F455994

General Info

Members Datasets Scaffolds Average Seq Length
503 190 477 153

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1037500|Ga0079104_10375002
Length 180
Sequence MPDFPASHRLRIGRYAEPNRIYLLTTNTLDREPVFADFALGRLVVAQFCRAHDLGLAKSLAWVVMPDHFHWLVELENCSLSKLMRETKSLSTREVNRSTGRTGPLWQYGFHDRALRREENLEKMARYVVANPLRAGLVDTIADYPLWDTIWIRNETELPPSLASQLPQDSMLFIDSESNP

Samples

Sample ID Description Type Environment
1 2511231015 Pseudomonas sp. GM49 Isolate Nodule
2 2511231019 Pseudomonas sp. GM67 Isolate Nodule
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
5 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
6 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
7 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
8 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
9 2765235841 Pseudomonas putida AA7 Isolate Unclassified
10 2773857673 Pseudomonas sp. 443 Isolate Unclassified
11 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
12 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
13 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
14 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
15 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
16 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
17 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
18 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
19 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
20 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
63 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
64 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
65 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
68 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
69 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
70 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
71 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
72 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
73 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
74 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
75 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
76 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
77 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
78 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
79 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
80 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
86 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
87 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
88 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
89 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
90 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
91 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
92 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
184 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
185 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
186 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
187 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
188 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
189 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
190 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.83
Metatranscriptomes 0
Isolates 5.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0.99
Rhizoplane 0.8
Rhizosphere 88.67
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1012069 3300003781 Bacteria 3243
2 Ga0065714_10012121 3300005288 Bacteria 1847
3 Ga0065714_10116090 3300005288 Bacteria 1382
4 Ga0065704_10074069 3300005289 Bacteria 6550
5 Ga0068855_101920205 3300005563 Bacteria 599
6 Ga0075432_10034252 3300006058 Bacteria 1763
7 Ga0075432_10070739 3300006058 Bacteria 1253
8 Ga0075432_10206526 3300006058 Bacteria 779
9 Ga0075362_10173219 3300006177 Bacteria 1043
10 Ga0075436_100667931 3300006914 Bacteria 768
11 Ga0079104_1037500 3300006946 Bacteria 1154
12 Ga0105251_10060392 3300009011 Bacteria 1785
13 Ga0105251_10093432 3300009011 Bacteria 1380
14 Ga0105251_10293222 3300009011 Bacteria 737
15 Ga0105251_10604715 3300009011 Bacteria 521
16 Ga0105244_10044470 3300009036 Bacteria 2288
17 Ga0105244_10075767 3300009036 Bacteria 1671
18 Ga0105244_10139555 3300009036 Bacteria 1166
19 Ga0105244_10183430 3300009036 Bacteria 992
20 Ga0105250_10000609 3300009092 Bacteria 23317
21 Ga0105250_10002234 3300009092 Bacteria 9855
22 Ga0105250_10087216 3300009092 Bacteria 1267
23 Ga0105250_10117616 3300009092 Bacteria 1091
24 Ga0105250_10187465 3300009092 Bacteria 869
25 Ga0105246_10235394 3300011119 Bacteria 1444
26 Ga0157345_1039508 3300012498 Bacteria 562
27 Ga0157373_10100167 3300013100 Bacteria 2039
28 Ga0157373_10149303 3300013100 Bacteria 1644
29 Ga0157373_10363589 3300013100 Bacteria 1033
30 Ga0157373_10582484 3300013100 Bacteria 813
31 Ga0157371_10350120 3300013102 Bacteria 1075
32 Ga0157370_10260149 3300013104 Bacteria 1604
33 Ga0157370_11353929 3300013104 Bacteria 641
34 Ga0157369_10213846 3300013105 Bacteria 2020
35 Ga0157369_10311416 3300013105 Bacteria 1637
36 Ga0157369_10912086 3300013105 Bacteria 901
37 Ga0163162_10634381 3300013306 Bacteria 1193
38 Ga0163162_10745834 3300013306 Bacteria 1099
39 Ga0163162_12224981 3300013306 Bacteria 630
