F456124

General Info

Members Datasets Scaffolds Average Seq Length
504 478 1008 231

Family's Representative Sequence

Representative Sequence 3300002739|JGI25158J39367_1005186|JGI25158J39367_10051861
Length 271
Sequence MTRTLYDLFASYSVRVNGRGSTFIVFPAKFDGLIDEEDGMAAKSSGTRTKRSPRANVKRQPGQEPRSDASLSLERIVTTAVELLDAEGVDGLTMRRLADRCGSGXMSLYWHVDTKEDVFDLALDSVLEYRGPWQTGESQDWRSEVVHMLEDWRASMLRHPWSALLLPSRALGANVLGRLELLGTALSRAGVADADLNVTIWSLWNHVLGATVTLASFDRSDEDKAAAQQRLTQLSERYPTIERSRLLLDNDWDGTFRKGLDFLLDGLTPKQ

Samples

Sample ID Description Type Environment
1 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
31 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
32 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
33 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
34 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
36 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
53 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
54 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
55 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
56 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
59 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
60 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
61 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
62 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
63 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
66 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
70 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
71 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
72 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
73 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
74 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
75 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
76 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
77 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
78 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
79 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
80 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
81 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
82 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
83 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
84 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
85 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
86 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
87 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
88 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
89 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
90 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
91 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
92 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
93 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
94 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
95 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
96 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
97 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
98 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
99 2516143018 Ensifer sp. BR816 Isolate Nodule
100 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
101 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
102 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
103 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
104 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
105 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
106 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
107 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
108 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
109 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
110 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
111 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
112 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
113 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
114 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
115 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
116 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
117 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
118 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
119 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
120 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
121 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
122 2643221607 Rhizobium sp. Root73 Isolate Unclassified
123 2643221626 Ensifer sp. Root31 Isolate Unclassified
124 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
125 2643221655 Ensifer sp. Root1252 Isolate Unclassified
126 2643221659 Ensifer sp. Root127 Isolate Unclassified
127 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
128 2643221698 Ensifer sp. Root142 Isolate Unclassified
129 2643221712 Ensifer sp. Root258 Isolate Unclassified
130 2643221723 Ensifer sp. Root278 Isolate Unclassified
131 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
132 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
133 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
134 2718217927 Rhizobium sp. N324 Isolate Nodule
135 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
136 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
137 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
138 2718218423 Rhizobium sp. N941 Isolate Nodule
139 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
140 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
141 2721755809 Rhizobium sp. N541 Isolate Nodule
142 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
143 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
144 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
145 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
146 2738543024 Aminobacter sp. AP02 Isolate Unclassified
147 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
148 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
149 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
150 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
151 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
152 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
153 2791355264 Rhizobium sp. S9 Isolate Nodule
154 2791355265 Rhizobium sp. H4 Isolate Nodule
155 2791355266 Rhizobium sp. L43 Isolate Nodule
156 2791355267 Rhizobium sp. L18 Isolate Nodule
157 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
158 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
159 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
160 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
161 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
162 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
163 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
164 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
165 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
166 2802429633 Rhizobium anhuiense J3 Isolate Nodule
167 2802429634 Rhizobium anhuiense S10 Isolate Nodule
168 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
169 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
170 2802429637 Rhizobium anhuiense C15 Isolate Nodule
171 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
172 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
173 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
174 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
175 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
176 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
177 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
178 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
179 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
180 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
181 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
182 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
183 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
