F455999

General Info

Members Datasets Scaffolds Average Seq Length
503 261 503 211

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10008684|Ga0105240_1000868410
Length 232
Sequence MRWTSGRGRAGRSIRTPPFGCRVAGMSTSFETVPLFATPILMVEVPDATALNAALREAIEQRHRTHPGTQHSNLGGWQSDWDMDRWGGAPAIKLLAIGRNTATRATTDRQGQPVTIAWRANMWANVNRSGHGNEFHSHPGSFWSGVYYVDDGGIDADPALGGELEFMDPRGPGPAMYAPHLAFGSAGLSVGANETIRPKAGRLLLFPAWLLHQVRPYRGTAERISIAFNLSL

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
261 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.95
Nodule 0
Rhizoplane 2.19
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001815 3300003320 Bacteria 13342
2 rootH2_10211674 3300003320 Bacteria 3284
3 Ga0070658_10026372 3300005327 Bacteria 4661
4 Ga0070676_10284243 3300005328 Bacteria 1116
5 Ga0070690_100002720 3300005330 Bacteria 9546
6 Ga0070670_100295983 3300005331 Bacteria 1415
7 Ga0070666_10004129 3300005335 Bacteria 8811
8 Ga0070666_10005958 3300005335 Bacteria 7484
9 Ga0070680_100000696 3300005336 Bacteria 23332
10 Ga0070680_100002746 3300005336 Bacteria 13055
11 Ga0070680_100005941 3300005336 Bacteria 9263
12 Ga0070680_100039614 3300005336 Bacteria 3812
13 Ga0070680_100066441 3300005336 Unclassified 2957
14 Ga0070680_100543922 3300005336 Unclassified 995
15 Ga0070660_100003695 3300005339 Bacteria 10561
16 Ga0070660_100053757 3300005339 Bacteria 3107
17 Ga0070660_100165328 3300005339 Bacteria 1785
18 Ga0070660_100443332 3300005339 Bacteria 1077
19 Ga0070689_100033096 3300005340 Bacteria 3936
20 Ga0070689_100139465 3300005340 Bacteria 1949
21 Ga0070691_10000460 3300005341 Bacteria 15112
22 Ga0070691_10003607 3300005341 Bacteria 6989
23 Ga0070691_10007728 3300005341 Bacteria 4925
24 Ga0070691_10035771 3300005341 Bacteria 2339
25 Ga0070691_10347964 3300005341 Bacteria 822
26 Ga0070661_100015248 3300005344 Bacteria 5424
27 Ga0070661_100036169 3300005344 Bacteria 3590
28 Ga0070661_100065069 3300005344 Bacteria 2679
29 Ga0070661_100246135 3300005344 Bacteria 1378
30 Ga0070661_100419489 3300005344 Unclassified 1061
31 Ga0070669_100158521 3300005353 Bacteria 1757
32 Ga0070675_100363920 3300005354 Bacteria 1285
33 Ga0070674_100304770 3300005356 Bacteria 1271
34 Ga0070673_100150435 3300005364 Bacteria 1971
35 Ga0070673_100195220 3300005364 Bacteria 1741
36 Ga0070688_100113780 3300005365 Bacteria 1803
37 Ga0070659_100060072 3300005366 Bacteria 3002
38 Ga0070667_100019882 3300005367 Bacteria 5572
39 Ga0070667_100085111 3300005367 Bacteria 2711
40 Ga0070667_100113558 3300005367 Bacteria 2351
41 Ga0070709_10001372 3300005434 Bacteria 13290
42 Ga0070709_10863514 3300005434 Bacteria 714
43 Ga0070714_100011085 3300005435 Bacteria 7145
44 Ga0070714_100031603 3300005435 Bacteria 4419
45 Ga0070714_100054777 3300005435 Bacteria 3408
46 Ga0070713_100000001 3300005436 Bacteria 257984
47 Ga0070701_10030835 3300005438 Bacteria 2656
48 Ga0070711_100013169 3300005439 Bacteria 5188
49 Ga0070711_100433725 3300005439 Bacteria 1073
50 Ga0070700_100296179 3300005441 Bacteria 1179
51 Ga0070694_100036868 3300005444 Bacteria 3241
52 Ga0070694_100075350 3300005444 Bacteria 2334
53 Ga0070708_100038826 3300005445 Bacteria 4163
54 Ga0070681_10000002 3300005458 Bacteria 821814
55 Ga0070681_10024892 3300005458 Bacteria 6022
56 Ga0070681_10032368 3300005458 Bacteria 5247
57 Ga0070681_10035462 3300005458 Bacteria 5011
58 Ga0070706_100273397 3300005467 Bacteria 1576
59 Ga0070706_100302763 3300005467 Bacteria 1491
60 Ga0070707_100022682 3300005468 Bacteria 5934
61 Ga0070698_100000727 3300005471 Bacteria 35372
62 Ga0070699_100183226 3300005518 Bacteria 1859
63 Ga0070679_100000152 3300005530 Bacteria 55942
64 Ga0070679_100036701 3300005530 Bacteria 4864
65 Ga0070679_100036776 3300005530 Bacteria 4859
66 Ga0070679_100252298 3300005530 Bacteria 1720
67 Ga0070684_100194431 3300005535 Bacteria 1847
68 Ga0070684_100565895 3300005535 Bacteria 1055
69 Ga0068853_100008575 3300005539 Bacteria 8217
70 Ga0068853_100026910 3300005539 Bacteria 4833
71 Ga0068853_100060038 3300005539 Bacteria 3285
72 Ga0070672_100171936 3300005543 Bacteria 1802
73 Ga0070672_100185255 3300005543 Bacteria 1736
74 Ga0070695_100016429 3300005545 Bacteria 4479
75 Ga0070695_100176999 3300005545 Bacteria 1509
76 Ga0070696_100273218 3300005546 Bacteria 1286
77 Ga0070693_100373118 3300005547 Bacteria 982
78 Ga0070693_100408568 3300005547 Unclassified 943
79 Ga0070665_100114039 3300005548 Bacteria 2705
80 Ga0068855_100000038 3300005563 Bacteria 157738
81 Ga0068855_100008235 3300005563 Bacteria 12601
82 Ga0068855_100028207 3300005563 Bacteria 6714
83 Ga0068855_100029277 3300005563 Bacteria 6586
84 Ga0068855_100073457 3300005563 Bacteria 3973
85 Ga0068855_100246203 3300005563 Bacteria 1995
86 Ga0068855_100256312 3300005563 Bacteria 1950
87 Ga0068855_100371882 3300005563 Bacteria 1571
88 Ga0070664_100002486 3300005564 Bacteria 14854
89 Ga0070664_100210977 3300005564 Bacteria 1735
90 Ga0068857_100000126 3300005577 Bacteria 46128
91 Ga0068857_100010598 3300005577 Bacteria 8014
92 Ga0068856_100001878 3300005614 Bacteria 21888
93 Ga0068856_100004915 3300005614 Bacteria 13229
94 Ga0068856_100112695 3300005614 Bacteria 2718
95 Ga0068856_100954343 3300005614 Bacteria 876
96 Ga0068852_100025741 3300005616 Bacteria 4772
97 Ga0068852_100045880 3300005616 Bacteria 3720
98 Ga0068852_100077594 3300005616 Bacteria 2937
99 Ga0068852_100798896 3300005616 Bacteria 957
100 Ga0068852_101165397 3300005616 Bacteria 791
101 Ga0068864_100061188 3300005618 Bacteria 3261
102 Ga0068851_10118381 3300005834 Bacteria 1421
103 Ga0068851_10354718 3300005834 Unclassified 854
104 Ga0068870_10372622 3300005840 Bacteria 922
105 Ga0068858_100005358 3300005842 Bacteria 12584
106 Ga0068860_100004656 3300005843 Bacteria 14008
107 Ga0068860_100073475 3300005843 Bacteria 3251
108 Ga0068860_100361553 3300005843 Bacteria 1430
109 Ga0068862_100017870 3300005844 Bacteria 5905
110 Ga0081455_10000211 3300005937 Bacteria 74488
111 Ga0081455_10003310 3300005937 Bacteria 18636
112 Ga0081455_10023297 3300005937 Bacteria 5764
113 Ga0081455_10058090 3300005937 Bacteria 3276
114 Ga0081455_10095119 3300005937 Bacteria 2405
115 Ga0081455_10125189 3300005937 Bacteria 2018
116 Ga0081539_10002291 3300005985 Bacteria 27716
117 Ga0081539_10008631 3300005985 Bacteria 8791
118 Ga0075365_10005557 3300006038 Bacteria 6813
119 Ga0075365_10029265 3300006038 Bacteria 3519
120 Ga0075365_10050595 3300006038 Bacteria 2741
121 Ga0075368_10132329 3300006042 Bacteria 1037
122 Ga0075363_100044381 3300006048 Bacteria 2355
123 Ga0070712_100000051 3300006175 Bacteria 62931
124 Ga0075362_10020247 3300006177 Bacteria 2778
125 Ga0075362_10020837 3300006177 Bacteria 2743
126 Ga0075362_10032217 3300006177 Bacteria 2273
127 Ga0075362_10058694 3300006177 Bacteria 1736
128 Ga0075362_10112077 3300006177 Bacteria 1285
129 Ga0075367_10014112 3300006178 Bacteria 4316
130 Ga0075367_10033349 3300006178 Bacteria 2967
131 Ga0075367_10043761 3300006178 Bacteria 2622
132 Ga0075369_10006640 3300006186 Bacteria 4383
133 Ga0075366_10006562 3300006195 Bacteria 6382
134 Ga0075370_10181171 3300006353 Bacteria 1240
135 Ga0068871_100032260 3300006358 Bacteria 4136
136 Ga0075428_100044374 3300006844 Bacteria 4885
137 Ga0075434_100163095 3300006871 Bacteria 2248
138 Ga0075429_100336920 3300006880 Bacteria 1320
139 Ga0068865_100137658 3300006881 Bacteria 1837
140 Ga0075436_100000166 3300006914 Bacteria 41286
141 Ga0075435_100140084 3300007076 Bacteria 2029
142 Ga0075435_100150222 3300007076 Bacteria 1958
143 Ga0099794_10243728 3300007265 Bacteria 926
144 Ga0105240_10000811 3300009093 Bacteria 56752
145 Ga0105240_10004839 3300009093 Bacteria 20288
146 Ga0105240_10008684 3300009093 Bacteria 14502
147 Ga0105240_10011383 3300009093 Bacteria 12392
148 Ga0105240_10021231 3300009093 Bacteria 8643
149 Ga0105240_10098983 3300009093 Bacteria 3550
150 Ga0105240_10248639 3300009093 Bacteria 2058
151 Ga0105240_10298181 3300009093 Bacteria 1845