40 Ga0157372_10327859 3300013307 Bacteria 1783
41 Ga0157375_10445892 3300013308 Bacteria 1460
42 Ga0182008_10566105 3300014497 Bacteria 633
43 Ga0182006_1058742 3300015261 Bacteria 1458
44 Ga0182007_10414324 3300015262 Bacteria 515
45 Ga0182005_1028468 3300015265 Bacteria 1523
46 Ga0163161_10229193 3300017792 Bacteria 1441
47 Ga0163161_10296943 3300017792 Bacteria 1271
48 Ga0163161_10325423 3300017792 Bacteria 1216
49 Ga0163161_10399411 3300017792 Bacteria 1102
50 Ga0163161_10474746 3300017792 Bacteria 1014
51 Ga0163161_10984385 3300017792 Bacteria 719
52 Ga0209563_100854 3300025230 Bacteria 9072
53 Ga0209676_1001519 3300025292 Bacteria 21116
54 Ga0207696_1000019 3300025711 Bacteria 476309
55 Ga0207696_1000101 3300025711 Bacteria 170899
56 Ga0207696_1000161 3300025711 Bacteria 109070
57 Ga0207696_1007872 3300025711 Bacteria 4132
58 Ga0207696_1019612 3300025711 Bacteria 2197
59 Ga0207696_1050310 3300025711 Bacteria 1193
60 Ga0207696_1064215 3300025711 Bacteria 1028
61 Ga0207655_1000532 3300025728 Bacteria 48217
62 Ga0207655_1005276 3300025728 Bacteria 8862
63 Ga0207655_1020736 3300025728 Bacteria 3365
64 Ga0207655_1024895 3300025728 Bacteria 2921
65 Ga0207655_1030576 3300025728 Bacteria 2502
66 Ga0207655_1038260 3300025728 Bacteria 2100
67 Ga0207655_1042126 3300025728 Bacteria 1948
68 Ga0207655_1072903 3300025728 Bacteria 1268
69 Ga0207655_1100932 3300025728 Bacteria 994
70 Ga0207655_1103637 3300025728 Bacteria 974
71 Ga0207655_1104916 3300025728 Bacteria 966
72 Ga0207713_1000159 3300025735 Bacteria 101793
73 Ga0207713_1002825 3300025735 Bacteria 12240
74 Ga0207713_1011953 3300025735 Bacteria 4681
75 Ga0207713_1014798 3300025735 Bacteria 4030
76 Ga0207713_1015263 3300025735 Bacteria 3952
77 Ga0207713_1024941 3300025735 Bacteria 2773
78 Ga0207713_1082827 3300025735 Bacteria 1149
79 Ga0207713_1099700 3300025735 Bacteria 1005
80 Ga0207709_10373877 3300025935 Bacteria 1082
81 Ga0207667_12022952 3300025949 Bacteria 536
82 Ga0209281_1006015 3300027111 Bacteria 3232
83 Ga0207428_10269287 3300027907 Bacteria 1267
84 Ga0207428_10670214 3300027907 Bacteria 743
85 Ga0316179_1078751 3300030734 Bacteria 4495
86 Ga0307408_100218294 3300031548 Bacteria 1554
87 Ga0307408_100594541 3300031548 Bacteria 982
88 Ga0307516_10617082 3300031730 Bacteria 739
89 Ga0307405_10217555 3300031731 Bacteria 1399
90 Ga0307407_10123473 3300031903 Bacteria 1645
91 Ga0307412_10238690 3300031911 Bacteria 1404
92 Ga0307414_10078474 3300032004 Bacteria 2407
93 Ga0307414_10098657 3300032004 Bacteria 2192
94 Ga0439438_004564 3300041405 Bacteria 5269
95 Ga0439438_029792 3300041405 Bacteria 1459
96 Ga0439438_054217 3300041405 Bacteria 1013
97 Ga0439447_002850 3300041407 Bacteria 6205
98 Ga0439447_005181 3300041407 Bacteria 4362
99 Ga0439447_006316 3300041407 Bacteria 3857
100 Ga0439447_022184 3300041407 Bacteria 1665
101 Ga0439447_036601 3300041407 Bacteria 1211
102 Ga0439447_042775 3300041407 Bacteria 1099
103 Ga0439447_059332 3300041407 Bacteria 902
104 Ga0439461_0145183 3300041410 Bacteria 609
105 Ga0439466_0000878 3300041411 Bacteria 11440
106 Ga0439466_0011728 3300041411 Bacteria 3236
107 Ga0439466_0036185 3300041411 Bacteria 1667
108 Ga0439466_0041039 3300041411 Bacteria 1545
109 Ga0439466_0045979 3300041411 Bacteria 1442
110 Ga0439466_0059315 3300041411 Bacteria 1236
111 Ga0439466_0088706 3300041411 Bacteria 971
112 Ga0439466_0161457 3300041411 Bacteria 685
113 Ga0439465_0086848 3300041413 Bacteria 1066
114 Ga0439465_0193044 3300041413 Bacteria 740
115 Ga0439432_009089 3300042006 Bacteria 3470
116 Ga0439432_009917 3300042006 Bacteria 3312
117 Ga0439432_111728 3300042006 Bacteria 812
118 Ga0439451_012763 3300042009 Bacteria 1696
119 Ga0439451_013033 3300042009 Bacteria 1679
120 Ga0439451_026057 3300042009 Bacteria 1178
121 Ga0439451_105410 3300042009 Bacteria 570
122 Ga0439452_018703 3300042010 Bacteria 1842
123 Ga0439452_039268 3300042010 Bacteria 1121
124 Ga0439456_008326 3300042013 Bacteria 2139
125 Ga0439456_029401 3300042013 Bacteria 1173
126 Ga0439456_029726 3300042013 Bacteria 1167
127 Ga0439456_032134 3300042013 Bacteria 1126
128 Ga0439456_050356 3300042013 Bacteria 909
129 Ga0439463_026172 3300042016 Bacteria 1465
130 Ga0450911_000708 3300042115 Bacteria 9741
131 Ga0450911_008556 3300042115 Bacteria 1453
132 Ga0450911_013783 3300042115 Bacteria 1078
133 Ga0450919_013726 3300042121 Bacteria 916
134 Ga0450919_041975 3300042121 Bacteria 531
135 Ga0450920_004135 3300042122 Bacteria 2540
136 Ga0450921_015587 3300042123 Bacteria 684
137 Ga0450900_006659 3300042136 Bacteria 1404
138 Ga0450902_013532 3300042137 Bacteria 1314
139 Ga0450902_048657 3300042137 Bacteria 726
140 Ga0450903_003059 3300042138 Bacteria 2916
141 Ga0450903_015679 3300042138 Bacteria 1192
142 Ga0450904_001831 3300042139 Bacteria 2769
143 Ga0450905_003867 3300042142 Bacteria 1972
144 Ga0450906_012214 3300042145 Bacteria 1594
145 Ga0450906_014081 3300042145 Bacteria 1467
146 Ga0450906_024721 3300042145 Bacteria 1067
147 Ga0450907_001074 3300042146 Bacteria 6337
148 Ga0450907_002040 3300042146 Bacteria 4023
149 Ga0450907_003459 3300042146 Bacteria 2815
150 Ga0439446_0004080 3300042156 Bacteria 3680
151 Ga0439446_0082903 3300042156 Bacteria 995