184 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
185 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
186 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
187 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
188 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
189 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
190 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
191 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
192 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
193 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
194 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
195 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
196 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
197 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
198 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
199 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
200 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
201 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
202 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
203 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
204 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
205 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
206 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
207 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
208 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
209 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
210 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
211 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
212 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
213 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
214 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
215 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
216 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
217 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
218 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
219 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
220 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
221 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
222 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
223 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
224 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
225 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
226 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
227 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
228 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
229 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
230 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
231 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
232 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
233 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
234 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
235 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
236 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
237 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
238 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
239 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
240 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
241 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
242 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
243 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
244 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
245 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
246 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
247 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
248 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
249 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
250 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
251 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
252 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
253 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
254 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
255 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
256 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
257 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
258 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
259 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
260 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
261 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
262 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
263 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
264 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
265 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
266 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
267 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
268 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
269 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
270 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
271 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
272 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
273 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
274 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
275 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
276 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
277 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
278 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
279 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
280 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
281 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
282 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
283 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
284 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
285 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
286 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
287 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
288 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
289 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
290 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
291 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
292 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
293 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
294 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
295 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
296 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
297 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
298 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
299 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
300 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
301 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
302 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
303 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
304 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
305 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
306 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
307 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
308 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
309 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
310 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
311 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
312 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
313 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
314 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
315 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
316 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
317 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
318 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
319 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
320 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