152 Ga0105245_10027317 3300009098 Bacteria 5028
153 Ga0105245_10324023 3300009098 Bacteria 1519
154 Ga0105245_11330950 3300009098 Bacteria 767
155 Ga0105247_10170872 3300009101 Bacteria 1445
156 Ga0105243_10083510 3300009148 Bacteria 2613
157 Ga0105243_10151108 3300009148 Unclassified 1992
158 Ga0105241_10231875 3300009174 Bacteria 1557
159 Ga0105241_10544616 3300009174 Bacteria 1041
160 Ga0105241_10731949 3300009174 Bacteria 905
161 Ga0105242_10032412 3300009176 Bacteria 4178
162 Ga0105242_10061335 3300009176 Bacteria 3093
163 Ga0105248_10000001 3300009177 Bacteria 1881304
164 Ga0105248_10001967 3300009177 Bacteria 22851
165 Ga0105248_11045495 3300009177 Bacteria 923
166 Ga0105237_10244746 3300009545 Bacteria 1795
167 Ga0105237_10558623 3300009545 Bacteria 1151
168 Ga0105238_10009220 3300009551 Bacteria 9876
169 Ga0105238_10012827 3300009551 Bacteria 8455
170 Ga0105238_10044899 3300009551 Bacteria 4466
171 Ga0105238_10098035 3300009551 Bacteria 2916
172 Ga0105239_10001844 3300010375 Bacteria 27744
173 Ga0105239_10008686 3300010375 Bacteria 11502
174 Ga0105239_10017918 3300010375 Bacteria 7832
175 Ga0105239_10032917 3300010375 Bacteria 5695
176 Ga0105239_10217795 3300010375 Bacteria 2141
177 Ga0105239_10272855 3300010375 Bacteria 1903
178 Ga0157373_10008832 3300013100 Bacteria 7464
179 Ga0157373_10056975 3300013100 Bacteria 2773
180 Ga0157371_10384954 3300013102 Bacteria 1024
181 Ga0157370_10006715 3300013104 Bacteria 12626
182 Ga0157370_10009137 3300013104 Bacteria 10628
183 Ga0157370_10087573 3300013104 Bacteria 2925
184 Ga0157369_10166227 3300013105 Bacteria 2327
185 Ga0157374_10678200 3300013296 Bacteria 1043
186 Ga0157378_10551370 3300013297 Bacteria 1158
187 Ga0157378_10756178 3300013297 Unclassified 995
188 Ga0163162_10150077 3300013306 Bacteria 2448
189 Ga0157372_10011944 3300013307 Bacteria 9252
190 Ga0157372_10038925 3300013307 Bacteria 5248
191 Ga0157372_10160139 3300013307 Bacteria 2601
192 Ga0157372_11719153 3300013307 Bacteria 722
193 Ga0157375_10001198 3300013308 Bacteria 22358
194 Ga0163163_10003735 3300014325 Bacteria 12964
195 Ga0163163_11374843 3300014325 Bacteria 768
196 Ga0157380_10518041 3300014326 Bacteria 1162
197 Ga0157377_10102776 3300014745 Bacteria 1706
198 Ga0157379_10008452 3300014968 Bacteria 8951
199 Ga0157379_10020886 3300014968 Bacteria 5794
200 Ga0157379_10054722 3300014968 Bacteria 3565
201 Ga0157379_10082126 3300014968 Bacteria 2887
202 Ga0157376_10071352 3300014969 Bacteria 2951
203 Ga0206354_10852664 3300020081 Bacteria 865
204 Ga0213872_10090113 3300021361 Bacteria 1373
205 Ga0213876_10000515 3300021384 Bacteria 29870
206 Ga0213871_10002377 3300021441 Bacteria 3455
207 Ga0207426_1017855 3300025302 Bacteria 2512
208 Ga0207692_10022137 3300025898 Bacteria 2921
209 Ga0207710_10021168 3300025900 Bacteria 2784
210 Ga0207710_10058220 3300025900 Bacteria 1747
211 Ga0207680_10034133 3300025903 Bacteria 2908
212 Ga0207680_10276910 3300025903 Bacteria 1165
213 Ga0207647_10217649 3300025904 Bacteria 1101
214 Ga0207699_10000116 3300025906 Bacteria 56075
215 Ga0207645_10116381 3300025907 Bacteria 1733
216 Ga0207705_10000374 3300025909 Bacteria 40260
217 Ga0207705_10058707 3300025909 Bacteria 2775
218 Ga0207684_10152037 3300025910 Bacteria 1991
219 Ga0207654_10167334 3300025911 Bacteria 1425
220 Ga0207707_10000002 3300025912 Bacteria 1142054
221 Ga0207707_10001297 3300025912 Bacteria 23274
222 Ga0207707_10006036 3300025912 Bacteria 10598
223 Ga0207707_10021807 3300025912 Bacteria 5598
224 Ga0207695_10000012 3300025913 Bacteria 840961
225 Ga0207695_10018978 3300025913 Bacteria 7930
226 Ga0207695_10113597 3300025913 Bacteria 2684
227 Ga0207695_10168015 3300025913 Bacteria 2121
228 Ga0207671_10022042 3300025914 Bacteria 4824
229 Ga0207693_10000052 3300025915 Bacteria 98125
230 Ga0207663_10007552 3300025916 Bacteria 5643
231 Ga0207663_10023361 3300025916 Bacteria 3547
232 Ga0207660_10000026 3300025917 Bacteria 69878
233 Ga0207660_10001385 3300025917 Bacteria 16273
234 Ga0207660_10179745 3300025917 Bacteria 1642
235 Ga0207660_10209377 3300025917 Bacteria 1526
236 Ga0207660_10213518 3300025917 Unclassified 1512
237 Ga0207660_10437936 3300025917 Unclassified 1056
238 Ga0207662_10671725 3300025918 Bacteria 725
239 Ga0207657_10000562 3300025919 Bacteria 39481
240 Ga0207657_10053730 3300025919 Bacteria 3488
241 Ga0207657_10297971 3300025919 Bacteria 1277
242 Ga0207649_10018872 3300025920 Bacteria 3933
243 Ga0207652_10000431 3300025921 Bacteria 43647
244 Ga0207652_10003336 3300025921 Bacteria 13277
245 Ga0207652_10011903 3300025921 Bacteria 7018
246 Ga0207652_10022485 3300025921 Bacteria 5217
247 Ga0207646_10921782 3300025922 Unclassified 774
248 Ga0207681_10042709 3300025923 Bacteria 3030
249 Ga0207694_10000006 3300025924 Bacteria 631109
250 Ga0207694_10009870 3300025924 Bacteria 7206
251 Ga0207694_10028932 3300025924 Bacteria 4225
252 Ga0207659_10320826 3300025926 Bacteria 1278
253 Ga0207687_10125225 3300025927 Bacteria 1928
254 Ga0207700_10000015 3300025928 Bacteria 224772
255 Ga0207700_10591165 3300025928 Bacteria 987
256 Ga0207664_10007464 3300025929 Bacteria 7585
257 Ga0207664_10040096 3300025929 Bacteria 3638
258 Ga0207664_10048979 3300025929 Bacteria 3325
259 Ga0207664_10872466 3300025929 Bacteria 808
260 Ga0207690_10010644 3300025932 Bacteria 5480
261 Ga0207686_10041277 3300025934 Bacteria 2812
262 Ga0207670_10062364 3300025936 Bacteria 2547
263 Ga0207670_10131577 3300025936 Bacteria 1834
264 Ga0207704_10216833 3300025938 Bacteria 1413
265 Ga0207691_10176531 3300025940 Bacteria 1868
266 Ga0207711_10000001 3300025941 Bacteria 1325674
267 Ga0207711_10020307 3300025941 Bacteria 5537
268 Ga0207711_10024967 3300025941 Bacteria 5013
269 Ga0207711_10612903 3300025941 Bacteria 1016
270 Ga0207667_10000052 3300025949 Bacteria 232415
271 Ga0207667_10004144 3300025949 Bacteria 17811
272 Ga0207667_10021507 3300025949 Bacteria 7146
273 Ga0207667_10023583 3300025949 Bacteria 6774
274 Ga0207667_10152236 3300025949 Bacteria 2380
275 Ga0207667_10220429 3300025949 Bacteria 1943
276 Ga0207651_10147094 3300025960 Bacteria 1829
277 Ga0207651_10861490 3300025960 Bacteria 806
278 Ga0207640_10324517 3300025981 Bacteria 1227
279 Ga0207658_10015749 3300025986 Bacteria 5191
280 Ga0207658_10120077 3300025986 Bacteria 2094
281 Ga0207658_10824515 3300025986 Bacteria 843
282 Ga0207677_10245799 3300026023 Bacteria 1450
283 Ga0207639_10184545 3300026041 Bacteria 1777
284 Ga0207702_10000011 3300026078 Bacteria 284514
285 Ga0207702_10009546 3300026078 Bacteria 8143
286 Ga0207641_10497083 3300026088 Bacteria 1184
287 Ga0207674_10000002 3300026116 Bacteria 279738
288 Ga0207674_10093031 3300026116 Bacteria 3004
289 Ga0207675_100402100 3300026118 Bacteria 1350
290 Ga0207683_10041219 3300026121 Bacteria 4031
291 Ga0207683_10517954 3300026121 Bacteria 1102
292 Ga0207698_10125133 3300026142 Bacteria 2184
293 Ga0207698_10507714 3300026142 Bacteria 1174
294 Ga0207698_10602468 3300026142 Bacteria 1083
295 Ga0207698_10717391 3300026142 Unclassified 996
296 Ga0207698_10767321 3300026142 Bacteria 964
297 Ga0209813_10089274 3300027866 Bacteria 1032
298 Ga0207428_10651118 3300027907 Bacteria 756
299 Ga0268266_10004956 3300028379 Bacteria 12596
300 Ga0268266_10075831 3300028379 Bacteria 2921
301 Ga0268265_10012443 3300028380 Bacteria 5766
302 Ga0268265_10125952 3300028380 Bacteria 2120
303 Ga0268264_10045663 3300028381 Bacteria 3638
304 Ga0268264_10335270 3300028381 Bacteria 1435
305 Ga0268264_10385642 3300028381 Bacteria 1343
306 Ga0265318_10000035 3300028577 Bacteria 139989
307 Ga0265338_10008580 3300028800 Bacteria 12368
308 Ga0265338_10043683 3300028800 Bacteria 4151
309 Ga0265330_10104202 3300031235 Bacteria 1213
310 Ga0265330_10105652 3300031235 Bacteria 1204
311 Ga0265330_10194556 3300031235 Bacteria 858
312 Ga0265332_10081105 3300031238 Bacteria 1376
313 Ga0265332_10113213 3300031238 Bacteria 1142
314 Ga0265332_10120844 3300031238 Bacteria 1100
315 Ga0265320_10000495 3300031240 Bacteria 30654