152 Ga0450908_010560 3300042184 Bacteria 1702
153 Ga0450908_014164 3300042184 Bacteria 1436
154 Ga0450908_038376 3300042184 Bacteria 830
155 Ga0450909_004722 3300042185 Bacteria 1948
156 Ga0450909_022064 3300042185 Bacteria 952
157 Ga0439434_0005608 3300042435 Bacteria 3665
158 Ga0439434_0034125 3300042435 Bacteria 1553
159 Ga0439464_0042132 3300042439 Bacteria 1303
160 Ga0439460_0015264 3300042461 Bacteria 2030
161 Ga0439460_0027736 3300042461 Bacteria 1592
162 Ga0450918_041712 3300042531 Bacteria 824
163 Ga0450893_0024632 3300042532 Bacteria 1051
164 Ga0439440_0010907 3300042993 Bacteria 1909
165 Ga0439440_0016567 3300042993 Bacteria 1615
166 Ga0439440_0027597 3300042993 Bacteria 1320
167 Ga0495617_019739 3300046452 Bacteria 2278
168 Ga0495617_064451 3300046452 Bacteria 1209
169 Ga0495617_067346 3300046452 Bacteria 1179
170 Ga0495617_081965 3300046452 Bacteria 1056
171 Ga0495617_116942 3300046452 Bacteria 860
172 Ga0495627_014542 3300046453 Bacteria 2743
173 Ga0495627_054770 3300046453 Bacteria 1191
174 Ga0495627_102268 3300046453 Bacteria 817
175 Ga0495592_0079453 3300046454 Bacteria 2374
176 Ga0495603_0417993 3300046455 Bacteria 768
177 Ga0495590_0009528 3300046457 Bacteria 3686
178 Ga0495590_0033553 3300046457 Bacteria 1794
179 Ga0495590_0075291 3300046457 Bacteria 1187
180 Ga0495590_0116662 3300046457 Bacteria 955
181 Ga0495591_002999 3300046458 Bacteria 8995
182 Ga0495591_004328 3300046458 Bacteria 6995
183 Ga0495591_051759 3300046458 Bacteria 1119
184 Ga0495591_055349 3300046458 Bacteria 1069
185 Ga0495591_061893 3300046458 Bacteria 992
186 Ga0495638_0035616 3300046460 Bacteria 3172
187 Ga0495638_0127658 3300046460 Bacteria 1497
188 Ga0495638_0129556 3300046460 Bacteria 1483
189 Ga0495638_0140175 3300046460 Bacteria 1412
190 Ga0495638_0314070 3300046460 Bacteria 840
191 Ga0495638_0423235 3300046460 Bacteria 686
192 Ga0495653_0057113 3300046463 Bacteria 2973
193 Ga0495653_0290072 3300046463 Bacteria 1070
194 Ga0495653_0308634 3300046463 Bacteria 1029
195 Ga0495650_0010955 3300046471 Bacteria 5016
196 Ga0495605_0011610 3300046474 Bacteria 4904
197 Ga0495605_0017163 3300046474 Bacteria 3904
198 Ga0495605_0055145 3300046474 Bacteria 1921
199 Ga0495605_0163535 3300046474 Bacteria 987
200 Ga0495605_0182061 3300046474 Bacteria 923
201 Ga0495605_0205492 3300046474 Bacteria 857
202 Ga0495605_0234682 3300046474 Bacteria 789
203 Ga0495584_0015983 3300046491 Bacteria 3829
204 Ga0495584_0054640 3300046491 Bacteria 2009
205 Ga0495584_0078744 3300046491 Bacteria 1658
206 Ga0495584_0112801 3300046491 Bacteria 1375
207 Ga0495585_0013265 3300046492 Bacteria 4826
208 Ga0495585_0085042 3300046492 Bacteria 1710
209 Ga0495585_0106997 3300046492 Bacteria 1490
210 Ga0495585_0133061 3300046492 Bacteria 1307
211 Ga0495585_0144606 3300046492 Bacteria 1243
212 Ga0495585_0148135 3300046492 Bacteria 1225
213 Ga0495585_0183917 3300046492 Bacteria 1073
214 Ga0495585_0343338 3300046492 Bacteria 726
215 Ga0495596_0006850 3300046500 Bacteria 5195
216 Ga0495607_0026676 3300046501 Bacteria 3582
217 Ga0495607_0049853 3300046501 Bacteria 2439
218 Ga0495607_0078627 3300046501 Bacteria 1819
219 Ga0495607_0081006 3300046501 Bacteria 1783
220 Ga0495607_0091484 3300046501 Bacteria 1647
221 Ga0495607_0109926 3300046501 Bacteria 1463
222 Ga0495607_0129497 3300046501 Bacteria 1315
223 Ga0495607_0144406 3300046501 Bacteria 1224
224 Ga0495607_0421968 3300046501 Bacteria 603
225 Ga0495583_0071078 3300046506 Bacteria 1529
226 Ga0495606_0049365 3300046507 Bacteria 2760
227 Ga0495606_0069783 3300046507 Bacteria 2218
228 Ga0495606_0108613 3300046507 Bacteria 1676
229 Ga0495606_0127976 3300046507 Bacteria 1512
230 Ga0495610_0059090 3300046512 Bacteria 1831
231 Ga0495610_0079142 3300046512 Bacteria 1513
232 Ga0495610_0082119 3300046512 Bacteria 1477
233 Ga0495610_0087969 3300046512 Bacteria 1412
234 Ga0495610_0088983 3300046512 Bacteria 1402
235 Ga0495610_0100984 3300046512 Bacteria 1292
236 Ga0495610_0107971 3300046512 Bacteria 1236
237 Ga0495610_0153105 3300046512 Bacteria 981
238 Ga0495616_0026170 3300046513 Bacteria 3108
239 Ga0495616_0085074 3300046513 Bacteria 1506
240 Ga0495616_0095976 3300046513 Bacteria 1396
241 Ga0495616_0136670 3300046513 Bacteria 1119
242 Ga0495616_0168051 3300046513 Bacteria 982
243 Ga0495620_0014528 3300046515 Bacteria 3999
244 Ga0495620_0052703 3300046515 Bacteria 1726
245 Ga0495620_0056351 3300046515 Bacteria 1653
246 Ga0495620_0096581 3300046515 Bacteria 1181
247 Ga0495620_0104092 3300046515 Bacteria 1129
248 Ga0495620_0107998 3300046515 Bacteria 1104
249 Ga0495628_0706503 3300046516 Bacteria 712
250 Ga0495631_0001379 3300046518 Bacteria 14791
251 Ga0495631_0090121 3300046518 Bacteria 1320
252 Ga0495631_0094423 3300046518 Bacteria 1287
253 Ga0495632_0009300 3300046519 Bacteria 5932
254 Ga0495632_0033620 3300046519 Bacteria 2630
255 Ga0495632_0089235 3300046519 Bacteria 1463
256 Ga0495632_0103634 3300046519 Bacteria 1339
257 Ga0495632_0157998 3300046519 Bacteria 1045
258 Ga0495632_0199257 3300046519 Bacteria 912
259 Ga0495632_0431262 3300046519 Bacteria 573
260 Ga0495637_0010319 3300046520 Bacteria 4524
261 Ga0495637_0012773 3300046520 Bacteria 4007
262 Ga0495637_0039263 3300046520 Bacteria 2044