321 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
322 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
323 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
324 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
325 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
326 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
327 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
328 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
329 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
330 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
331 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
332 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
333 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
334 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
335 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
336 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
337 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
338 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
339 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
340 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
341 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
342 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
343 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
344 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
345 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
346 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
347 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
348 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
349 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
350 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
351 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
352 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
353 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
354 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
355 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
356 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
357 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
358 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
359 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
360 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
361 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
362 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
363 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
364 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
365 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
366 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
367 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
368 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
369 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
370 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
371 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
372 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
373 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
374 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
375 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
376 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
377 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
378 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
379 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
380 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
381 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
382 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
383 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
384 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
385 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
386 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
387 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
388 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
389 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
390 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
391 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
392 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
393 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
394 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
395 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
396 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
397 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
398 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
399 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
400 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
401 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
402 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
403 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
404 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
405 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
406 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
407 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
408 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
409 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
410 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
411 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
412 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
413 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
414 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
415 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
416 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
417 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
418 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
419 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
420 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
421 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
422 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
423 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
424 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
425 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
426 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
427 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
428 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
429 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
430 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
431 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
432 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
433 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
434 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
435 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
436 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
437 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
438 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
439 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
440 2996893221 Rhizobium sp. R635 Isolate Nodule
441 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
442 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
443 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
444 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
445 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
446 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
447 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
448 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
449 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
450 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
451 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
452 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
453 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
454 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
455 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
456 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
457 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