316 Ga0265325_10000101 3300031241 Bacteria 60537
317 Ga0265325_10007631 3300031241 Bacteria 6467
318 Ga0265325_10010458 3300031241 Bacteria 5373
319 Ga0265325_10013241 3300031241 Bacteria 4701
320 Ga0265325_10103290 3300031241 Bacteria 1393
321 Ga0265325_10290642 3300031241 Bacteria 731
322 Ga0265340_10004413 3300031247 Bacteria 7869
323 Ga0265340_10014505 3300031247 Bacteria 4114
324 Ga0265340_10023868 3300031247 Bacteria 3112
325 Ga0265340_10042187 3300031247 Bacteria 2241
326 Ga0265340_10046833 3300031247 Bacteria 2108
327 Ga0265339_10001839 3300031249 Bacteria 15585
328 Ga0265339_10021727 3300031249 Bacteria 3727
329 Ga0265339_10039913 3300031249 Bacteria 2610
330 Ga0265339_10058458 3300031249 Bacteria 2082
331 Ga0265339_10253926 3300031249 Unclassified 850
332 Ga0265331_10054232 3300031250 Bacteria 1909
333 Ga0265316_10007244 3300031344 Bacteria 10475
334 Ga0265316_10020088 3300031344 Bacteria 5694
335 Ga0265316_10024151 3300031344 Bacteria 5100
336 Ga0265316_10038154 3300031344 Bacteria 3873
337 Ga0265316_10074892 3300031344 Bacteria 2604
338 Ga0265316_10355982 3300031344 Bacteria 1059
339 Ga0265313_10000725 3300031595 Bacteria 33945
340 Ga0265313_10017910 3300031595 Bacteria 4000
341 Ga0265313_10095527 3300031595 Bacteria 1327
342 Ga0265314_10000144 3300031711 Bacteria 107465
343 Ga0265314_10040105 3300031711 Bacteria 3364
344 Ga0265314_10101932 3300031711 Bacteria 1843
345 Ga0265314_10190369 3300031711 Unclassified 1221
346 Ga0265342_10012117 3300031712 Bacteria 5852
347 Ga0265342_10017315 3300031712 Bacteria 4690
348 Ga0265342_10042803 3300031712 Bacteria 2735
349 Ga0265342_10107774 3300031712 Bacteria 1580
350 Ga0265342_10208794 3300031712 Bacteria 1057
351 Ga0307516_10048771 3300031730 Bacteria 4166
352 Ga0307405_10948521 3300031731 Bacteria 731
353 Ga0307410_10248836 3300031852 Unclassified 1381
354 Ga0373930_0036713 3300034816 Bacteria 1029
355 Ga0373928_0045485 3300035084 Bacteria 1022
356 Ga0373923_0116356 3300035111 Bacteria 1191
357 Ga0373923_0321212 3300035111 Unclassified 735
358 Ga0373932_0123950 3300035112 Bacteria 864
359 Ga0373954_0210035 3300035118 Bacteria 957
360 Ga0373955_0328849 3300035172 Unclassified 924
361 Ga0316574_0436578 3300035398 Bacteria 822
362 Ga0373924_0180821 3300035410 Unclassified 928
363 Ga0373931_0035729 3300035691 Bacteria 2586
364 Ga0373935_0075155 3300035692 Bacteria 2186
365 Ga0373935_0167473 3300035692 Bacteria 1501
366 Ga0373935_0215922 3300035692 Bacteria 1331
367 Ga0373927_0100670 3300035695 Bacteria 1879
368 Ga0373927_0169511 3300035695 Bacteria 1431
369 Ga0373927_0406014 3300035695 Unclassified 899
370 Ga0373933_0024046 3300035724 Bacteria 3487
371 Ga0373933_0038018 3300035724 Bacteria 2827
372 Ga0373933_0091795 3300035724 Bacteria 1875
373 Ga0373937_0043688 3300036401 Bacteria 4092
374 Ga0373937_0235112 3300036401 Bacteria 1726
375 Ga0373937_0540792 3300036401 Bacteria 1107
376 Ga0373937_0864568 3300036401 Unclassified 853
377 Ga0373937_0988428 3300036401 Unclassified 790
378 Ga0373937_1142804 3300036401 Unclassified 727
379 Ga0373937_1360471 3300036401 Bacteria 658
380 Ga0373925_0145509 3300037068 Bacteria 1858
381 Ga0395899_0020467 3300037312 Bacteria 5016
382 Ga0395899_0165885 3300037312 Bacteria 1558
383 Ga0395899_0182875 3300037312 Bacteria 1470
384 Ga0395899_0321916 3300037312 Bacteria 1041
385 Ga0395900_0026276 3300037418 Bacteria 5962
386 Ga0395900_0296205 3300037418 Bacteria 1605
387 Ga0395900_0362972 3300037418 Bacteria 1419
388 Ga0395901_0003454 3300038443 Bacteria 15926
389 Ga0395901_0005926 3300038443 Bacteria 12377
390 Ga0395901_0138467 3300038443 Bacteria 2558
391 Ga0436365_0183721 3300039437 Bacteria 950
392 Ga0436365_0506456 3300039437 Bacteria 108332
393 Ga0436365_1070491 3300039437 Bacteria 7543
394 Ga0436360_0901592 3300039438 Bacteria 5708
395 Ga0436361_0915994 3300039447 Bacteria 3372
396 Ga0436363_0019403 3300039450 Bacteria 2007
397 Ga0436363_0429426 3300039450 Bacteria 14490
398 Ga0436362_0296389 3300039453 Bacteria 1070
399 Ga0436362_0894899 3300039453 Bacteria 1405
400 Ga0451833_1112399 3300041491 Bacteria 963
401 Ga0450923_029871 3300042125 Unclassified 1106
402 Ga0466963_0117889 3300044694 Bacteria 1825
403 Ga0466958_0041165 3300045836 Bacteria 2779
404 Ga0466967_0249085 3300045976 Bacteria 1696
405 Ga0495603_0200963 3300046455 Unclassified 1152
406 Ga0495651_0194197 3300046462 Bacteria 1426
407 Ga0495580_0572443 3300046472 Unclassified 748
408 Ga0495628_0059647 3300046516 Bacteria 2995
409 Ga0495628_0084633 3300046516 Bacteria 2461
410 Ga0495652_0135672 3300046529 Bacteria 1942
411 Ga0495652_0157201 3300046529 Bacteria 1769
412 Ga0495652_0176014 3300046529 Bacteria 1647
413 Ga0495640_0478802 3300046533 Bacteria 759
414 Ga0495586_0267870 3300046535 Bacteria 976
415 Ga0495645_0016246 3300046543 Bacteria 5309
416 Ga0495645_0524437 3300046543 Unclassified 737
417 Ga0495667_0255883 3300046559 Bacteria 1114
418 Ga0495634_0334683 3300046642 Bacteria 909
419 Ga0495623_0177013 3300046679 Unclassified 1242
420 Ga0495674_0236917 3300047319 Bacteria 1505
421 Ga0495675_0033121 3300047444 Bacteria 3298
422 Ga0495684_0119445 3300047471 Bacteria 1986
423 Ga0495602_0171957 3300048088 Bacteria 1681
424 Ga0496100_0241103 3300048903 Bacteria 1334
425 Ga0496101_0144677 3300048904 Bacteria 1815
426 Ga0496102_0639567 3300048905 Bacteria 987
427 Ga0496104_0393626 3300048907 Unclassified 1298
428 Ga0496106_0024306 3300048909 Bacteria 4504
429 Ga0496107_0177598 3300048910 Unclassified 1581
430 Ga0496110_0937234 3300048913 Unclassified 772
431 Ga0496112_0195490 3300048915 Bacteria 1983
432 Ga0496113_0834755 3300048916 Bacteria 731
433 Ga0496114_0017119 3300048917 Bacteria 5846
434 Ga0496115_0403917 3300048918 Bacteria 1108
435 Ga0496126_0531292 3300048929 Bacteria 936
436 Ga0495682_0003564 3300049460 Bacteria 6880
437 Ga0501031_0124021 3300049568 Bacteria 1687
438 Ga0501032_0282963 3300049569 Bacteria 1073
439 Ga0501033_0170198 3300049570 Bacteria 1565
440 Ga0501034_0001153 3300049571 Bacteria 36629
441 Ga0501034_0017167 3300049571 Bacteria 7426
442 Ga0501034_0113305 3300049571 Bacteria 2702
443 Ga0501034_0123399 3300049571 Bacteria 2576
444 Ga0501034_0517184 3300049571 Bacteria 1106
445 Ga0501036_0506123 3300049572 Bacteria 1005
446 Ga0501036_0523331 3300049572 Bacteria 986
447 Ga0501037_0084961 3300049573 Bacteria 2291
448 Ga0501040_0071053 3300049576 Bacteria 2403
449 Ga0501040_0483034 3300049576 Bacteria 893
450 Ga0501042_0675831 3300049578 Bacteria 751
451 Ga0501043_0022656 3300049579 Bacteria 4925
452 Ga0501043_0042690 3300049579 Bacteria 3564
453 Ga0501043_0601623 3300049579 Unclassified 812
454 Ga0501046_0274299 3300049580 Bacteria 1236
455 Ga0501047_0081255 3300049581 Bacteria 3116
456 Ga0501048_0614798 3300049582 Bacteria 780
457 Ga0501068_0471936 3300049584 Bacteria 813
458 Ga0501070_0000025 3300049586 Bacteria 152175
459 Ga0501070_0023648 3300049586 Bacteria 5148
460 Ga0501070_0242866 3300049586 Bacteria 1474
461 Ga0501070_0550284 3300049586 Bacteria 924
462 Ga0501071_0007394 3300049587 Bacteria 7208
463 Ga0501074_0575189 3300049590 Bacteria 797
464 Ga0501075_0096540 3300049591 Bacteria 2243
465 Ga0501076_0333073 3300049592 Bacteria 1245
466 Ga0501079_0074393 3300049741 Bacteria 2626
467 Ga0501080_0001209 3300049742 Bacteria 21425
468 Ga0501080_0082127 3300049742 Bacteria 2994
469 Ga0501081_0155273 3300049743 Bacteria 1646
470 Ga0501035_0009379 3300049822 Bacteria 9098
471 Ga0501044_0038931 3300049823 Bacteria 4964
472 Ga0501044_0222599 3300049823 Bacteria 1837
473 Ga0501044_0264617 3300049823 Bacteria 1657
474 Ga0501044_0360794 3300049823 Bacteria 1371
475 Ga0501045_0124956 3300049824 Bacteria 1911
476 nmdc:mga03683_186535_c1 3300050489 Bacteria 948
477 nmdc:mga03683_4770_c1 3300050489 Bacteria 4525
478 nmdc:mga03n38_363728_c1 3300050490 Bacteria 790
479 nmdc:mga0yw44_13535_c1 3300050492 Bacteria 4300
480 nmdc:mga0yw44_56178_c1 3300050492 Bacteria 2397