263 Ga0495637_0067134 3300046520 Bacteria 1456
264 Ga0495637_0068424 3300046520 Bacteria 1438
265 Ga0495637_0071769 3300046520 Bacteria 1395
266 Ga0495637_0120761 3300046520 Bacteria 1008
267 Ga0495637_0124822 3300046520 Bacteria 987
268 Ga0495637_0277515 3300046520 Bacteria 598
269 Ga0495643_0068733 3300046522 Bacteria 1864
270 Ga0495643_0123914 3300046522 Bacteria 1303
271 Ga0495643_0144845 3300046522 Bacteria 1181
272 Ga0495643_0146703 3300046522 Bacteria 1172
273 Ga0495643_0213500 3300046522 Bacteria 919
274 Ga0495643_0220311 3300046522 Bacteria 900
275 Ga0495643_0258980 3300046522 Bacteria 808
276 Ga0495644_0031647 3300046523 Bacteria 1999
277 Ga0495648_0011366 3300046524 Bacteria 6709
278 Ga0495648_0040024 3300046524 Bacteria 2976
279 Ga0495648_0090022 3300046524 Bacteria 1720
280 Ga0495648_0121074 3300046524 Bacteria 1406
281 Ga0495648_0198717 3300046524 Bacteria 1005
282 Ga0495648_0325099 3300046524 Bacteria 711
283 Ga0495666_0058872 3300046526 Bacteria 1837
284 Ga0495666_0082249 3300046526 Bacteria 1522
285 Ga0495666_0102383 3300046526 Bacteria 1349
286 Ga0495666_0136066 3300046526 Bacteria 1147
287 Ga0495642_0008536 3300046528 Bacteria 3919
288 Ga0495652_0066872 3300046529 Bacteria 3014
289 Ga0495654_0023933 3300046530 Bacteria 3159
290 Ga0495654_0032535 3300046530 Bacteria 2643
291 Ga0495654_0034346 3300046530 Bacteria 2559
292 Ga0495654_0062590 3300046530 Bacteria 1783
293 Ga0495654_0074391 3300046530 Bacteria 1604
294 Ga0495654_0082341 3300046530 Bacteria 1506
295 Ga0495654_0101467 3300046530 Bacteria 1324
296 Ga0495654_0113436 3300046530 Bacteria 1234
297 Ga0495654_0149654 3300046530 Bacteria 1033
298 Ga0495654_0208046 3300046530 Bacteria 833
299 Ga0495654_0299914 3300046530 Bacteria 656
300 Ga0495587_0057256 3300046536 Bacteria 2292
301 Ga0495609_0014758 3300046538 Bacteria 3667
302 Ga0495609_0089792 3300046538 Bacteria 1336
303 Ga0495609_0303029 3300046538 Bacteria 650
304 Ga0495597_0033963 3300046542 Bacteria 2306
305 Ga0495597_0036314 3300046542 Bacteria 2219
306 Ga0495597_0045887 3300046542 Bacteria 1937
307 Ga0495597_0075174 3300046542 Bacteria 1450
308 Ga0495597_0092947 3300046542 Bacteria 1278
309 Ga0495597_0132202 3300046542 Bacteria 1034
310 Ga0495645_0075857 3300046543 Bacteria 2420
311 Ga0495645_0972995 3300046543 Bacteria 500
312 Ga0495622_0132974 3300046557 Bacteria 1132
313 Ga0495633_0074901 3300046558 Bacteria 1577
314 Ga0495668_0005069 3300046616 Bacteria 9067
315 Ga0495668_0038947 3300046616 Bacteria 2654
316 Ga0495634_0047668 3300046642 Bacteria 2886
317 Ga0495611_0495152 3300046648 Bacteria 555
318 Ga0495625_0027685 3300046660 Bacteria 4260
319 Ga0495625_0049909 3300046660 Bacteria 3005
320 Ga0495625_0067122 3300046660 Bacteria 2525
321 Ga0495625_0176348 3300046660 Bacteria 1424
322 Ga0495625_0253930 3300046660 Bacteria 1140
323 Ga0495625_0288991 3300046660 Bacteria 1052
324 Ga0495625_0319205 3300046660 Bacteria 989
325 Ga0495661_0004285 3300046665 Bacteria 10354
326 Ga0495661_0160874 3300046665 Bacteria 1205
327 Ga0495661_0274929 3300046665 Bacteria 851
328 Ga0495588_0115358 3300046674 Bacteria 1415
329 Ga0495623_0141937 3300046679 Bacteria 1427
330 Ga0495669_0094876 3300046684 Bacteria 1381
331 Ga0495613_0072718 3300046689 Bacteria 2506
332 Ga0495624_0041511 3300046690 Bacteria 2942
333 Ga0495670_0025293 3300046691 Bacteria 2936
334 Ga0495670_0095444 3300046691 Bacteria 1525
335 Ga0495670_0182521 3300046691 Bacteria 1108
336 Ga0495670_0331677 3300046691 Bacteria 817
337 Ga0495670_0468356 3300046691 Bacteria 683
338 Ga0495670_0697807 3300046691 Bacteria 554
339 Ga0495671_0007405 3300046692 Bacteria 6259
340 Ga0495671_0071490 3300046692 Bacteria 1704
341 Ga0495671_0090162 3300046692 Bacteria 1500
342 Ga0495671_0107457 3300046692 Bacteria 1362
343 Ga0495671_0146659 3300046692 Bacteria 1149
344 Ga0495671_0269180 3300046692 Bacteria 821
345 Ga0495671_0289544 3300046692 Bacteria 788
346 Ga0495649_0096034 3300046694 Bacteria 1577
347 Ga0495649_0116317 3300046694 Bacteria 1415
348 Ga0495649_0168138 3300046694 Bacteria 1148
349 Ga0495649_0302183 3300046694 Bacteria 814
350 Ga0495589_0014607 3300046794 Bacteria 4041
351 Ga0495589_0017326 3300046794 Bacteria 3698
352 Ga0495589_0047054 3300046794 Bacteria 2138
353 Ga0495589_0101698 3300046794 Bacteria 1390
354 Ga0495589_0111629 3300046794 Bacteria 1319
355 Ga0495589_0180719 3300046794 Bacteria 1000
356 Ga0495600_0052079 3300046809 Bacteria 2672
357 Ga0495600_0400067 3300046809 Bacteria 855
358 Ga0495660_0000616 3300046810 Bacteria 28012
359 Ga0495660_0041437 3300046810 Bacteria 2549
360 Ga0495660_0081564 3300046810 Bacteria 1695
361 Ga0495660_0085932 3300046810 Bacteria 1642
362 Ga0495660_0090739 3300046810 Bacteria 1588
363 Ga0495660_0101809 3300046810 Bacteria 1477
364 Ga0495660_0106333 3300046810 Bacteria 1437
365 Ga0495660_0195940 3300046810 Bacteria 967
366 Ga0495660_0205041 3300046810 Bacteria 939
367 Ga0495660_0245474 3300046810 Bacteria 833
368 Ga0495660_0265012 3300046810 Bacteria 792
369 Ga0495604_0201281 3300047317 Bacteria 1381
370 Ga0495672_0006681 3300047320 Bacteria 8859
371 Ga0495672_0037891 3300047320 Bacteria 2947
372 Ga0495672_0104377 3300047320 Bacteria 1531