458 8005275841 Rhizobium sp. N4311 Isolate Nodule
459 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
460 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
461 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
462 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
463 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
464 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
465 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
466 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
467 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
468 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
469 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
470 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
471 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
472 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
473 8018176218 Rhizobium sp. N122 Isolate Nodule
474 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
475 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
476 8024501048 Rhizobium sp. H4 Isolate Nodule
477 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
478 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 19.64
Metatranscriptomes 0
Isolates 80.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.71
Nodule 73.41
Rhizoplane 0.6
Rhizosphere 5.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1005186 3300002739 Bacteria 1919
2 JGI25159J45721_1000068 3300002987 Bacteria 49966
3 JGI25151J46595_10004416 3300003187 Bacteria 7446
4 JGI25153J46596_10042846 3300003215 Bacteria 1377
5 rootH2_10046321 3300003320 Bacteria 1135
6 rootH2_10091725 3300003320 Bacteria 2565
7 JGI25160J50197_1000199 3300003354 Bacteria 49966
8 JGI25161J50226_1006144 3300003374 Bacteria 2217
9 Ga0055542_1000495 3300003762 Bacteria 36159
10 Ga0055526_1002140 3300003771 Bacteria 13539
11 Ga0055524_1001735 3300003775 Bacteria 12094
12 Ga0055524_1028521 3300003775 Bacteria 1670
13 Ga0055536_1019410 3300003781 Bacteria 2138
14 Ga0055528_1000475 3300003790 Bacteria 32037
15 Ga0055540_1000227 3300003792 Bacteria 52847
16 Ga0055543_1000194 3300004625 Bacteria 50004
17 Ga0055543_1001652 3300004625 Bacteria 8502
18 Ga0065165_1000655 3300005262 Bacteria 50004
19 Ga0065165_1033181 3300005262 Bacteria 1609
20 Ga0068853_100457980 3300005539 Bacteria 1200
21 Ga0070665_100040439 3300005548 Bacteria 4687
22 Ga0070665_100051900 3300005548 Bacteria 4113
23 Ga0070665_100366643 3300005548 Bacteria 1447
24 Ga0081538_10009686 3300005981 Bacteria 7999
25 Ga0075365_10015925 3300006038 Bacteria 4559
26 Ga0075365_10020172 3300006038 Bacteria 4128
27 Ga0075365_10036701 3300006038 Bacteria 3177
28 Ga0075363_100032062 3300006048 Bacteria 2727
29 Ga0075362_10013087 3300006177 Bacteria 3312
30 Ga0075367_10029716 3300006178 Bacteria 3129
31 Ga0075366_10034142 3300006195 Bacteria 2996
32 Ga0075370_10024096 3300006353 Bacteria 3358
33 Ga0105240_10455220 3300009093 Bacteria 1431
34 Ga0105033_100758 3300009986 Bacteria 2518
35 Ga0105239_10086612 3300010375 Bacteria 3453
36 Ga0171463_1016 3300013249 Bacteria 62129
37 Ga0157376_10134744 3300014969 Bacteria 2209
38 Ga0183363_1100 3300015690 Bacteria 24468
39 Ga0214544_1003342 3300021320 Bacteria 33254
40 Ga0214542_1001482 3300021321 Bacteria 48143
41 Ga0214543_1001272 3300021327 Bacteria 48176
42 Ga0214543_1004822 3300021327 Bacteria 25338
43 Ga0209436_101636 3300025208 Bacteria 7485
44 Ga0209129_1011433 3300025258 Bacteria 2119
45 Ga0209129_1014827 3300025258 Bacteria 1639
46 Ga0209673_1000922 3300025273 Bacteria 37220
47 Ga0209130_1000378 3300025284 Bacteria 50018
48 Ga0209676_1002040 3300025292 Bacteria 15801
49 Ga0209025_1000114 3300025294 Bacteria 218921
50 Ga0209025_1000205 3300025294 Bacteria 141452
51 Ga0209025_1000372 3300025294 Bacteria 94142
52 Ga0209025_1053402 3300025294 Bacteria 1586
53 Ga0209564_1001208 3300025295 Bacteria 29493
54 Ga0209564_1002391 3300025295 Bacteria 15000
55 Ga0209564_1041503 3300025295 Bacteria 1233
56 Ga0209758_1000567 3300025297 Bacteria 58201
57 Ga0209758_1002625 3300025297 Bacteria 17862
58 Ga0209758_1002670 3300025297 Bacteria 17613
59 Ga0209050_1004082 3300025298 Bacteria 10215
60 Ga0209050_1034965 3300025298 Bacteria 1493
61 Ga0209256_1000153 3300025299 Bacteria 144736
62 Ga0209256_1001267 3300025299 Bacteria 27586
63 Ga0209256_1003442 3300025299 Bacteria 11105
64 Ga0207426_1000538 3300025302 Bacteria 54233
65 Ga0207426_1000567 3300025302 Bacteria 50019
66 Ga0209051_1000288 3300025303 Bacteria 80746
67 Ga0209051_1024289 3300025303 Bacteria 2495
68 Ga0209051_1091699 3300025303 Bacteria 843
69 Ga0209257_1004713 3300025304 Bacteria 10228
70 Ga0209257_1005415 3300025304 Bacteria 8978
71 Ga0207654_10047158 3300025911 Bacteria 2461
72 Ga0207639_10378974 3300026041 Bacteria 1270
73 Ga0207639_10571448 3300026041 Bacteria 1040
74 Ga0209281_1001068 3300027111 Bacteria 20481
75 Ga0268266_10026390 3300028379 Bacteria 4942
76 Ga0307513_10005704 3300031456 Bacteria 16381
77 Ga0451802_1550926 3300041460 Bacteria 1525
78 Ga0451849_0362522 3300041505 Bacteria 1602
79 Ga0451851_0534480 3300041507 Bacteria 6123
80 Ga0451853_3443962 3300041512 Bacteria 1693
81 Ga0439431_0090061 3300041997 Bacteria 835
82 Ga0439449_0028006 3300042007 Bacteria 2101
83 Ga0495605_0110906 3300046474 Bacteria 1252
84 Ga0495607_0044717 3300046501 Bacteria 2609
85 Ga0495597_0004766 3300046542 Bacteria 7334
86 Ga0495625_0142401 3300046660 Bacteria 1616
87 Ga0495660_0017212 3300046810 Bacteria 4163
88 Ga0495685_118621 3300047447 Bacteria 869
89 Ga0496105_0513954 3300048908 Bacteria 939
90 Ga0496117_0261032 3300048920 Bacteria 939
91 Ga0496118_0008537 3300048921 Bacteria 10568
92 Ga0496121_0108351 3300048924 Bacteria 2125
93 Ga0501034_0586754 3300049571 Bacteria 1021
94 nmdc:mga03n38_102525_c1 3300050490 Bacteria 1382
95 nmdc:mga0yw44_29723_c1 3300050492 Bacteria 3157
96 nmdc:mga0yw44_76993_c1 3300050492 Bacteria 2083
97 nmdc:mga07m45_280196_c1 3300050496 Bacteria 970
98 Ga0500658_0000540 3300053134 Bacteria 15962
99 Ga0500568_0000175 3300053139 Bacteria 56086
100 2503200384 2503198000 Bacteria 6884444
101 2509373638 2509276018 Bacteria 6910194
102 2509388057 2509276021 Bacteria 7634384
103 2509443644 2509276033 Bacteria 7180565
104 2510131732 2510065019 Bacteria 6903379
105 2510317206 2510065059 Bacteria 6847884
106 2511392850 2511231027 Bacteria 5013807
107 2511499064 2511231052 Bacteria 6974333
108 2512531710 2512047086 Bacteria 6850303
109 2513571309 2513237084 Bacteria 7231967
110 2513579127 2513237085 Bacteria 7695351
111 2513582376 2513237086 Bacteria 7265287
112 2513602208 2513237089 Bacteria 6553624
113 2513616076 2513237091 Bacteria 6900273
114 2513632406 2513237093 Bacteria 7545552
115 2513711737 2513237103 Bacteria 7647401
116 2513884722 2513237140 Bacteria 7076289
117 2513905117 2513237143 Bacteria 6664116
118 2513987624 2513237156 Bacteria 6402557
119 2514003795 2513237160 Bacteria 6650282
120 2514023359 2513237162 Bacteria 7468464
121 2514416851 2513237305 Bacteria 7293571
122 2515110678 2515075009 Bacteria 7288508
123 2515607484 2515154107 Bacteria 6795637
124 2515742819 2515154134 Bacteria 7220242
125 2516208160 2516143018 Bacteria 6951533
126 2516891612 2516653046 Bacteria 6989037
127 2517039378 2516653077 Bacteria 7555578
128 2517079620 2516653085 Bacteria 7346596
129 2517405251 2517287029 Bacteria 6905599
130 2517570860 2517487022 Bacteria 7227575
131 2524450774 2524023207 Bacteria 6813453
132 2530644243 2529292951 Bacteria 6916614
133 2551680011 2551306084 Bacteria 8942552
134 2551683634 2551306085 Bacteria 7347181
135 2551690742 2551306086 Bacteria 6843938
136 2551703632 2551306087 Bacteria 7351905
137 2551708699 2551306089 Bacteria 7162724
138 2551722404 2551306090 Bacteria 7953713
139 2551729421 2551306091 Bacteria 7086830
140 2551734884 2551306092 Bacteria 6992595
141 2551741912 2551306093 Bacteria 7064773
142 2585385476 2582581865 Bacteria 6644329
143 2585528568 2585427526 Bacteria 7258840
144 2585540022 2585427528 Bacteria 6842387
