596
882 Ga0207676_10003353
883 Ga0207676_10027216
884 Ga0207674_10003141
885 Ga0207674_10003483
886 Ga0207674_10121782
887 Ga0207674_10208226
888 Ga0207683_10001284
889 Ga0207698_10006635
890 Ga0207698_10021285
891 Ga0207698_10059877
892 Ga0268266_10000366
893 Ga0268266_10005591
894 Ga0268266_10020813
895 Ga0268266_10042139
896 Ga0265338_10004299
897 Ga0265338_10063045
898 Ga0265762_1000029
899 Ga0265320_10004250
900 Ga0265325_10006906
901 Ga0265329_10038405
902 Ga0265339_10033750
903 Ga0265316_10152221
904 Ga0265314_10011283
905 Ga0307510_10032315
906 Ga0307510_10050696
907 Ga0373943_0141214
908 Ga0373947_0050160
909 Ga0373937_0004896
910 Ga0373937_0273803
911 Ga0395900_0371408
912 Ga0395898_0128753
913 Ga0436364_0011216
914 Ga0436364_0118817
915 Ga0436364_0178906
916 Ga0436364_1144642
917 Ga0436364_1243158
918 Ga0436365_1355351
919 Ga0436365_1684423
920 Ga0436365_1901564
921 Ga0436361_0902439
922 Ga0436361_1096304
923 Ga0436361_1130897
924 Ga0436363_0043325
925 Ga0436363_0839491
926 Ga0436363_1111764
927 Ga0436362_0562575
928 Ga0451576_0332201
929 Ga0466967_0005957
930 Ga0466967_0056974
931 Ga0466967_0326444
932 Ga0495629_0023607
933 Ga0495651_0043613
934 Ga0495651_0056530
935 Ga0495650_0000029
936 Ga0495650_0025861
937 Ga0495580_0008947
938 Ga0495580_0011827
939 Ga0495580_0182432
940 Ga0495582_0002145
941 Ga0495630_0022551
942 Ga0495630_0216487
943 Ga0495648_0104740
944 Ga0495665_0090057
945 Ga0495640_0064168
946 Ga0495587_0017918
947 Ga0495645_0012832
948 Ga0495625_0000429
949 Ga0495635_0049599
950 Ga0495646_0024987
951 Ga0495646_0154492
952 Ga0495658_0151996
953 Ga0495613_0199759
954 Ga0495600_0038344
955 Ga0495581_0039823
956 Ga0495604_0103897
957 Ga0495674_0081915
958 Ga0495674_0098027
959 Ga0495672_0004409
960 Ga0495675_0202977
961 Ga0495684_0163040
962 Ga0495684_0254007
963 Ga0495686_0000006
964 Ga0495602_0170475
965 Ga0496101_0056818
966 Ga0496102_0001923
967 Ga0496104_0015521
968 Ga0496104_0227180
969 Ga0496106_0211331
970 Ga0496107_0160862
971 Ga0496112_0021777
972 Ga0496112_0071720
973 Ga0496114_0054127
974 Ga0496114_0068943
975 Ga0496115_0007960
976 Ga0496115_0023112
977 Ga0496115_0058897
978 Ga0496115_0062359
979 Ga0496115_0090319
980 Ga0496115_0141332
981 Ga0496126_0000010
982 Ga0496126_0002319
983 Ga0496126_0003534
984 Ga0501047_0001149
985 Ga0501070_0057250
986 Ga0501070_0125096
987 Ga0501073_0037223
988 Ga0501074_0179361
989 Ga0501080_0269483
990 Ga0501035_0015199
991 Ga0501044_0015111
992 Ga0501044_0073548
993 nmdc:mga0n895_117212_c1
994 nmdc:mga0n895_1798_c1
995 nmdc:mga0n895_21587_c1
996 nmdc:mga0n895_26826_c1
997 nmdc:mga0rr50_24720_c1
998 nmdc:mga0rr50_62942_c1
999 nmdc:mga08x19_151434_c1
1000 nmdc:mga08x19_2116_c1
1001 nmdc:mga0a205_8763_c4
1002 Ga0495601_0026509
1003 Ga0500643_005767
1004 Ga0500644_0006090
1005 Ga0500651_0000004
1006 Ga0500595_000012
1007 Ga0500595_037099
1008 Ga0500661_000268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vc7-assembly1.cif.gz_A structure of the f349a mutant of the periplasmic domain of yejm from salmonella typhimurium 0.6902 52 376
6v8q-assembly2.cif.gz_B structure of an inner membrane protein required for phopq regulated increases in outer membrane cardiolipin 0.675 52 389
6v8q-assembly1.cif.gz_A structure of an inner membrane protein required for phopq regulated increases in outer membrane cardiolipin 0.6724 52 369
6xlp-assembly1.cif.gz_A structure of the essential inner membrane lipopolysaccharide-pbga complex 0.6525 52 389
6vdf-assembly1.cif.gz_A structure of the periplasmic domain of yejm from salmonella typhimurium (twinned) 0.6487 52 376
ID Description Score Start End Superfamily
af_E7FE54_66_340_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7445 53 388 3.40.720.10
af_E7FE54_66_340_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7348 53 388 3.40.720.10
5udyA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7169 53 382 3.40.720.10
5eghA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6886 53 383 3.40.720.10
af_A1ZB84_62_350_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6871 40 385 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A372IK06-F1-model_v4 Metalloenzyme domain-containing protein 0.9475 57 389
AF-A0A1I6MDD2-F1-model_v4 Type I phosphodiesterase / nucleotide pyrophosphatase 0.9448 56 389
AF-A0A2W0AWD8-F1-model_v4 Metalloenzyme domain-containing protein 0.9421 65 389
AF-A0A1I6MDD2-F1-model_v4 Type I phosphodiesterase / nucleotide pyrophosphatase 0.9393 56 389
AF-A0A2W0AWD8-F1-model_v4 Metalloenzyme domain-containing protein 0.9393 65 389

Map