373 Ga0495672_0113797 3300047320 Bacteria 1448
374 Ga0495672_0162356 3300047320 Bacteria 1147
375 Ga0495672_0217855 3300047320 Bacteria 944
376 Ga0495672_0322989 3300047320 Bacteria 724
377 Ga0495672_0469859 3300047320 Bacteria 564
378 Ga0495676_0079497 3300047321 Bacteria 2492
379 Ga0495676_0137658 3300047321 Bacteria 1753
380 Ga0495676_0341950 3300047321 Bacteria 1001
381 Ga0495680_0085258 3300047322 Bacteria 2378
382 Ga0495680_0178990 3300047322 Bacteria 1531
383 Ga0495683_0003171 3300047323 Bacteria 9607
384 Ga0495683_0003249 3300047323 Bacteria 9503
385 Ga0495683_0046939 3300047323 Bacteria 2167
386 Ga0495683_0094852 3300047323 Bacteria 1441
387 Ga0495683_0109184 3300047323 Bacteria 1322
388 Ga0495683_0137334 3300047323 Bacteria 1148
389 Ga0495687_007225 3300047443 Bacteria 6598
390 Ga0495675_0285348 3300047444 Bacteria 983
391 Ga0495675_0522936 3300047444 Bacteria 679
392 Ga0495679_076086 3300047446 Bacteria 960
393 Ga0495673_0014503 3300047469 Bacteria 4094
394 Ga0495673_0016649 3300047469 Bacteria 3754
395 Ga0495673_0041461 3300047469 Bacteria 2072
396 Ga0495673_0054079 3300047469 Bacteria 1747
397 Ga0495673_0062877 3300047469 Bacteria 1584
398 Ga0495673_0104364 3300047469 Bacteria 1141
399 Ga0495673_0185873 3300047469 Bacteria 784
400 Ga0495673_0226281 3300047469 Bacteria 690
401 Ga0495681_0005425 3300047470 Bacteria 8539
402 Ga0495681_0014387 3300047470 Bacteria 4538
403 Ga0495681_0014892 3300047470 Bacteria 4431
404 Ga0495681_0073236 3300047470 Bacteria 1547
405 Ga0495681_0097254 3300047470 Bacteria 1291
406 Ga0495681_0100323 3300047470 Bacteria 1266
407 Ga0495681_0251658 3300047470 Bacteria 697
408 Ga0495684_0081438 3300047471 Bacteria 2456
409 Ga0495684_0291155 3300047471 Bacteria 1175
410 Ga0495686_0027444 3300047472 Bacteria 3717
411 Ga0495686_0070356 3300047472 Bacteria 2156
412 Ga0495686_0193318 3300047472 Bacteria 1172
413 Ga0495686_0247125 3300047472 Bacteria 1004
414 Ga0495686_0565663 3300047472 Bacteria 592
415 Ga0495593_0030774 3300047673 Bacteria 2934
416 Ga0495593_0123552 3300047673 Bacteria 1316
417 Ga0495602_0053700 3300048088 Bacteria 3565
418 Ga0495615_0068382 3300048090 Bacteria 952
419 Ga0495626_0002967 3300048091 Bacteria 11256
420 Ga0495626_0009227 3300048091 Bacteria 5338
421 Ga0495626_0009973 3300048091 Bacteria 5100
422 Ga0495626_0073672 3300048091 Bacteria 1529
423 Ga0495626_0085827 3300048091 Bacteria 1391
424 Ga0495626_0094557 3300048091 Bacteria 1310
425 Ga0495626_0133438 3300048091 Bacteria 1058
426 Ga0495626_0136521 3300048091 Bacteria 1042
427 Ga0496110_1589601 3300048913 Bacteria 564
428 Ga0496114_0006055 3300048917 Bacteria 9519
429 Ga0496116_0030573 3300048919 Bacteria 3865
430 Ga0496116_0046424 3300048919 Bacteria 2931
431 Ga0496117_0002645 3300048920 Bacteria 22206
432 Ga0496117_0110583 3300048920 Bacteria 1712
433 Ga0496117_0184223 3300048920 Bacteria 1196
434 Ga0496118_0007805 3300048921 Bacteria 11227
435 Ga0496118_0157453 3300048921 Bacteria 1410
436 Ga0496118_0219331 3300048921 Bacteria 1108
437 Ga0496119_0234028 3300048922 Bacteria 933
438 Ga0496121_0067339 3300048924 Bacteria 2903
439 Ga0496121_0179308 3300048924 Bacteria 1530
440 Ga0496121_0326811 3300048924 Bacteria 1030
441 Ga0496122_0001163 3300048925 Bacteria 45014
442 Ga0496122_0002835 3300048925 Bacteria 23765
443 Ga0496122_0246554 3300048925 Bacteria 1003
444 Ga0496123_0000088 3300048926 Bacteria 180478
445 Ga0496123_0253974 3300048926 Bacteria 865
446 Ga0496124_0005913 3300048927 Bacteria 13540
447 Ga0496124_0022394 3300048927 Bacteria 5793
448 Ga0496124_0276562 3300048927 Bacteria 1226
449 Ga0496124_0396397 3300048927 Bacteria 959
450 Ga0496125_0028879 3300048928 Bacteria 4996
451 Ga0496125_0235578 3300048928 Bacteria 1167
452 Ga0496125_0321257 3300048928 Bacteria 938
453 Ga0496126_0864321 3300048929 Bacteria 689
454 Ga0495678_003757 3300049459 Bacteria 9168
455 Ga0495678_021616 3300049459 Bacteria 2829
456 Ga0495678_047403 3300049459 Bacteria 1683
457 Ga0495678_058867 3300049459 Bacteria 1450
458 Ga0495678_060439 3300049459 Bacteria 1425
459 Ga0495678_063966 3300049459 Bacteria 1372
460 Ga0495678_069730 3300049459 Bacteria 1292
461 Ga0495678_083671 3300049459 Bacteria 1139
462 Ga0495678_096899 3300049459 Bacteria 1028
463 Ga0495678_179220 3300049459 Bacteria 665
464 Ga0495682_0101716 3300049460 Bacteria 1030
465 Ga0501034_0000214 3300049571 Bacteria 110247
466 Ga0501240_048449 3300049673 Bacteria 723
467 Ga0501269_022960 3300049766 Bacteria 781
468 nmdc:mga03683_103525_c1 3300050489 Bacteria 1253
469 nmdc:mga00v17_94050_c1 3300050491 Bacteria 1885
470 nmdc:mga08x19_606270_c1 3300050514 Bacteria 776
471 nmdc:mga08x19_761303_c1 3300050514 Bacteria 688
472 Ga0500572_171046 3300053111 Bacteria 711
473 Ga0500655_068598 3300053133 Unclassified 721
474 Ga0500573_0094388 3300053140 Bacteria 1687
475 Ga0500586_011494 3300053145 Bacteria 2538
476 Ga0500586_075054 3300053145 Bacteria 1185
477 Ga0500649_178987 3300053722 Bacteria 719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048091 Ga0495626_0002967 Ga0495626_0002967_10071_10511 145
2 iso_pu_bacteria 2600254954 2600445105 145
3 iso_pu_bacteria 2765235841 2765581788 147
4 iso_pu_bacteria 3007872151 3007875761 147