145 2585838003 2585427593 Bacteria 7141551
146 2600197072 2599185352 Bacteria 7228948
147 2616292629 2615840624 Bacteria 6557588
148 2644049602 2643221607 Bacteria 6314006
149 2644146087 2643221626 Bacteria 8069654
150 2644203990 2643221636 Bacteria 6583769
151 2644308886 2643221655 Bacteria 7722067
152 2644332711 2643221659 Bacteria 7890716
153 2644482635 2643221686 Bacteria 6310811
154 2644540113 2643221698 Bacteria 7756764
155 2644614827 2643221712 Bacteria 7729434
156 2644674111 2643221723 Bacteria 7095460
157 2657681389 2657244999 Bacteria 5946535
158 2688599219 2687453392 Bacteria 6880454
159 2692317815 2690316117 Bacteria 6800650
160 2719384526 2718217927 Bacteria 6972593
161 2719665440 2718217997 Bacteria 6740740
162 2720491860 2718218199 Bacteria 6740745
163 2720613127 2718218232 Bacteria 6720332
164 2721398236 2718218423 Bacteria 6438183
165 2723026772 2721755556 Bacteria 6745503
166 2723576161 2721755686 Bacteria 7343952
167 2724037048 2721755809 Bacteria 6438790
168 2724110030 2721755823 Bacteria 6752556
169 2725952098 2724679232 Bacteria 7646494
170 2730107708 2728369352 Bacteria 6745171
171 2739034889 2738541333 Bacteria 7106503
172 2739307058 2738543024 Bacteria 5603683
173 2766062497 2765235942 Bacteria 7445910
174 2776272403 2775506902 Bacteria 6208009
175 2776284343 2775506904 Bacteria 5954060
176 2792627360 2791355092 Bacteria 6248105
177 2792642227 2791355094 Bacteria 7011481
178 2793319050 2791355259 Bacteria 7254731
179 2793350521 2791355264 Bacteria 6429314
180 2793352449 2791355265 Bacteria 6539969
181 2793360851 2791355266 Bacteria 7116587
182 2793368117 2791355267 Bacteria 7222458
183 2802718049 2802428858 Bacteria 6636079
184 2802725100 2802428859 Bacteria 6667919
185 2802730776 2802428860 Bacteria 6525526
186 2802738123 2802428861 Bacteria 6534206
187 2802744007 2802428862 Bacteria 6633353
188 2802750886 2802428863 Bacteria 6410669
189 2804752584 2802429268 Bacteria 6094027
190 2805931112 2802429605 Bacteria 6875453
191 2805935700 2802429606 Bacteria 6346811
192 2806044176 2802429633 Bacteria 7341974
193 2806052012 2802429634 Bacteria 7083200
194 2806058314 2802429635 Bacteria 7650140
195 2806069218 2802429636 Bacteria 7597525
196 2806074545 2802429637 Bacteria 7067217
197 2821444234 2821443989 Bacteria 7658172
198 2838021083 2838016132 Bacteria 6577831
199 2838048279 2838042994 Bacteria 6046894
200 2838673940 2838668709 Bacteria 6671819
201 2838692356 2838686498 Bacteria 7807632
202 2838706422 2838701080 Bacteria 6669771
203 2838732548 2838729681 Bacteria 7400765
204 2838745443 2838742623 Bacteria 7396178
205 2841855087 2841851746 Bacteria 7532261
206 2841866464 2841864319 Bacteria 6742987
207 2842117682 2842110456 Bacteria 7656360
208 2842148756 2842146304 Bacteria 5957337
209 2842161883 2842156927 Bacteria 6894975
210 2842169259 2842163707 Bacteria 6916235
211 2842185500 2842180545 Bacteria 6888678
212 2842206224 2842205361 Bacteria 6340321
213 2842233438 2842229732 Bacteria 7475766
214 2842249632 2842243621 Bacteria 7421798
215 2842256058 2842250916 Bacteria 6579627
216 2842261701 2842257432 Bacteria 7401195
217 2842268102 2842264693 Bacteria 6472963
218 2842276825 2842271015 Bacteria 7807131
219 2842279681 2842278818 Bacteria 6340002
220 2842286320 2842285085 Bacteria 6011953
221 2842306207 2842304105 Bacteria 7023636
222 2842318096 2842317721 Bacteria 6793725
223 2842342718 2842341865 Bacteria 7003929
224 2842408061 2842402390 Bacteria 6681310
225 2842414822 2842409023 Bacteria 6687331
226 2842421295 2842415677 Bacteria 6596907
227 2842431661 2842428310 Bacteria 6767288
228 2842438378 2842434925 Bacteria 6502746
229 2842445009 2842441272 Bacteria 6769273
230 2842466033 2842462802 Bacteria 6588055
231 2842472993 2842469257 Bacteria 6752936
232 2842492939 2842489311 Bacteria 6620893
233 2842496366 2842495871 Bacteria 6820686
234 2842873685 2842871566 Bacteria 4827117
235 2842923422 2842922631 Bacteria 5824079
236 2844014392 2844009547 Bacteria 6728125
237 2844455702 2844454524 Bacteria 7952546
238 2844535574 2844533157 Bacteria 7517899
239 2855827978 2855825444 Bacteria 6785811
240 2855839751 2855839649 Bacteria 7135830
241 2856329167 2856328259 Bacteria 6528202
242 2856341920 2856334872 Bacteria 7037011
243 2856346831 2856342000 Bacteria 7176905
244 2857375351 2857367948 Bacteria 6965560
245 2857523964 2857516855 Bacteria 7787325
246 2858803628 2858800743 Bacteria 6603254
247 2869175425 2869169390 Bacteria 6659796
248 2869241084 2869234852 Bacteria 6654993
249 2869248307 2869242130 Bacteria 6609239
250 2869250119 2869249662 Bacteria 6868783
251 2869260971 2869256925 Bacteria 6981691
252 2869270477 2869264136 Bacteria 6880765
253 2869273054 2869271264 Bacteria 6908218
254 2871438728 2871435913 Bacteria 6880295
255 2871451984 2871451962 Bacteria 7336357
256 2871464630 2871459585 Bacteria 6866887
257 2871482457 2871481445 Bacteria 6700002
258 2874110405 2874109183 Bacteria 6517025
259 2874118802 2874116593 Bacteria 6674494
260 2874135673 2874131515 Bacteria 6820270
261 2874164216 2874162495 Bacteria 6174670
262 2876390510 2876386047 Bacteria 6698674
263 2876403272 2876399893 Bacteria 6927900
264 2876411487 2876406927 Bacteria 6191900
265 2876421967 2876420981 Bacteria 6687741
266 2878778394 2878774303 Bacteria 6108671
267 2878784505 2878781027 Bacteria 6834456
268 2888348479 2888343758 Bacteria 6611049
269 2896385047 2896384573 Bacteria 7700774
270 2903516776 2903513507 Bacteria 6344008
271 2906366834 2906363423 Bacteria 6856682
272 2906371889 2906370794 Bacteria 6881062
273 2906386920 2906386501 Bacteria 5977019
274 2906395420 2906393657 Bacteria 6790866
275 2906407701 2906401398 Bacteria 6693206
276 2906414291 2906408224 Bacteria 6162342
277 2915988891 2915986958 Bacteria 6739310
278 2915997241 2915993759 Bacteria 7016183
279 2916019087 2916014648 Bacteria 6946486
280 2916072193 2916068649 Bacteria 6943657
281 2920826351 2920822456 Bacteria 6897201
282 2921207512 2921201388 Bacteria 6926299
283 2921242734 2921237296 Bacteria 6876710
284 2921262757 2921257292 Bacteria 6808382
285 2921289873 2921289301 Bacteria 7316391
286 2922152260 2922151315 Bacteria 6902399
287 2922173034 2922172374 Bacteria 6167644
288 2922179673 2922178524 Bacteria 6025201
289 2924148854 2924144063 Bacteria 6883928
290 2924154298 2924150972 Bacteria 7169444
291 2924164672 2924158325 Bacteria 7188855
292 2924170819 2924165586 Bacteria 7260590
293 2924189461 2924186466 Bacteria 6876637
294 2924200162 2924193448 Bacteria 6955718
295 2924211708 2924207177 Bacteria 6917007
296 2924214675 2924214083 Bacteria 7080103
297 2924226380 2924221636 Bacteria 7113495
298 2924718666 2924710171 Bacteria 6752351
299 2924734725 2924733363 Bacteria 7574837
300 2924747233 2924741084 Bacteria 6661321
301 2924750395 2924748358 Bacteria 6154725
302 2933573276 2933570622 Bacteria 7023390
303 2933593725 2933586486 Bacteria 7667493
304 2935907417 2935901341 Bacteria 7341747
305 2936368680 2936367885 Bacteria 7324495
306 2936379412 2936375103 Bacteria 6652732
307 2936998530 2936996657 Bacteria 6298727
308 2937007437 2937002841 Bacteria 6934057
309 2937015767 2937009748 Bacteria 6746052
310 2937021340 2937016420 Bacteria 6782579
311 2937023448 2937023124 Bacteria 6815156
312 2937033151 2937029754 Bacteria 6424026
313 2937036653 2937036028 Bacteria 6846469
314 2937053292 2937049772 Bacteria 6757901
315 2937064804 2937063883 Bacteria 7199456
316 2937071999 2937071275 Bacteria 6984483
317 2937078474 2937078374 Bacteria 6610289
318 2937086272 2937084907 Bacteria 6618516
319 2937098716 2937091812 Bacteria 6979387
320 2937102773 2937098957 Bacteria 7249374
321 2937106487 2937106411 Bacteria 6947143
322 2937119399 2937113482 Bacteria 6505872
323 2937124271 2937119839 Bacteria 6597547
324 2937130851 2937126314 Bacteria 6771275
325 2937862396 2937861824 Bacteria 6660327
326 2937871455 2937868953 Bacteria 6639878
327 2937983555 2937980651 Bacteria 6517427
328 2941502347 2941499720 Bacteria 7599444
329 2957378266 2957375807 Bacteria 6425588