481 nmdc:mga0k408_107906_c1 3300050493 Bacteria 1644
482 nmdc:mga06z11_17997_c1 3300050494 Bacteria 3219
483 nmdc:mga06z11_354691_c1 3300050494 Bacteria 878
484 nmdc:mga06z11_62448_c1 3300050494 Bacteria 1946
485 nmdc:mga06z11_62452_c1 3300050494 Bacteria 967
486 nmdc:mga06z11_87215_c1 3300050494 Bacteria 1687
487 nmdc:mga04h51_65547_c1 3300050495 Bacteria 1256
488 nmdc:mga04h51_76071_c1 3300050495 Bacteria 1182
489 nmdc:mga07m45_47418_c1 3300050496 Bacteria 2415
490 nmdc:mga08y16_324151_c1 3300050511 Bacteria 1585
491 nmdc:mga0n895_50756_c1 3300050512 Bacteria 4067
492 nmdc:mga0rr50_243550_c1 3300050513 Bacteria 1491
493 nmdc:mga0rr50_34939_c1 3300050513 Bacteria 3605
494 nmdc:mga08x19_177261_c1 3300050514 Bacteria 1454
495 nmdc:mga08x19_86_c1 3300050514 Bacteria 83486
496 nmdc:mga0sz30_6831_c1 3300050516 Bacteria 4258
497 Ga0500641_0000985 3300053096 Bacteria 10124
498 Ga0500655_009799 3300053133 Bacteria 1729
499 Ga0500568_0009392 3300053139 Bacteria 4652
500 Ga0500588_0204864 3300053146 Bacteria 732
501 Ga0500616_0001129 3300053153 Bacteria 27455
502 Ga0500619_028928 3300053154 Bacteria 1672
503 Ga0500552_000129 3300053733 Bacteria 6380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0988428 Ga0373937_0988428_231_755 173
2 3300025918 Ga0207662_10671725 Ga0207662_106717252 174
3 3300036401 Ga0373937_1142804 Ga0373937_1142804_18_587 184
4 3300009093 Ga0105240_10298181 Ga0105240_102981812 187
5 3300009098 Ga0105245_10027317 Ga0105245_100273173 187
6 3300009148 Ga0105243_10151108 Ga0105243_101511082 187
7 3300010375 Ga0105239_10017918 Ga0105239_100179189 187
8 3300046455 Ga0495603_0200963 Ga0495603_0200963_432_1010 187
9 3300048909 Ga0496106_0024306 Ga0496106_0024306_2441_3019 187
10 3300048915 Ga0496112_0195490 Ga0496112_0195490_414_992 187
11 3300048916 Ga0496113_0834755 Ga0496113_0834755_104_682 187
12 3300046472 Ga0495580_0572443 Ga0495580_0572443_144_734 191
13 3300048910 Ga0496107_0177598 Ga0496107_0177598_219_809 191
14 3300048918 Ga0496115_0403917 Ga0496115_0403917_13_603 191
15 3300005327 Ga0070658_10026372 Ga0070658_100263725 194
16 3300005336 Ga0070680_100005941 Ga0070680_1000059412 194
17 3300005341 Ga0070691_10035771 Ga0070691_100357713 194
18 3300005458 Ga0070681_10035462 Ga0070681_100354622 194
19 3300005530 Ga0070679_100252298 Ga0070679_1002522982 194
20 3300025917 Ga0207660_10209377 Ga0207660_102093772 194
21 3300031595 Ga0265313_10017910 Ga0265313_100179103 195
22 3300031712 Ga0265342_10017315 Ga0265342_100173153 195
23 3300005328 Ga0070676_10284243 Ga0070676_102842432 198
24 3300005331 Ga0070670_100295983 Ga0070670_1002959832 198
25 3300005353 Ga0070669_100158521 Ga0070669_1001585212 198
26 3300005354 Ga0070675_100363920 Ga0070675_1003639202 198
27 3300005356 Ga0070674_100304770 Ga0070674_1003047702 198
28 3300005364 Ga0070673_100195220 Ga0070673_1001952202 198
29 3300005441 Ga0070700_100296179 Ga0070700_1002961792 198
30 3300005543 Ga0070672_100185255 Ga0070672_1001852552 198
31 3300005547 Ga0070693_100373118 Ga0070693_1003731182 198
32 3300005548 Ga0070665_100114039 Ga0070665_1001140392 198
33 3300005840 Ga0068870_10372622 Ga0068870_103726222 198
34 3300009177 Ga0105248_11045495 Ga0105248_110454952 198
35 3300013296 Ga0157374_10678200 Ga0157374_106782002 198
36 3300025302 Ga0207426_1017855 Ga0207426_10178552 198
37 3300025907 Ga0207645_10116381 Ga0207645_101163812 198
38 3300025923 Ga0207681_10042709 Ga0207681_100427092 198
39 3300025926 Ga0207659_10320826 Ga0207659_103208262 198
40 3300025929 Ga0207664_10872466 Ga0207664_108724661 198
41 3300025936 Ga0207670_10062364 Ga0207670_100623642 198
42 3300025941 Ga0207711_10612903 Ga0207711_106129032 198
43 3300025960 Ga0207651_10147094 Ga0207651_101470942 198
44 3300025960 Ga0207651_10861490 Ga0207651_108614902 198
45 3300026118 Ga0207675_100402100 Ga0207675_1004021002 198
46 3300026121 Ga0207683_10041219 Ga0207683_100412193 198
47 3300026121 Ga0207683_10517954 Ga0207683_105179542 198
48 3300028379 Ga0268266_10004956 Ga0268266_100049564 198
49 3300039453 Ga0436362_0296389 Ga0436362_0296389_210_821 198
50 3300044694 Ga0466963_0117889 Ga0466963_0117889_617_1228 198
51 3300045836 Ga0466958_0041165 Ga0466958_0041165_1690_2301 198
52 3300045976 Ga0466967_0249085 Ga0466967_0249085_470_1081 198
53 3300049571 Ga0501034_0017167 Ga0501034_0017167_2473_3084 198
54 3300049571 Ga0501034_0123399 Ga0501034_0123399_1165_1776 198
55 3300049571 Ga0501034_0517184 Ga0501034_0517184_324_935 198
56 3300025903 Ga0207680_10276910 Ga0207680_102769102 201
57 3300005336 Ga0070680_100002746 Ga0070680_10000274610 202
58 3300005339 Ga0070660_100165328 Ga0070660_1001653282 202
59 3300005340 Ga0070689_100033096 Ga0070689_1000330964 202
60 3300005341 Ga0070691_10007728 Ga0070691_100077282 202
61 3300005458 Ga0070681_10032368 Ga0070681_100323685 202
62 3300005530 Ga0070679_100036701 Ga0070679_1000367014 202
63 3300005563 Ga0068855_100256312 Ga0068855_1002563122 202
64 3300006177 Ga0075362_10058694 Ga0075362_100586942 202
65 3300006195 Ga0075366_10006562 Ga0075366_100065628 202
66 3300009093 Ga0105240_10008684 Ga0105240_1000868410 202
67 3300009098 Ga0105245_10324023 Ga0105245_103240232 202
68 3300009174 Ga0105241_10731949 Ga0105241_107319492 202
69 3300013104 Ga0157370_10087573 Ga0157370_100875734 202
70 3300025909 Ga0207705_10058707 Ga0207705_100587073 202
71 3300025912 Ga0207707_10021807 Ga0207707_100218072 202
72 3300025917 Ga0207660_10179745 Ga0207660_101797452 202
73 3300025919 Ga0207657_10053730 Ga0207657_100537302 202
74 3300025921 Ga0207652_10022485 Ga0207652_100224855 202
75 3300025936 Ga0207670_10131577 Ga0207670_101315772 202
76 3300025949 Ga0207667_10220429 Ga0207667_102204292 202
77 3300025981 Ga0207640_10324517 Ga0207640_103245172 202
78 3300031238 Ga0265332_10113213 Ga0265332_101132132 202
79 3300035118 Ga0373954_0210035 Ga0373954_0210035_111_734 202
80 3300035724 Ga0373933_0091795 Ga0373933_0091795_729_1352 202
81 3300037312 Ga0395899_0020467 Ga0395899_0020467_956_1579 202
82 3300037312 Ga0395899_0321916 Ga0395899_0321916_247_870 202
83 3300037418 Ga0395900_0026276 Ga0395900_0026276_687_1310 202
84 3300037418 Ga0395900_0296205 Ga0395900_0296205_447_1070 202
85 3300038443 Ga0395901_0003454 Ga0395901_0003454_14684_15307 202
86 3300038443 Ga0395901_0138467 Ga0395901_0138467_1331_1954 202
87 3300049586 Ga0501070_0242866 Ga0501070_0242866_81_755 202
88 3300005563 Ga0068855_100008235 Ga0068855_10000823512 203
89 3300005937 Ga0081455_10095119 Ga0081455_100951193 203
90 3300005985 Ga0081539_10002291 Ga0081539_1000229110 203
91 3300005985 Ga0081539_10008631 Ga0081539_100086316 203
92 3300006038 Ga0075365_10029265 Ga0075365_100292653 203
93 3300006048 Ga0075363_100044381 Ga0075363_1000443812 203
94 3300006177 Ga0075362_10032217 Ga0075362_100322172 203
95 3300006178 Ga0075367_10014112 Ga0075367_100141122 203
96 3300009093 Ga0105240_10011383 Ga0105240_100113839 203
97 3300009098 Ga0105245_11330950 Ga0105245_113309501 203
98 3300021361 Ga0213872_10090113 Ga0213872_100901132 203
99 3300021441 Ga0213871_10002377 Ga0213871_100023771 203
100 3300025912 Ga0207707_10006036 Ga0207707_100060369 203
101 3300025913 Ga0207695_10018978 Ga0207695_100189784 203
102 3300025921 Ga0207652_10011903 Ga0207652_100119032 203
103 3300025922 Ga0207646_10921782 Ga0207646_109217822 203
104 3300025949 Ga0207667_10023583 Ga0207667_100235833 203
105 3300031238 Ga0265332_10120844 Ga0265332_101208442 203
106 3300031731 Ga0307405_10948521 Ga0307405_109485211 203
107 3300039438 Ga0436360_0901592 Ga0436360_0901592_3822_4442 203
108 3300039447 Ga0436361_0915994 Ga0436361_0915994_760_1380 203
109 3300049571 Ga0501034_0113305 Ga0501034_0113305_188_808 203
110 3300050490 nmdc:mga03n38_363728_c1 nmdc:mga03n38_363728_c1_128_748 203
111 3300050492 nmdc:mga0yw44_56178_c1 nmdc:mga0yw44_56178_c1_607_1227 203
112 3300050493 nmdc:mga0k408_107906_c1 nmdc:mga0k408_107906_c1_624_1244 203
113 3300050494 nmdc:mga06z11_17997_c1 nmdc:mga06z11_17997_c1_482_1102 203