5 iso_pu_bacteria 8054929484 8054930256 147
6 3300025735 Ga0207713_1000159 Ga0207713_100015957 148
7 3300046474 Ga0495605_0234682 Ga0495605_0234682_43_501 148
8 3300046529 Ga0495652_0066872 Ga0495652_0066872_528_983 148
9 3300046543 Ga0495645_0972995 Ga0495645_0972995_17_472 148
10 iso_pu_bacteria 2511231015 2511323289 148
11 iso_pu_bacteria 2511231019 2511344299 148
12 iso_pu_bacteria 2511231021 2511357478 148
13 iso_pu_bacteria 2599185307 2599970848 148
14 iso_pu_bacteria 2643221565 2643841746 148
15 iso_pu_bacteria 2643221589 2643953075 148
16 iso_pu_bacteria 2643221602 2644025074 148
17 iso_pu_bacteria 2773857673 2774137602 148
18 iso_pu_bacteria 2808606445 2809216381 148
19 iso_pu_bacteria 2880230671 2880232318 148
20 iso_pu_bacteria 2904518522 2904521791 148
21 iso_pu_bacteria 2919385768 2919386411 148
22 iso_pu_bacteria 2919487758 2919491306 148
23 iso_pu_bacteria 2939636861 2939640433 148
24 iso_pu_bacteria 3007614139 3007616406 148
25 iso_pu_bacteria 3007855910 3007856217 148
26 iso_pu_bacteria 8029995093 8029999130 148
27 iso_pu_bacteria 8056125926 8056129881 148
28 iso_pu_bacteria 8056177738 8056181152 148
29 iso_pu_bacteria 8056569372 8056573218 148
30 iso_pu_bacteria 8057798959 8057805014 148
31 3300041413 Ga0439465_0086848 Ga0439465_0086848_580_1032 149
32 3300042009 Ga0439451_105410 Ga0439451_105410_13_465 149
33 3300009036 Ga0105244_10075767 Ga0105244_100757672 150
34 3300009092 Ga0105250_10000609 Ga0105250_100006098 150
35 3300025711 Ga0207696_1000161 Ga0207696_100016174 150
36 3300025728 Ga0207655_1024895 Ga0207655_10248952 150
37 3300025728 Ga0207655_1072903 Ga0207655_10729032 150
38 3300047321 Ga0495676_0341950 Ga0495676_0341950_474_929 150
39 3300053133 Ga0500655_068598 Ga0500655_068598_256_711 150
40 3300003781 Ga0055536_1012069 Ga0055536_10120693 151
41 3300005288 Ga0065714_10012121 Ga0065714_100121212 151
42 3300005288 Ga0065714_10116090 Ga0065714_101160902 151
43 3300005289 Ga0065704_10074069 Ga0065704_100740695 151
44 3300005563 Ga0068855_101920205 Ga0068855_1019202052 151
45 3300006058 Ga0075432_10034252 Ga0075432_100342522 151
46 3300006058 Ga0075432_10070739 Ga0075432_100707392 151
47 3300006058 Ga0075432_10206526 Ga0075432_102065261 151
48 3300006177 Ga0075362_10173219 Ga0075362_101732192 151
49 3300006914 Ga0075436_100667931 Ga0075436_1006679311 151
50 3300006946 Ga0079104_1037500 Ga0079104_10375002 151
51 3300009011 Ga0105251_10060392 Ga0105251_100603922 151
52 3300009011 Ga0105251_10093432 Ga0105251_100934322 151
53 3300009011 Ga0105251_10293222 Ga0105251_102932222 151
54 3300009011 Ga0105251_10604715 Ga0105251_106047151 151
55 3300009036 Ga0105244_10044470 Ga0105244_100444703 151
56 3300009036 Ga0105244_10139555 Ga0105244_101395552 151
57 3300009036 Ga0105244_10183430 Ga0105244_101834302 151
58 3300009092 Ga0105250_10002234 Ga0105250_1000223410 151
59 3300009092 Ga0105250_10087216 Ga0105250_100872162 151
60 3300009092 Ga0105250_10117616 Ga0105250_101176162 151
61 3300009092 Ga0105250_10187465 Ga0105250_101874652 151
62 3300011119 Ga0105246_10235394 Ga0105246_102353942 151
63 3300012498 Ga0157345_1039508 Ga0157345_10395081 151
64 3300013100 Ga0157373_10100167 Ga0157373_101001672 151
65 3300013100 Ga0157373_10149303 Ga0157373_101493032 151
66 3300013100 Ga0157373_10363589 Ga0157373_103635892 151
67 3300013100 Ga0157373_10582484 Ga0157373_105824841 151
68 3300013102 Ga0157371_10350120 Ga0157371_103501201 151
69 3300013104 Ga0157370_10260149 Ga0157370_102601492 151
70 3300013104 Ga0157370_11353929 Ga0157370_113539291 151
71 3300013105 Ga0157369_10213846 Ga0157369_102138462 151
72 3300013105 Ga0157369_10311416 Ga0157369_103114162 151
73 3300013105 Ga0157369_10912086 Ga0157369_109120862 151
74 3300013306 Ga0163162_10634381 Ga0163162_106343812 151
75 3300013306 Ga0163162_10745834 Ga0163162_107458342 151
76 3300013306 Ga0163162_12224981 Ga0163162_122249811 151
77 3300013307 Ga0157372_10327859 Ga0157372_103278592 151
78 3300013308 Ga0157375_10445892 Ga0157375_104458922 151
79 3300014497 Ga0182008_10566105 Ga0182008_105661051 151
80 3300015261 Ga0182006_1058742 Ga0182006_10587422 151
81 3300015262 Ga0182007_10414324 Ga0182007_104143241 151
82 3300015265 Ga0182005_1028468 Ga0182005_10284682 151
83 3300017792 Ga0163161_10229193 Ga0163161_102291932 151
84 3300017792 Ga0163161_10296943 Ga0163161_102969432 151
85 3300017792 Ga0163161_10325423 Ga0163161_103254232 151
86 3300017792 Ga0163161_10399411 Ga0163161_103994112 151
87 3300017792 Ga0163161_10474746 Ga0163161_104747462 151
88 3300017792 Ga0163161_10984385 Ga0163161_109843851 151
89 3300025230 Ga0209563_100854 Ga0209563_1008547 151
90 3300025292 Ga0209676_1001519 Ga0209676_100151919 151
91 3300025711 Ga0207696_1000019 Ga0207696_1000019393 151
92 3300025711 Ga0207696_1000101 Ga0207696_100010116 151
93 3300025711 Ga0207696_1007872 Ga0207696_10078725 151
94 3300025711 Ga0207696_1019612 Ga0207696_10196121 151
95 3300025711 Ga0207696_1050310 Ga0207696_10503101 151
96 3300025711 Ga0207696_1064215 Ga0207696_10642151 151
97 3300025728 Ga0207655_1000532 Ga0207655_100053232 151
98 3300025728 Ga0207655_1005276 Ga0207655_10052768 151
99 3300025728 Ga0207655_1020736 Ga0207655_10207364 151