330 2957386486 2957382221 Bacteria 6737050
331 2957393308 2957388812 Bacteria 6778072
332 2957397753 2957395598 Bacteria 6822399
333 2957403375 2957402308 Bacteria 6741770
334 2957413396 2957408893 Bacteria 6558585
335 2957420826 2957415311 Bacteria 6991633
336 2957428930 2957422303 Bacteria 7172205
337 2957431187 2957430029 Bacteria 7022557
338 2957437232 2957437181 Bacteria 6568994
339 2957447369 2957443900 Bacteria 6869977
340 2957455622 2957450854 Bacteria 6765715
341 2957461892 2957457609 Bacteria 6967680
342 2957469445 2957464669 Bacteria 6568877
343 2957477944 2957471148 Bacteria 6797643
344 2957485159 2957484790 Bacteria 6703082
345 2957494055 2957491536 Bacteria 6695180
346 2957500742 2957498199 Bacteria 7126688
347 2957512746 2957505466 Bacteria 7253085
348 2958110115 2958108152 Bacteria 6681128
349 2958125267 2958122699 Bacteria 7280457
350 2958139182 2958137437 Bacteria 6050276
351 2958164294 2958158011 Bacteria 6058449
352 2960590411 2960584000 Bacteria 6864594
353 2960591122 2960591022 Bacteria 6622873
354 2960601221 2960597568 Bacteria 6550735
355 2960610529 2960603979 Bacteria 6898737
356 2960611651 2960610863 Bacteria 6691244
357 2960620099 2960617483 Bacteria 6727748
358 2960626698 2960624210 Bacteria 6875384
359 2960635787 2960631154 Bacteria 6732508
360 2960644169 2960637947 Bacteria 7296468
361 2960650365 2960645483 Bacteria 7211087
362 2960654404 2960652885 Bacteria 7083688
363 2960660653 2960660292 Bacteria 7041660
364 2960673028 2960667422 Bacteria 6763020
365 2960677695 2960674078 Bacteria 6609048
366 2960682490 2960680706 Bacteria 6624464
367 2960687430 2960687367 Bacteria 6535474
368 2960697254 2960693952 Bacteria 6749742
369 2961141379 2961136820 Bacteria 6775228
370 2961185879 2961183825 Bacteria 6688536
371 2964618353 2964615318 Bacteria 6809089
372 2964626626 2964621998 Bacteria 6834995
373 2964633351 2964628898 Bacteria 7083044
374 2964638757 2964636051 Bacteria 7091832
375 2964649161 2964643177 Bacteria 6820887
376 2964650090 2964649959 Bacteria 6675118
377 2964661646 2964656573 Bacteria 7100150
378 2964670222 2964663802 Bacteria 7019362
379 2964672787 2964670856 Bacteria 6851364
380 2964683576 2964678106 Bacteria 6792020
381 2964689865 2964685014 Bacteria 6839111
382 2964696154 2964691889 Bacteria 6802758
383 2964702879 2964698721 Bacteria 6765331
384 2964710756 2964705432 Bacteria 7114648
385 2964713013 2964712639 Bacteria 6695970
386 2964724424 2964719344 Bacteria 7286602
387 2965029320 2965025482 Bacteria 6532201
388 2965038491 2965032056 Bacteria 6887443
389 2965043343 2965040258 Bacteria 6855979
390 2965052065 2965047637 Bacteria 6623551
391 2965092018 2965089291 Bacteria 6866420
392 2965104312 2965102966 Bacteria 6800987
393 2965115092 2965110997 Bacteria 6693150
394 2967667484 2967664464 Bacteria 6948836
395 2967676813 2967671571 Bacteria 7021409
396 2967682565 2967678726 Bacteria 7264382
397 2967687627 2967686174 Bacteria 6678622
398 2967694829 2967693043 Bacteria 6804451
399 2967706659 2967699805 Bacteria 6854538
400 2967711477 2967706974 Bacteria 7186053
401 2967714423 2967714385 Bacteria 7000047
402 2967723747 2967721400 Bacteria 7073753
403 2967729589 2967728569 Bacteria 6641507
404 2967739173 2967735183 Bacteria 6827012
405 2967745707 2967742019 Bacteria 6794534
406 2967754534 2967748971 Bacteria 6733771
407 2967758175 2967755722 Bacteria 6814706
408 2967768924 2967762386 Bacteria 6923502
409 2967773742 2967769361 Bacteria 6587838
410 2968144519 2968138860 Bacteria 6605449
411 2970021262 2970019648 Bacteria 7072033
412 2970033391 2970026789 Bacteria 6785236
413 2970037452 2970033650 Bacteria 7118744
414 2970041039 2970040964 Bacteria 6731123
415 2970054012 2970047711 Bacteria 7088379
416 2970056927 2970054988 Bacteria 6611507
417 2970063128 2970061556 Bacteria 7099761
418 2970074612 2970068827 Bacteria 7123112
419 2970080441 2970076120 Bacteria 6697332
420 2970088114 2970082768 Bacteria 6183754
421 2970093712 2970088815 Bacteria 6933825
422 2970100778 2970095765 Bacteria 6936963
423 2970106060 2970102677 Bacteria 6812532
424 2970111518 2970109326 Bacteria 6863976
425 2970118187 2970116247 Bacteria 6501857
426 2970128715 2970122695 Bacteria 6625855
427 2970131327 2970129317 Bacteria 6806560
428 2970140786 2970136068 Bacteria 7207982
429 2970146476 2970143518 Bacteria 6446480
430 2970151855 2970149975 Bacteria 6779706
431 2970158659 2970156795 Bacteria 7168044
432 2970169549 2970164137 Bacteria 6861252
433 2970175674 2970170962 Bacteria 6876229
434 2970183583 2970177841 Bacteria 6768001
435 2970188768 2970184632 Bacteria 7054431
436 2970196601 2970191845 Bacteria 7032787
437 2970535668 2970532167 Bacteria 6553173
438 2970545879 2970540015 Bacteria 6977556
439 2970548120 2970547951 Bacteria 6931819
440 2970624681 2970619444 Bacteria 6986144
441 2970631153 2970627176 Bacteria 6680862
442 2977521039 2977516862 Bacteria 6940108
443 2977528469 2977523885 Bacteria 6960446
444 2977534199 2977530762 Bacteria 6951399
445 2977538489 2977537788 Bacteria 6929320
446 2977547326 2977544691 Bacteria 6875412
447 2977554746 2977551784 Bacteria 7125765
448 2977563325 2977558990 Bacteria 6863948
449 2977570097 2977565890 Bacteria 6901543
450 2977575559 2977572785 Bacteria 6763888
451 2977584363 2977579622 Bacteria 6772100
452 2977852327 2977851361 Bacteria 6694324
453 2977876771 2977872689 Bacteria 7270173
454 2977904169 2977898635 Bacteria 6675551
455 2977911708 2977907340 Bacteria 6577984
456 2977919317 2977915119 Bacteria 6829656
457 2977937603 2977935797 Bacteria 6252826
458 2977956940 2977950692 Bacteria 6893264
459 2977960346 2977957713 Bacteria 6877875
460 2979765787 2979764755 Bacteria 6610066
461 2979776495 2979772303 Bacteria 6618277
462 2979796130 2979793036 Bacteria 6808957
463 2987648107 2987645492 Bacteria 6117018
464 2987676285 2987673487 Bacteria 6884027
465 2996388245 2996386984 Bacteria 6978667
466 2996894381 2996893221 Bacteria 5823108
467 3000136264 3000135777 Bacteria 6891109
468 3002144857 3002141150 Bacteria 5254435
469 3004199534 3004195979 Bacteria 6776956
470 3004236918 3004232784 Bacteria 6662140
471 3004247729 3004239961 Bacteria 6892290
472 3004251580 3004248173 Bacteria 6563236
473 3004269869 3004268573 Bacteria 7043476
474 648736799 648276728 Bacteria 6968865
475 649873647 649633066 Bacteria 6690028
476 8002291062 8002285264 Bacteria 6717907
477 8003992206 8003992118 Bacteria 7266902
478 8004002462 8003999396 Bacteria 7063185
479 8004304395 8004300914 Bacteria 6132239
480 8004317473 8004312739 Bacteria 7444653
481 8004364282 8004361976 Bacteria 6858373
482 8004695865 8004695233 Bacteria 6731676
483 8004728474 8004727605 Bacteria 6643904
484 8005279241 8005275841 Bacteria 6929066
485 8005290776 8005289223 Bacteria 6634003
486 8005302330 8005301065 Bacteria 6614431
487 8005311017 8005307578 Bacteria 7395396
488 8005377187 8005376324 Bacteria 6590079
489 8005433674 8005430974 Bacteria 6689030
490 8005461321 8005460587 Bacteria 7157962
491 8005559206 8005556819 Bacteria 6908598
492 8005569877 8005563573 Bacteria 7153261
493 8005577274 8005570704 Bacteria 6957481
494 8005621453 8005619151 Bacteria 7030230
495 8005689903 8005688590 Bacteria 6610080
496 8005697198 8005695170 Bacteria 6912330
497 8018129738 8018127388 Bacteria 7351159
498 8018167078 8018163183 Bacteria 7277977
499 8018181576 8018176218 Bacteria 6896178
500 8023683963 8023680758 Bacteria 7729763
501 8024480544 8024479707 Bacteria 6954785
502 8024506784 8024501048 Bacteria 6427847
503 8056379238 8056375014 Bacteria 7006639
504 8056388268 8056382006 Bacteria 6408074
505 JGI25158J39367_1005186
506 JGI25159J45721_1000068
507 JGI25151J46595_10004416
508 JGI25153J46596_10042846
509 rootH2_10046321
510 rootH2_10091725
511 JGI25160J50197_1000199
512 JGI25161J50226_1006144
513 Ga0055542_1000495
514 Ga0055526_1002140
515 Ga0055524_1001735
516 Ga0055524_1028521
517 Ga0055536_1019410
518 Ga0055528_1000475
519 Ga0055540_1000227
520 Ga0055543_1000194
521 Ga0055543_1001652
522 Ga0065165_1000655
523 Ga0065165_1033181