114 3300050495 nmdc:mga04h51_76071_c1 nmdc:mga04h51_76071_c1_186_806 203
115 3300053146 Ga0500588_0204864 Ga0500588_0204864_53_673 203
116 3300006038 Ga0075365_10005557 Ga0075365_100055576 204
117 3300006042 Ga0075368_10132329 Ga0075368_101323292 204
118 3300006178 Ga0075367_10043761 Ga0075367_100437614 204
119 3300006186 Ga0075369_10006640 Ga0075369_100066403 204
120 3300006353 Ga0075370_10181171 Ga0075370_101811712 204
121 3300026088 Ga0207641_10497083 Ga0207641_104970832 204
122 3300027866 Ga0209813_10089274 Ga0209813_100892742 204
123 3300049584 Ga0501068_0471936 Ga0501068_0471936_17_634 204
124 3300050489 nmdc:mga03683_186535_c1 nmdc:mga03683_186535_c1_64_711 204
125 3300050492 nmdc:mga0yw44_13535_c1 nmdc:mga0yw44_13535_c1_2939_3586 204
126 3300050494 nmdc:mga06z11_354691_c1 nmdc:mga06z11_354691_c1_11_658 204
127 3300050494 nmdc:mga06z11_62448_c1 nmdc:mga06z11_62448_c1_560_1207 204
128 3300050494 nmdc:mga06z11_62452_c1 nmdc:mga06z11_62452_c1_27_674 204
129 3300050495 nmdc:mga04h51_65547_c1 nmdc:mga04h51_65547_c1_152_799 204
130 3300050496 nmdc:mga07m45_47418_c1 nmdc:mga07m45_47418_c1_695_1342 204
131 3300050516 nmdc:mga0sz30_6831_c1 nmdc:mga0sz30_6831_c1_1649_2296 204
132 3300053153 Ga0500616_0001129 Ga0500616_0001129_25828_26475 204
133 3300005335 Ga0070666_10004129 Ga0070666_100041292 205
134 3300005336 Ga0070680_100066441 Ga0070680_1000664413 205
135 3300005336 Ga0070680_100543922 Ga0070680_1005439222 205
136 3300005339 Ga0070660_100443332 Ga0070660_1004433322 205
137 3300005341 Ga0070691_10347964 Ga0070691_103479642 205
138 3300005367 Ga0070667_100113558 Ga0070667_1001135582 205
139 3300005434 Ga0070709_10863514 Ga0070709_108635141 205
140 3300005439 Ga0070711_100433725 Ga0070711_1004337252 205
141 3300005445 Ga0070708_100038826 Ga0070708_1000388263 205
142 3300005467 Ga0070706_100273397 Ga0070706_1002733971 205
143 3300005467 Ga0070706_100302763 Ga0070706_1003027631 205
144 3300005468 Ga0070707_100022682 Ga0070707_1000226823 205
145 3300005471 Ga0070698_100000727 Ga0070698_10000072740 205
146 3300005563 Ga0068855_100029277 Ga0068855_1000292774 205
147 3300005563 Ga0068855_100073457 Ga0068855_1000734574 205
148 3300005564 Ga0070664_100210977 Ga0070664_1002109772 205
149 3300005577 Ga0068857_100010598 Ga0068857_1000105985 205
150 3300005616 Ga0068852_101165397 Ga0068852_1011653971 205
151 3300005834 Ga0068851_10118381 Ga0068851_101183812 205
152 3300005843 Ga0068860_100004656 Ga0068860_1000046562 205
153 3300005843 Ga0068860_100361553 Ga0068860_1003615532 205
154 3300005937 Ga0081455_10000211 Ga0081455_1000021162 205
155 3300005937 Ga0081455_10003310 Ga0081455_1000331021 205
156 3300005937 Ga0081455_10023297 Ga0081455_100232976 205
157 3300005937 Ga0081455_10058090 Ga0081455_100580903 205
158 3300005937 Ga0081455_10125189 Ga0081455_101251893 205
159 3300006038 Ga0075365_10050595 Ga0075365_100505953 205
160 3300006177 Ga0075362_10020247 Ga0075362_100202473 205
161 3300006177 Ga0075362_10020837 Ga0075362_100208372 205
162 3300006178 Ga0075367_10033349 Ga0075367_100333492 205
163 3300006880 Ga0075429_100336920 Ga0075429_1003369202 205
164 3300007265 Ga0099794_10243728 Ga0099794_102437282 205
165 3300009093 Ga0105240_10098983 Ga0105240_100989833 205
166 3300009545 Ga0105237_10558623 Ga0105237_105586232 205
167 3300010375 Ga0105239_10217795 Ga0105239_102177951 205
168 3300013102 Ga0157371_10384954 Ga0157371_103849542 205
169 3300013307 Ga0157372_11719153 Ga0157372_117191531 205
170 3300014325 Ga0163163_11374843 Ga0163163_113748432 205
171 3300020081 Ga0206354_10852664 Ga0206354_108526642 205
172 3300025898 Ga0207692_10022137 Ga0207692_100221372 205
173 3300025903 Ga0207680_10034133 Ga0207680_100341334 205
174 3300025904 Ga0207647_10217649 Ga0207647_102176492 205
175 3300025910 Ga0207684_10152037 Ga0207684_101520372 205
176 3300025917 Ga0207660_10213518 Ga0207660_102135182 205
177 3300025917 Ga0207660_10437936 Ga0207660_104379362 205
178 3300025919 Ga0207657_10297971 Ga0207657_102979711 205
179 3300025928 Ga0207700_10591165 Ga0207700_105911651 205
180 3300025941 Ga0207711_10024967 Ga0207711_100249674 205
181 3300025949 Ga0207667_10152236 Ga0207667_101522363 205
182 3300025986 Ga0207658_10015749 Ga0207658_100157492 205
183 3300026116 Ga0207674_10093031 Ga0207674_100930313 205
184 3300026142 Ga0207698_10767321 Ga0207698_107673212 205
185 3300028380 Ga0268265_10125952 Ga0268265_101259522 205
186 3300028381 Ga0268264_10335270 Ga0268264_103352701 205
187 3300028381 Ga0268264_10385642 Ga0268264_103856422 205
188 3300031235 Ga0265330_10105652 Ga0265330_101056522 205
189 3300031241 Ga0265325_10013241 Ga0265325_100132415 205
190 3300031247 Ga0265340_10004413 Ga0265340_100044138 205
191 3300031247 Ga0265340_10023868 Ga0265340_100238682 205
192 3300031247 Ga0265340_10046833 Ga0265340_100468334 205
193 3300031344 Ga0265316_10024151 Ga0265316_100241515 205
194 3300031344 Ga0265316_10038154 Ga0265316_100381542 205
195 3300031711 Ga0265314_10190369 Ga0265314_101903692 205
196 3300035172 Ga0373955_0328849 Ga0373955_0328849_157_774 205
197 3300035692 Ga0373935_0167473 Ga0373935_0167473_314_940 205
198 3300035692 Ga0373935_0215922 Ga0373935_0215922_503_1120 205
199 3300035695 Ga0373927_0100670 Ga0373927_0100670_455_1105 205
200 3300036401 Ga0373937_0235112 Ga0373937_0235112_376_993 205
201 3300037068 Ga0373925_0145509 Ga0373925_0145509_1183_1809 205
202 3300037312 Ga0395899_0165885 Ga0395899_0165885_791_1417 205
203 3300037312 Ga0395899_0182875 Ga0395899_0182875_214_840 205
204 3300037418 Ga0395900_0362972 Ga0395900_0362972_13_639 205
205 3300038443 Ga0395901_0005926 Ga0395901_0005926_11083_11709 205
206 3300039453 Ga0436362_0894899 Ga0436362_0894899_742_1368 205
207 3300042125 Ga0450923_029871 Ga0450923_029871_423_1094 205
208 3300046516 Ga0495628_0084633 Ga0495628_0084633_533_1150 205
209 3300046533 Ga0495640_0478802 Ga0495640_0478802_103_729 205
210 3300047319 Ga0495674_0236917 Ga0495674_0236917_15_632 205
211 3300047471 Ga0495684_0119445 Ga0495684_0119445_1303_1920 205
212 3300048929 Ga0496126_0531292 Ga0496126_0531292_296_922 205
213 3300049572 Ga0501036_0523331 Ga0501036_0523331_288_914 205
214 3300049579 Ga0501043_0601623 Ga0501043_0601623_57_683 205
215 3300049580 Ga0501046_0274299 Ga0501046_0274299_398_1024 205
216 3300049582 Ga0501048_0614798 Ga0501048_0614798_126_752 205
217 3300049586 Ga0501070_0550284 Ga0501070_0550284_128_754 205
218 3300049742 Ga0501080_0082127 Ga0501080_0082127_1663_2289 205
219 3300049823 Ga0501044_0222599 Ga0501044_0222599_882_1508 205
220 3300050489 nmdc:mga03683_4770_c1 nmdc:mga03683_4770_c1_165_800 205
221 3300050494 nmdc:mga06z11_87215_c1 nmdc:mga06z11_87215_c1_311_946 205
222 3300053733 Ga0500552_000129 Ga0500552_000129_487_1122 205
223 3300003320 rootH2_10211674 rootH2_102116742 206
224 3300005367 Ga0070667_100085111 Ga0070667_1000851114 206
225 3300005444 Ga0070694_100075350 Ga0070694_1000753502 206
226 3300005545 Ga0070695_100176999 Ga0070695_1001769992 206
227 3300006177 Ga0075362_10112077 Ga0075362_101120772 206
228 3300006844 Ga0075428_100044374 Ga0075428_1000443743 206
229 3300025986 Ga0207658_10120077 Ga0207658_101200773 206
230 3300027907 Ga0207428_10651118 Ga0207428_106511181 206
231 3300031344 Ga0265316_10074892 Ga0265316_100748922 206
232 3300031711 Ga0265314_10101932 Ga0265314_101019322 206
233 3300031712 Ga0265342_10042803 Ga0265342_100428035 206
234 3300031712 Ga0265342_10107774 Ga0265342_101077742 206
235 3300039437 Ga0436365_0183721 Ga0436365_0183721_173_802 206
236 3300039437 Ga0436365_1070491 Ga0436365_1070491_5301_5945 206
237 3300039450 Ga0436363_0019403 Ga0436363_0019403_940_1569 206
238 3300046529 Ga0495652_0176014 Ga0495652_0176014_210_839 206
239 3300049571 Ga0501034_0001153 Ga0501034_0001153_22570_23199 206
240 3300049576 Ga0501040_0483034 Ga0501040_0483034_130_804 206
241 3300049586 Ga0501070_0023648 Ga0501070_0023648_1237_1866 206
242 3300049823 Ga0501044_0038931 Ga0501044_0038931_1972_2601 206