100 3300025728 Ga0207655_1030576 Ga0207655_10305763 151
101 3300025728 Ga0207655_1038260 Ga0207655_10382602 151
102 3300025728 Ga0207655_1042126 Ga0207655_10421262 151
103 3300025728 Ga0207655_1100932 Ga0207655_11009322 151
104 3300025728 Ga0207655_1103637 Ga0207655_11036371 151
105 3300025728 Ga0207655_1104916 Ga0207655_11049162 151
106 3300025735 Ga0207713_1002825 Ga0207713_10028253 151
107 3300025735 Ga0207713_1011953 Ga0207713_10119533 151
108 3300025735 Ga0207713_1014798 Ga0207713_10147982 151
109 3300025735 Ga0207713_1015263 Ga0207713_10152633 151
110 3300025735 Ga0207713_1024941 Ga0207713_10249413 151
111 3300025735 Ga0207713_1082827 Ga0207713_10828272 151
112 3300025735 Ga0207713_1099700 Ga0207713_10997002 151
113 3300025935 Ga0207709_10373877 Ga0207709_103738772 151
114 3300025949 Ga0207667_12022952 Ga0207667_120229521 151
115 3300027111 Ga0209281_1006015 Ga0209281_10060152 151
116 3300027907 Ga0207428_10269287 Ga0207428_102692872 151
117 3300027907 Ga0207428_10670214 Ga0207428_106702141 151
118 3300030734 Ga0316179_1078751 Ga0316179_10787514 151
119 3300031548 Ga0307408_100218294 Ga0307408_1002182942 151
120 3300031548 Ga0307408_100594541 Ga0307408_1005945411 151
121 3300031730 Ga0307516_10617082 Ga0307516_106170822 151
122 3300031731 Ga0307405_10217555 Ga0307405_102175552 151
123 3300031903 Ga0307407_10123473 Ga0307407_101234732 151
124 3300031911 Ga0307412_10238690 Ga0307412_102386902 151
125 3300032004 Ga0307414_10078474 Ga0307414_100784741 151
126 3300032004 Ga0307414_10098657 Ga0307414_100986572 151
127 3300041405 Ga0439438_004564 Ga0439438_004564_4434_4892 151
128 3300041405 Ga0439438_029792 Ga0439438_029792_682_1140 151
129 3300041405 Ga0439438_054217 Ga0439438_054217_178_720 151
130 3300041407 Ga0439447_002850 Ga0439447_002850_4995_5453 151
131 3300041407 Ga0439447_005181 Ga0439447_005181_2789_3247 151
132 3300041407 Ga0439447_006316 Ga0439447_006316_3132_3590 151
133 3300041407 Ga0439447_022184 Ga0439447_022184_672_1130 151
134 3300041407 Ga0439447_036601 Ga0439447_036601_501_959 151
135 3300041407 Ga0439447_042775 Ga0439447_042775_312_854 151
136 3300041407 Ga0439447_059332 Ga0439447_059332_372_830 151
137 3300041410 Ga0439461_0145183 Ga0439461_0145183_29_487 151
138 3300041411 Ga0439466_0000878 Ga0439466_0000878_10000_10458 151
139 3300041411 Ga0439466_0011728 Ga0439466_0011728_2461_2934 151
140 3300041411 Ga0439466_0036185 Ga0439466_0036185_213_671 151
141 3300041411 Ga0439466_0041039 Ga0439466_0041039_338_796 151
142 3300041411 Ga0439466_0045979 Ga0439466_0045979_661_1119 151
143 3300041411 Ga0439466_0059315 Ga0439466_0059315_443_901 151
144 3300041411 Ga0439466_0088706 Ga0439466_0088706_499_957 151
145 3300041411 Ga0439466_0161457 Ga0439466_0161457_110_568 151
146 3300041413 Ga0439465_0193044 Ga0439465_0193044_185_643 151
147 3300042006 Ga0439432_009089 Ga0439432_009089_1082_1540 151
148 3300042006 Ga0439432_009917 Ga0439432_009917_882_1340 151
149 3300042006 Ga0439432_111728 Ga0439432_111728_343_801 151
150 3300042009 Ga0439451_012763 Ga0439451_012763_569_1027 151
151 3300042009 Ga0439451_013033 Ga0439451_013033_401_859 151
152 3300042009 Ga0439451_026057 Ga0439451_026057_113_571 151
153 3300042010 Ga0439452_018703 Ga0439452_018703_405_863 151
154 3300042010 Ga0439452_039268 Ga0439452_039268_640_1098 151
155 3300042013 Ga0439456_008326 Ga0439456_008326_977_1435 151
156 3300042013 Ga0439456_029401 Ga0439456_029401_125_583 151
157 3300042013 Ga0439456_029726 Ga0439456_029726_321_779 151
158 3300042013 Ga0439456_032134 Ga0439456_032134_37_495 151
159 3300042013 Ga0439456_050356 Ga0439456_050356_166_624 151
160 3300042016 Ga0439463_026172 Ga0439463_026172_638_1180 151
161 3300042115 Ga0450911_000708 Ga0450911_000708_8435_8893 151
162 3300042115 Ga0450911_008556 Ga0450911_008556_350_808 151
163 3300042115 Ga0450911_013783 Ga0450911_013783_109_567 151
164 3300042121 Ga0450919_013726 Ga0450919_013726_308_766 151
165 3300042121 Ga0450919_041975 Ga0450919_041975_26_484 151
166 3300042122 Ga0450920_004135 Ga0450920_004135_963_1421 151
167 3300042123 Ga0450921_015587 Ga0450921_015587_179_637 151
168 3300042136 Ga0450900_006659 Ga0450900_006659_472_930 151
169 3300042137 Ga0450902_013532 Ga0450902_013532_261_719 151
170 3300042137 Ga0450902_048657 Ga0450902_048657_44_502 151
171 3300042138 Ga0450903_003059 Ga0450903_003059_1826_2284 151
172 3300042138 Ga0450903_015679 Ga0450903_015679_395_853 151
173 3300042139 Ga0450904_001831 Ga0450904_001831_761_1219 151
174 3300042142 Ga0450905_003867 Ga0450905_003867_281_739 151
175 3300042145 Ga0450906_012214 Ga0450906_012214_797_1255 151
176 3300042145 Ga0450906_014081 Ga0450906_014081_734_1192 151
177 3300042145 Ga0450906_024721 Ga0450906_024721_320_778 151
178 3300042146 Ga0450907_001074 Ga0450907_001074_3298_3756 151
179 3300042146 Ga0450907_002040 Ga0450907_002040_3529_3987 151
180 3300042146 Ga0450907_003459 Ga0450907_003459_2260_2718 151
181 3300042156 Ga0439446_0004080 Ga0439446_0004080_943_1401 151
182 3300042156 Ga0439446_0082903 Ga0439446_0082903_368_826 151
183 3300042184 Ga0450908_010560 Ga0450908_010560_369_827 151
184 3300042184 Ga0450908_014164 Ga0450908_014164_670_1128 151
185 3300042184 Ga0450908_038376 Ga0450908_038376_25_483 151