524 Ga0068853_100457980
525 Ga0070665_100040439
526 Ga0070665_100051900
527 Ga0070665_100366643
528 Ga0081538_10009686
529 Ga0075365_10015925
530 Ga0075365_10020172
531 Ga0075365_10036701
532 Ga0075363_100032062
533 Ga0075362_10013087
534 Ga0075367_10029716
535 Ga0075366_10034142
536 Ga0075370_10024096
537 Ga0105240_10455220
538 Ga0105033_100758
539 Ga0105239_10086612
540 Ga0171463_1016
541 Ga0157376_10134744
542 Ga0183363_1100
543 Ga0214544_1003342
544 Ga0214542_1001482
545 Ga0214543_1001272
546 Ga0214543_1004822
547 Ga0209436_101636
548 Ga0209129_1011433
549 Ga0209129_1014827
550 Ga0209673_1000922
551 Ga0209130_1000378
552 Ga0209676_1002040
553 Ga0209025_1000114
554 Ga0209025_1000205
555 Ga0209025_1000372
556 Ga0209025_1053402
557 Ga0209564_1001208
558 Ga0209564_1002391
559 Ga0209564_1041503
560 Ga0209758_1000567
561 Ga0209758_1002625
562 Ga0209758_1002670
563 Ga0209050_1004082
564 Ga0209050_1034965
565 Ga0209256_1000153
566 Ga0209256_1001267
567 Ga0209256_1003442
568 Ga0207426_1000538
569 Ga0207426_1000567
570 Ga0209051_1000288
571 Ga0209051_1024289
572 Ga0209051_1091699
573 Ga0209257_1004713
574 Ga0209257_1005415
575 Ga0207654_10047158
576 Ga0207639_10378974
577 Ga0207639_10571448
578 Ga0209281_1001068
579 Ga0268266_10026390
580 Ga0307513_10005704
581 Ga0451802_1550926
582 Ga0451849_0362522
583 Ga0451851_0534480
584 Ga0451853_3443962
585 Ga0439431_0090061
586 Ga0439449_0028006
587 Ga0495605_0110906
588 Ga0495607_0044717
589 Ga0495597_0004766
590 Ga0495625_0142401
591 Ga0495660_0017212
592 Ga0495685_118621
593 Ga0496105_0513954
594 Ga0496117_0261032
595 Ga0496118_0008537
596 Ga0496121_0108351
597 Ga0501034_0586754
598 nmdc:mga03n38_102525_c1
599 nmdc:mga0yw44_29723_c1
600 nmdc:mga0yw44_76993_c1
601 nmdc:mga07m45_280196_c1
602 Ga0500658_0000540
603 Ga0500568_0000175
604 2503200384
605 2509373638
606 2509388057
607 2509443644
608 2510131732
609 2510317206
610 2511392850
611 2511499064
612 2512531710
613 2513571309
614 2513579127
615 2513582376
616 2513602208
617 2513616076
618 2513632406
619 2513711737
620 2513884722
621 2513905117
622 2513987624
623 2514003795
624 2514023359
625 2514416851
626 2515110678
627 2515607484
628 2515742819
629 2516208160
630 2516891612
631 2517039378
632 2517079620
633 2517405251
634 2517570860
635 2524450774
636 2530644243
637 2551680011
638 2551683634
639 2551690742
640 2551703632
641 2551708699
642 2551722404
643 2551729421
644 2551734884
645 2551741912
646 2585385476
647 2585528568
648 2585540022
649 2585838003
650 2600197072
651 2616292629
652 2644049602
653 2644146087
654 2644203990
655 2644308886
656 2644332711
657 2644482635
658 2644540113
659 2644614827
660 2644674111
661 2657681389
662 2688599219
663 2692317815
664 2719384526
665 2719665440
666 2720491860
667 2720613127
668 2721398236
669 2723026772
670 2723576161
671 2724037048
672 2724110030
673 2725952098
674 2730107708
675 2739034889
676 2739307058
677 2766062497
678 2776272403
679 2776284343
680 2792627360
681 2792642227
682 2793319050
683 2793350521
684 2793352449
685 2793360851
686 2793368117
687 2802718049
688 2802725100
689 2802730776
690 2802738123
691 2802744007
692 2802750886
693 2804752584
694 2805931112
695 2805935700
696 2806044176
697 2806052012
698 2806058314
699 2806069218
700 2806074545
701 2821444234
702 2838021083
703 2838048279
704 2838673940
705 2838692356
706 2838706422
707 2838732548
708 2838745443
709 2841855087
710 2841866464
711 2842117682
712 2842148756
713 2842161883
714 2842169259
715 2842185500
716 2842206224
717 2842233438
718 2842249632
719 2842256058
720 2842261701
721 2842268102
722 2842276825
723 2842279681
724 2842286320
725 2842306207
726 2842318096
727 2842342718
728 2842408061
729 2842414822
730 2842421295
731 2842431661
732 2842438378
733 2842445009
734 2842466033
735 2842472993
736 2842492939
737 2842496366
738 2842873685
739 2842923422
740 2844014392
741 2844455702
742 2844535574
743 2855827978
744 2855839751
745 2856329167
746 2856341920
747 2856346831
748 2857375351
749 2857523964
750 2858803628
751 2869175425
752 2869241084
753 2869248307
754 2869250119
755 2869260971
756 2869270477
757 2869273054
758 2871438728
759 2871451984
760 2871464630
761 2871482457
762 2874110405
763 2874118802
764 2874135673
765 2874164216
766 2876390510
767 2876403272
768 2876411487
769 2876421967
770 2878778394
771 2878784505
772 2888348479
773 2896385047
774 2903516776
775 2906366834
776 2906371889
777 2906386920
778 2906395420
779 2906407701
780 2906414291
781 2915988891
782 2915997241
783 2916019087
784 2916072193
785 2920826351
786 2921207512
787 2921242734
788 2921262757
789 2921289873
790 2922152260
791 2922173034
792 2922179673
793 2924148854
794 2924154298
795 2924164672
796 2924170819
797 2924189461
798 2924200162
799 2924211708
800 2924214675
801 2924226380
802 2924718666
803 2924734725
804 2924747233
805 2924750395
806 2933573276
807 2933593725
808 2935907417
809 2936368680
810 2936379412
811 2936998530
812 2937007437
813 2937015767
814 2937021340
815 2937023448
816 2937033151
817 2937036653
818 2937053292
819 2937064804
820 2937071999
821 2937078474
822 2937086272
823 2937098716
824 2937102773
825 2937106487
826 2937119399
827 2937124271
828 2937130851
829 2937862396
830 2937871455
831 2937983555
832 2941502347
833 2957378266
834 2957386486
835 2957393308
836 2957397753
837 2957403375
838 2957413396
839 2957420826
840 2957428930
841 2957431187
842 2957437232
843 2957447369
844 2957455622
845 2957461892
846 2957469445
847 2957477944
848 2957485159
849 2957494055
850 2957500742
851 2957512746
852 2958110115
853 2958125267
854 2958139182
855 2958164294
856 2960590411
857 2960591122
858 2960601221
859 2960610529
860 2960611651
861 2960620099
862 2960626698
863 2960635787
864 2960644169
865 2960650365
866 2960654404
867 2960660653
868 2960673028
869 2960677695
870 2960682490
871 2960687430
872 2960697254
873 2961141379
874 2961185879
875 2964618353
876 2964626626
877 2964633351
878 2964638757
879 2964649161
880 2964650090
881 2964661646
882 2964670222
883 2964672787
884 2964683576
885 2964689865
886 2964696154
887 2964702879
888 2964710756
889 2964713013
890 2964724424
891 2965029320
892 2965038491
893 2965043343
894 2965052065
895 2965092018
896 2965104312
897 2965115092
898 2967667484
899 2967676813
900 2967682565
901 2967687627
902 2967694829
903 2967706659
904 2967711477
905 2967714423
906 2967723747
907 2967729589
908 2967739173
909 2967745707
910 2967754534
911 2967758175
912 2967768924
913 2967773742
914 2968144519
915 2970021262
916 2970033391
917 2970037452
918 2970041039
919 2970054012
920 2970056927
921 2970063128
922 2970074612
923 2970080441
924 2970088114
925 2970093712
926 2970100778
927 2970106060
928 2970111518
929 2970118187
930 2970128715
931 2970131327
932 2970140786
933 2970146476
934 2970151855
935 2970158659
936 2970169549
937 2970175674
938 2970183583
939 2970188768
940 2970196601
941 2970535668
942 2970545879
943 2970548120
944 2970624681
945 2970631153
946 2977521039
947 2977528469
948 2977534199
949 2977538489
950 2977547326
951 2977554746
952 2977563325
953 2977570097
954 2977575559
955 2977584363
956 2977852327
957 2977876771
958 2977904169
959 2977911708
960 2977919317
961 2977937603
962 2977956940
963 2977960346
964 2979765787
965 2979776495
966 2979796130
967 2987648107
968 2987676285
969 2996388245
970 2996894381
971 3000136264
972 3002144857
973 3004199534
974 3004236918
975 3004247729
976 3004251580
977 3004269869
978 648736799
979 649873647
980 8002291062
981 8003992206
982 8004002462
983 8004304395
984 8004317473
985 8004364282
986 8004695865
987 8004728474
988 8005279241
989 8005290776
990 8005302330
991 8005311017
992 8005377187
993 8005433674
994 8005461321
995 8005559206
996 8005569877
997 8005577274
998 8005621453
999 8005689903
1000 8005697198
1001 8018129738
1002 8018167078
1003 8018181576
1004 8023683963
1005 8024480544
1006 8024506784
1007 8056379238
1008 8056388268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