243 3300050511 nmdc:mga08y16_324151_c1 nmdc:mga08y16_324151_c1_197_868 206
244 3300053096 Ga0500641_0000985 Ga0500641_0000985_5486_6142 206
245 3300053139 Ga0500568_0009392 Ga0500568_0009392_3786_4430 206
246 3300005330 Ga0070690_100002720 Ga0070690_1000027204 207
247 3300005335 Ga0070666_10005958 Ga0070666_100059584 207
248 3300005340 Ga0070689_100139465 Ga0070689_1001394652 207
249 3300005344 Ga0070661_100015248 Ga0070661_1000152483 207
250 3300005364 Ga0070673_100150435 Ga0070673_1001504352 207
251 3300005365 Ga0070688_100113780 Ga0070688_1001137802 207
252 3300005367 Ga0070667_100019882 Ga0070667_1000198824 207
253 3300005438 Ga0070701_10030835 Ga0070701_100308352 207
254 3300005444 Ga0070694_100036868 Ga0070694_1000368682 207
255 3300005535 Ga0070684_100194431 Ga0070684_1001944313 207
256 3300005543 Ga0070672_100171936 Ga0070672_1001719362 207
257 3300005547 Ga0070693_100408568 Ga0070693_1004085681 207
258 3300005563 Ga0068855_100371882 Ga0068855_1003718822 207
259 3300005564 Ga0070664_100002486 Ga0070664_10000248610 207
260 3300005614 Ga0068856_100112695 Ga0068856_1001126952 207
261 3300005616 Ga0068852_100077594 Ga0068852_1000775944 207
262 3300005618 Ga0068864_100061188 Ga0068864_1000611883 207
263 3300005842 Ga0068858_100005358 Ga0068858_10000535813 207
264 3300005843 Ga0068860_100073475 Ga0068860_1000734753 207
265 3300005844 Ga0068862_100017870 Ga0068862_1000178706 207
266 3300006358 Ga0068871_100032260 Ga0068871_1000322603 207
267 3300006881 Ga0068865_100137658 Ga0068865_1001376582 207
268 3300009148 Ga0105243_10083510 Ga0105243_100835102 207
269 3300009176 Ga0105242_10032412 Ga0105242_100324124 207
270 3300009177 Ga0105248_10001967 Ga0105248_1000196715 207
271 3300009551 Ga0105238_10098035 Ga0105238_100980352 207
272 3300013308 Ga0157375_10001198 Ga0157375_100011984 207
273 3300014325 Ga0163163_10003735 Ga0163163_100037359 207
274 3300014326 Ga0157380_10518041 Ga0157380_105180412 207
275 3300014745 Ga0157377_10102776 Ga0157377_101027762 207
276 3300014968 Ga0157379_10054722 Ga0157379_100547223 207
277 3300014969 Ga0157376_10071352 Ga0157376_100713522 207
278 3300025900 Ga0207710_10021168 Ga0207710_100211682 207
279 3300025927 Ga0207687_10125225 Ga0207687_101252252 207
280 3300025938 Ga0207704_10216833 Ga0207704_102168332 207
281 3300025940 Ga0207691_10176531 Ga0207691_101765312 207
282 3300025941 Ga0207711_10020307 Ga0207711_100203072 207
283 3300025986 Ga0207658_10824515 Ga0207658_108245151 207
284 3300026023 Ga0207677_10245799 Ga0207677_102457992 207
285 3300026142 Ga0207698_10717391 Ga0207698_107173912 207
286 3300028379 Ga0268266_10075831 Ga0268266_100758312 207
287 3300028380 Ga0268265_10012443 Ga0268265_100124436 207
288 3300028381 Ga0268264_10045663 Ga0268264_100456634 207
289 3300028800 Ga0265338_10043683 Ga0265338_100436832 207
290 3300031235 Ga0265330_10104202 Ga0265330_101042022 207
291 3300031238 Ga0265332_10081105 Ga0265332_100811052 207
292 3300031241 Ga0265325_10007631 Ga0265325_100076317 207
293 3300031241 Ga0265325_10290642 Ga0265325_102906421 207
294 3300031247 Ga0265340_10042187 Ga0265340_100421872 207
295 3300031249 Ga0265339_10021727 Ga0265339_100217272 207
296 3300031249 Ga0265339_10039913 Ga0265339_100399133 207
297 3300031249 Ga0265339_10058458 Ga0265339_100584582 207
298 3300031249 Ga0265339_10253926 Ga0265339_102539262 207
299 3300031250 Ga0265331_10054232 Ga0265331_100542323 207
300 3300031344 Ga0265316_10020088 Ga0265316_100200889 207
301 3300031344 Ga0265316_10355982 Ga0265316_103559822 207
302 3300031595 Ga0265313_10095527 Ga0265313_100955272 207
303 3300031711 Ga0265314_10000144 Ga0265314_1000014481 207
304 3300031712 Ga0265342_10012117 Ga0265342_100121177 207
305 3300031712 Ga0265342_10208794 Ga0265342_102087942 207
306 3300031852 Ga0307410_10248836 Ga0307410_102488362 207
307 3300035398 Ga0316574_0436578 Ga0316574_0436578_130_807 207
308 3300046642 Ga0495634_0334683 Ga0495634_0334683_143_826 207
309 3300048903 Ga0496100_0241103 Ga0496100_0241103_562_1245 207
310 3300048904 Ga0496101_0144677 Ga0496101_0144677_1072_1755 207
311 3300048905 Ga0496102_0639567 Ga0496102_0639567_190_873 207
312 3300048917 Ga0496114_0017119 Ga0496114_0017119_2352_3035 207
313 3300049576 Ga0501040_0071053 Ga0501040_0071053_693_1376 207
314 3300049578 Ga0501042_0675831 Ga0501042_0675831_35_718 207
315 3300049587 Ga0501071_0007394 Ga0501071_0007394_5043_5726 207
316 3300049590 Ga0501074_0575189 Ga0501074_0575189_57_740 207
317 3300049591 Ga0501075_0096540 Ga0501075_0096540_858_1541 207
318 3300049592 Ga0501076_0333073 Ga0501076_0333073_463_1146 207
319 3300049743 Ga0501081_0155273 Ga0501081_0155273_322_1005 207
320 3300049824 Ga0501045_0124956 Ga0501045_0124956_766_1449 207
321 3300005336 Ga0070680_100000696 Ga0070680_1000006962 208
322 3300005339 Ga0070660_100053757 Ga0070660_1000537573 208
323 3300005341 Ga0070691_10000460 Ga0070691_1000046013 208
324 3300005344 Ga0070661_100036169 Ga0070661_1000361693 208
325 3300005344 Ga0070661_100246135 Ga0070661_1002461351 208
326 3300005344 Ga0070661_100419489 Ga0070661_1004194891 208
327 3300005434 Ga0070709_10001372 Ga0070709_100013726 208
328 3300005435 Ga0070714_100011085 Ga0070714_10001108512 208
329 3300005435 Ga0070714_100031603 Ga0070714_1000316032 208
330 3300005435 Ga0070714_100054777 Ga0070714_1000547772 208
331 3300005436 Ga0070713_100000001 Ga0070713_10000000156 208
332 3300005439 Ga0070711_100013169 Ga0070711_1000131695 208
333 3300005458 Ga0070681_10000002 Ga0070681_10000002463 208
334 3300005518 Ga0070699_100183226 Ga0070699_1001832263 208
335 3300005530 Ga0070679_100000152 Ga0070679_10000015210 208
336 3300005535 Ga0070684_100565895 Ga0070684_1005658952 208
337 3300005539 Ga0068853_100008575 Ga0068853_1000085753 208
338 3300005539 Ga0068853_100060038 Ga0068853_1000600381 208
339 3300005545 Ga0070695_100016429 Ga0070695_1000164297 208
340 3300005546 Ga0070696_100273218 Ga0070696_1002732182 208
341 3300005563 Ga0068855_100000038 Ga0068855_10000003822 208
342 3300005563 Ga0068855_100246203 Ga0068855_1002462032 208
343 3300005577 Ga0068857_100000126 Ga0068857_10000012613 208
344 3300005614 Ga0068856_100001878 Ga0068856_1000018785 208
345 3300005614 Ga0068856_100004915 Ga0068856_1000049156 208
346 3300005614 Ga0068856_100954343 Ga0068856_1009543432 208
347 3300005616 Ga0068852_100025741 Ga0068852_1000257415 208
348 3300005616 Ga0068852_100045880 Ga0068852_1000458803 208
349 3300005616 Ga0068852_100798896 Ga0068852_1007988962 208
350 3300005834 Ga0068851_10354718 Ga0068851_103547182 208
351 3300006175 Ga0070712_100000051 Ga0070712_10000005155 208
352 3300006871 Ga0075434_100163095 Ga0075434_1001630954 208
353 3300006914 Ga0075436_100000166 Ga0075436_10000016619 208
354 3300007076 Ga0075435_100140084 Ga0075435_1001400842 208
355 3300007076 Ga0075435_100150222 Ga0075435_1001502222 208
356 3300009093 Ga0105240_10000811 Ga0105240_1000081152 208
357 3300009093 Ga0105240_10004839 Ga0105240_1000483912 208
358 3300009093 Ga0105240_10021231 Ga0105240_100212315 208
359 3300009093 Ga0105240_10248639 Ga0105240_102486392 208
360 3300009101 Ga0105247_10170872 Ga0105247_101708721 208
361 3300009174 Ga0105241_10231875 Ga0105241_102318752 208
362 3300009177 Ga0105248_10000001 Ga0105248_100000011285 208
363 3300009545 Ga0105237_10244746 Ga0105237_102447461 208
364 3300009551 Ga0105238_10012827 Ga0105238_100128277 208
365 3300009551 Ga0105238_10044899 Ga0105238_100448992 208
366 3300010375 Ga0105239_10001844 Ga0105239_1000184415 208
367 3300010375 Ga0105239_10008686 Ga0105239_100086862 208
368 3300010375 Ga0105239_10032917 Ga0105239_100329171 208
369 3300010375 Ga0105239_10272855 Ga0105239_102728551 208
370 3300013100 Ga0157373_10008832 Ga0157373_100088324 208
371 3300013104 Ga0157370_10009137 Ga0157370_100091371 208
372 3300013105 Ga0157369_10166227 Ga0157369_101662273 208
373 3300013297 Ga0157378_10551370 Ga0157378_105513701 208
374 3300013297 Ga0157378_10756178 Ga0157378_107561781 208
375 3300013306 Ga0163162_10150077 Ga0163162_101500774 208