76

122

0.96

PF02909

TetR_C_1

Tetracyclin repressor-like, C-terminal domain

134

270

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b6a-assembly4.cif.gz_G crystal structure of the streptomyces coelicolor tetr family protein actr in complex with actinorhodin 0.8744 69 266
2y2z-assembly1.cif.gz_A ligand-free form of tetr-like repressor simr 0.8691 71 266
3b6a-assembly4.cif.gz_H crystal structure of the streptomyces coelicolor tetr family protein actr in complex with actinorhodin 0.8649 71 266
3b6c-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor tetr family protein actr in complex with (s)-dnpa 0.8642 71 266
2opt-assembly1.cif.gz_A crystal structure of apo actr from streptomyces coelicolor. 0.8631 71 266
ID Description Score Start End Superfamily
2hxoA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9406 71 125 1.10.10.60
3fiwD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9396 72 118 1.10.10.60
4d7mA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9319 71 126 1.10.10.60
1bjyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9296 71 126 1.10.10.60
3fiwA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9285 74 121 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A249PC69-F1-model_v4 Transcriptional regulator, TetR family 0.9492 78 270 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A249PC69-F1-model_v4 Transcriptional regulator, TetR family 0.9352 78 270 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A528HT37-F1-model_v4 TetR family transcriptional regulator 0.932 149 269 GO:0045892
AF-A0A7X5ZSC7-F1-model_v4 AcrR family transcriptional regulator 0.9263 78 266 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-F4F133-F1-model_v4 deleted 0.9207 82 266

Map