376 3300013307 Ga0157372_10011944 Ga0157372_1001194410 208
377 3300013307 Ga0157372_10160139 Ga0157372_101601392 208
378 3300014968 Ga0157379_10008452 Ga0157379_100084523 208
379 3300014968 Ga0157379_10020886 Ga0157379_100208868 208
380 3300014968 Ga0157379_10082126 Ga0157379_100821263 208
381 3300021384 Ga0213876_10000515 Ga0213876_1000051511 208
382 3300025900 Ga0207710_10058220 Ga0207710_100582202 208
383 3300025906 Ga0207699_10000116 Ga0207699_1000011622 208
384 3300025911 Ga0207654_10167334 Ga0207654_101673342 208
385 3300025912 Ga0207707_10000002 Ga0207707_10000002494 208
386 3300025913 Ga0207695_10000012 Ga0207695_10000012518 208
387 3300025913 Ga0207695_10113597 Ga0207695_101135972 208
388 3300025913 Ga0207695_10168015 Ga0207695_101680152 208
389 3300025914 Ga0207671_10022042 Ga0207671_100220422 208
390 3300025915 Ga0207693_10000052 Ga0207693_1000005258 208
391 3300025916 Ga0207663_10007552 Ga0207663_1000755210 208
392 3300025916 Ga0207663_10023361 Ga0207663_100233617 208
393 3300025917 Ga0207660_10000026 Ga0207660_1000002616 208
394 3300025920 Ga0207649_10018872 Ga0207649_100188724 208
395 3300025921 Ga0207652_10000431 Ga0207652_1000043116 208
396 3300025924 Ga0207694_10000006 Ga0207694_10000006150 208
397 3300025924 Ga0207694_10028932 Ga0207694_100289324 208
398 3300025928 Ga0207700_10000015 Ga0207700_10000015209 208
399 3300025929 Ga0207664_10007464 Ga0207664_1000746411 208
400 3300025929 Ga0207664_10040096 Ga0207664_100400963 208
401 3300025929 Ga0207664_10048979 Ga0207664_100489793 208
402 3300025941 Ga0207711_10000001 Ga0207711_10000001586 208
403 3300025949 Ga0207667_10000052 Ga0207667_10000052256 208
404 3300025949 Ga0207667_10004144 Ga0207667_1000414414 208
405 3300026041 Ga0207639_10184545 Ga0207639_101845453 208
406 3300026078 Ga0207702_10000011 Ga0207702_10000011204 208
407 3300026078 Ga0207702_10009546 Ga0207702_100095468 208
408 3300026116 Ga0207674_10000002 Ga0207674_10000002208 208
409 3300026142 Ga0207698_10125133 Ga0207698_101251332 208
410 3300026142 Ga0207698_10507714 Ga0207698_105077142 208
411 3300026142 Ga0207698_10602468 Ga0207698_106024682 208
412 3300028577 Ga0265318_10000035 Ga0265318_1000003594 208
413 3300031235 Ga0265330_10194556 Ga0265330_101945562 208
414 3300031240 Ga0265320_10000495 Ga0265320_1000049511 208
415 3300031241 Ga0265325_10000101 Ga0265325_1000010137 208
416 3300031241 Ga0265325_10010458 Ga0265325_100104583 208
417 3300031241 Ga0265325_10103290 Ga0265325_101032902 208
418 3300031247 Ga0265340_10014505 Ga0265340_100145052 208
419 3300031249 Ga0265339_10001839 Ga0265339_100018395 208
420 3300031344 Ga0265316_10007244 Ga0265316_100072445 208
421 3300031595 Ga0265313_10000725 Ga0265313_1000072519 208
422 3300031711 Ga0265314_10040105 Ga0265314_100401056 208
423 3300031730 Ga0307516_10048771 Ga0307516_100487713 208
424 3300034816 Ga0373930_0036713 Ga0373930_0036713_88_717 208
425 3300035084 Ga0373928_0045485 Ga0373928_0045485_354_983 208
426 3300035111 Ga0373923_0116356 Ga0373923_0116356_237_866 208
427 3300035111 Ga0373923_0321212 Ga0373923_0321212_59_688 208
428 3300035112 Ga0373932_0123950 Ga0373932_0123950_180_809 208
429 3300035410 Ga0373924_0180821 Ga0373924_0180821_209_838 208
430 3300035691 Ga0373931_0035729 Ga0373931_0035729_1828_2457 208
431 3300035692 Ga0373935_0075155 Ga0373935_0075155_239_868 208
432 3300035695 Ga0373927_0169511 Ga0373927_0169511_474_1103 208
433 3300035695 Ga0373927_0406014 Ga0373927_0406014_65_691 208
434 3300035724 Ga0373933_0024046 Ga0373933_0024046_1025_1654 208
435 3300035724 Ga0373933_0038018 Ga0373933_0038018_786_1415 208
436 3300036401 Ga0373937_0043688 Ga0373937_0043688_731_1360 208
437 3300036401 Ga0373937_0540792 Ga0373937_0540792_277_906 208
438 3300036401 Ga0373937_0864568 Ga0373937_0864568_14_661 208
439 3300036401 Ga0373937_1360471 Ga0373937_1360471_14_640 208
440 3300039437 Ga0436365_0506456 Ga0436365_0506456_101374_102018 208
441 3300039450 Ga0436363_0429426 Ga0436363_0429426_250_882 208
442 3300041491 Ga0451833_1112399 Ga0451833_1112399_85_726 208
443 3300046462 Ga0495651_0194197 Ga0495651_0194197_13_654 208
444 3300046516 Ga0495628_0059647 Ga0495628_0059647_871_1512 208
445 3300046529 Ga0495652_0135672 Ga0495652_0135672_169_810 208
446 3300046529 Ga0495652_0157201 Ga0495652_0157201_711_1352 208
447 3300046535 Ga0495586_0267870 Ga0495586_0267870_219_860 208
448 3300046543 Ga0495645_0016246 Ga0495645_0016246_2623_3264 208
449 3300046543 Ga0495645_0524437 Ga0495645_0524437_11_652 208
450 3300046559 Ga0495667_0255883 Ga0495667_0255883_24_665 208
451 3300046679 Ga0495623_0177013 Ga0495623_0177013_494_1135 208
452 3300047444 Ga0495675_0033121 Ga0495675_0033121_252_893 208
453 3300048088 Ga0495602_0171957 Ga0495602_0171957_626_1255 208
454 3300048907 Ga0496104_0393626 Ga0496104_0393626_123_749 208
455 3300048913 Ga0496110_0937234 Ga0496110_0937234_119_748 208
456 3300049460 Ga0495682_0003564 Ga0495682_0003564_4689_5333 208
457 3300049570 Ga0501033_0170198 Ga0501033_0170198_483_1130 208
458 3300049572 Ga0501036_0506123 Ga0501036_0506123_282_929 208
459 3300049579 Ga0501043_0042690 Ga0501043_0042690_2136_2783 208
460 3300049823 Ga0501044_0360794 Ga0501044_0360794_567_1214 208
461 3300050512 nmdc:mga0n895_50756_c1 nmdc:mga0n895_50756_c1_1837_2466 208
462 3300050513 nmdc:mga0rr50_243550_c1 nmdc:mga0rr50_243550_c1_395_1024 208
463 3300050513 nmdc:mga0rr50_34939_c1 nmdc:mga0rr50_34939_c1_2660_3289 208
464 3300050514 nmdc:mga08x19_177261_c1 nmdc:mga08x19_177261_c1_784_1413 208
465 3300050514 nmdc:mga08x19_86_c1 nmdc:mga08x19_86_c1_2699_3328 208
466 3300053133 Ga0500655_009799 Ga0500655_009799_755_1399 208
467 3300053154 Ga0500619_028928 Ga0500619_028928_414_1049 208
468 3300005336 Ga0070680_100039614 Ga0070680_1000396144 210
469 3300005339 Ga0070660_100003695 Ga0070660_1000036956 210
470 3300005341 Ga0070691_10003607 Ga0070691_100036075 210
471 3300005344 Ga0070661_100065069 Ga0070661_1000650692 210
472 3300005366 Ga0070659_100060072 Ga0070659_1000600723 210
473 3300005458 Ga0070681_10024892 Ga0070681_100248928 210
474 3300005530 Ga0070679_100036776 Ga0070679_1000367764 210
475 3300005539 Ga0068853_100026910 Ga0068853_1000269102 210
476 3300005563 Ga0068855_100028207 Ga0068855_1000282073 210
477 3300009174 Ga0105241_10544616 Ga0105241_105446162 210
478 3300009176 Ga0105242_10061335 Ga0105242_100613353 210
479 3300009551 Ga0105238_10009220 Ga0105238_100092205 210
480 3300013100 Ga0157373_10056975 Ga0157373_100569754 210
481 3300013104 Ga0157370_10006715 Ga0157370_100067158 210
482 3300013307 Ga0157372_10038925 Ga0157372_100389253 210
483 3300025909 Ga0207705_10000374 Ga0207705_1000037432 210
484 3300025912 Ga0207707_10001297 Ga0207707_1000129716 210
485 3300025917 Ga0207660_10001385 Ga0207660_100013858 210
486 3300025919 Ga0207657_10000562 Ga0207657_1000056211 210
487 3300025921 Ga0207652_10003336 Ga0207652_100033368 210
488 3300025924 Ga0207694_10009870 Ga0207694_100098705 210
489 3300025932 Ga0207690_10010644 Ga0207690_100106442 210
490 3300025934 Ga0207686_10041277 Ga0207686_100412772 210
491 3300025949 Ga0207667_10021507 Ga0207667_100215078 210
492 3300028800 Ga0265338_10008580 Ga0265338_1000858016 210
493 3300003320 rootH2_10001815 rootH2_1000181514 211
494 3300049568 Ga0501031_0124021 Ga0501031_0124021_1009_1644 211
495 3300049569 Ga0501032_0282963 Ga0501032_0282963_217_855 211
496 3300049573 Ga0501037_0084961 Ga0501037_0084961_861_1496 211
497 3300049579 Ga0501043_0022656 Ga0501043_0022656_2673_3308 211
498 3300049581 Ga0501047_0081255 Ga0501047_0081255_2204_2842 211
499 3300049586 Ga0501070_0000025 Ga0501070_0000025_126546_127181 211
500 3300049741 Ga0501079_0074393 Ga0501079_0074393_410_1045 211
501 3300049742 Ga0501080_0001209 Ga0501080_0001209_10672_11307 211
502 3300049822 Ga0501035_0009379 Ga0501035_0009379_4068_4703 211
503 3300049823 Ga0501044_0264617 Ga0501044_0264617_37_675 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13759

2OG-FeII_Oxy_5

Putative 2OG-Fe(II) oxygenase

121

229

0.86

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

122

231

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ipj-assembly1.cif.gz_C crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers complexes with n-acetyl-d-glucosamine 0.805 94 210
7u1h-assembly1.cif.gz_B crystal structure of lens culinaris vicilin 0.8005 94 206
4lej-assembly1.cif.gz_A crystal structure of the korean pine (pinus koraiensis) vicilin 0.7998 94 206
3smh-assembly2.cif.gz_E crystal structure of major peanut allergen ara h 1 0.7991 94 207
1uik-assembly1.cif.gz_B crystal structure of soybean beta-conglycinin alpha prime homotrimer 0.794 94 207
ID Description Score Start End Superfamily
4lejA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7998 94 206 2.60.120.10
5e1rB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7942 94 210 2.60.120.10
af_A0A1D6PUN9_3_157_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7808 94 208 2.60.120.10
af_I1K4A9_32_201_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7518 94 207 2.60.120.10
af_P33487_36_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.741 94 209 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1H8MHN0-F1-model_v4 2OG-Fe(II) oxygenase 0.9184 50 207
AF-A0A4Q2U5N0-F1-model_v4 2OG-Fe(II) oxygenase 0.8853 8 210
AF-A0A521T7L5-F1-model_v4 deleted 0.8839 93 211
AF-A0A4D7C5A5-F1-model_v4 2OG-Fe(II) oxygenase 0.8831 12 211
AF-A0A2Z3J6A1-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.8755 7 209

Feature Viewer

pLDDT pTM Quality
85.37 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map