186 3300042185 Ga0450909_004722 Ga0450909_004722_666_1124 151
187 3300042185 Ga0450909_022064 Ga0450909_022064_135_593 151
188 3300042435 Ga0439434_0005608 Ga0439434_0005608_845_1303 151
189 3300042435 Ga0439434_0034125 Ga0439434_0034125_1078_1536 151
190 3300042439 Ga0439464_0042132 Ga0439464_0042132_584_1042 151
191 3300042461 Ga0439460_0015264 Ga0439460_0015264_309_767 151
192 3300042461 Ga0439460_0027736 Ga0439460_0027736_396_854 151
193 3300042531 Ga0450918_041712 Ga0450918_041712_59_517 151
194 3300042532 Ga0450893_0024632 Ga0450893_0024632_391_864 151
195 3300042993 Ga0439440_0010907 Ga0439440_0010907_1109_1567 151
196 3300042993 Ga0439440_0016567 Ga0439440_0016567_934_1392 151
197 3300042993 Ga0439440_0027597 Ga0439440_0027597_333_791 151
198 3300046452 Ga0495617_019739 Ga0495617_019739_1797_2255 151
199 3300046452 Ga0495617_064451 Ga0495617_064451_497_955 151
200 3300046452 Ga0495617_067346 Ga0495617_067346_666_1124 151
201 3300046452 Ga0495617_081965 Ga0495617_081965_165_623 151
202 3300046452 Ga0495617_116942 Ga0495617_116942_320_778 151
203 3300046453 Ga0495627_014542 Ga0495627_014542_1790_2248 151
204 3300046453 Ga0495627_054770 Ga0495627_054770_222_680 151
205 3300046453 Ga0495627_102268 Ga0495627_102268_273_731 151
206 3300046454 Ga0495592_0079453 Ga0495592_0079453_1599_2057 151
207 3300046455 Ga0495603_0417993 Ga0495603_0417993_215_673 151
208 3300046457 Ga0495590_0009528 Ga0495590_0009528_712_1170 151
209 3300046457 Ga0495590_0033553 Ga0495590_0033553_747_1205 151
210 3300046457 Ga0495590_0075291 Ga0495590_0075291_403_861 151
211 3300046457 Ga0495590_0116662 Ga0495590_0116662_280_738 151
212 3300046458 Ga0495591_002999 Ga0495591_002999_753_1211 151
213 3300046458 Ga0495591_004328 Ga0495591_004328_2140_2598 151
214 3300046458 Ga0495591_051759 Ga0495591_051759_149_607 151
215 3300046458 Ga0495591_055349 Ga0495591_055349_365_823 151
216 3300046458 Ga0495591_061893 Ga0495591_061893_38_496 151
217 3300046460 Ga0495638_0035616 Ga0495638_0035616_2042_2500 151
218 3300046460 Ga0495638_0127658 Ga0495638_0127658_671_1129 151
219 3300046460 Ga0495638_0129556 Ga0495638_0129556_485_943 151
220 3300046460 Ga0495638_0140175 Ga0495638_0140175_406_864 151
221 3300046460 Ga0495638_0314070 Ga0495638_0314070_60_518 151
222 3300046460 Ga0495638_0423235 Ga0495638_0423235_208_666 151
223 3300046463 Ga0495653_0057113 Ga0495653_0057113_357_815 151
224 3300046463 Ga0495653_0290072 Ga0495653_0290072_424_882 151
225 3300046463 Ga0495653_0308634 Ga0495653_0308634_199_657 151
226 3300046471 Ga0495650_0010955 Ga0495650_0010955_716_1174 151
227 3300046474 Ga0495605_0011610 Ga0495605_0011610_1867_2325 151
228 3300046474 Ga0495605_0017163 Ga0495605_0017163_727_1185 151
229 3300046474 Ga0495605_0055145 Ga0495605_0055145_725_1183 151
230 3300046474 Ga0495605_0163535 Ga0495605_0163535_488_946 151
231 3300046474 Ga0495605_0182061 Ga0495605_0182061_341_799 151
232 3300046474 Ga0495605_0205492 Ga0495605_0205492_266_724 151
233 3300046491 Ga0495584_0015983 Ga0495584_0015983_2436_2894 151
234 3300046491 Ga0495584_0054640 Ga0495584_0054640_1443_1901 151
235 3300046491 Ga0495584_0078744 Ga0495584_0078744_562_1020 151
236 3300046491 Ga0495584_0112801 Ga0495584_0112801_328_786 151
237 3300046492 Ga0495585_0013265 Ga0495585_0013265_1777_2250 151
238 3300046492 Ga0495585_0085042 Ga0495585_0085042_592_1050 151
239 3300046492 Ga0495585_0106997 Ga0495585_0106997_501_959 151
240 3300046492 Ga0495585_0133061 Ga0495585_0133061_307_765 151
241 3300046492 Ga0495585_0144606 Ga0495585_0144606_414_986 151
242 3300046492 Ga0495585_0148135 Ga0495585_0148135_437_895 151
243 3300046492 Ga0495585_0183917 Ga0495585_0183917_83_541 151
244 3300046492 Ga0495585_0343338 Ga0495585_0343338_21_479 151
245 3300046500 Ga0495596_0006850 Ga0495596_0006850_3969_4427 151
246 3300046501 Ga0495607_0026676 Ga0495607_0026676_896_1354 151
247 3300046501 Ga0495607_0049853 Ga0495607_0049853_534_992 151
248 3300046501 Ga0495607_0078627 Ga0495607_0078627_638_1096 151
249 3300046501 Ga0495607_0081006 Ga0495607_0081006_996_1454 151
250 3300046501 Ga0495607_0091484 Ga0495607_0091484_585_1043 151
251 3300046501 Ga0495607_0109926 Ga0495607_0109926_577_1035 151
252 3300046501 Ga0495607_0129497 Ga0495607_0129497_36_509 151
253 3300046501 Ga0495607_0144406 Ga0495607_0144406_736_1194 151
254 3300046501 Ga0495607_0421968 Ga0495607_0421968_68_526 151
255 3300046506 Ga0495583_0071078 Ga0495583_0071078_345_803 151
256 3300046507 Ga0495606_0049365 Ga0495606_0049365_1895_2368 151
257 3300046507 Ga0495606_0069783 Ga0495606_0069783_1181_1639 151
258 3300046507 Ga0495606_0108613 Ga0495606_0108613_679_1137 151
259 3300046507 Ga0495606_0127976 Ga0495606_0127976_681_1139 151
260 3300046512 Ga0495610_0059090 Ga0495610_0059090_675_1133 151
261 3300046512 Ga0495610_0079142 Ga0495610_0079142_412_885 151
262 3300046512 Ga0495610_0082119 Ga0495610_0082119_506_964 151
263 3300046512 Ga0495610_0087969 Ga0495610_0087969_573_1031 151
264 3300046512 Ga0495610_0088983 Ga0495610_0088983_432_890 151
265 3300046512 Ga0495610_0100984 Ga0495610_0100984_674_1132 151
266 3300046512 Ga0495610_0107971 Ga0495610_0107971_289_747 151
267 3300046512 Ga0495610_0153105 Ga0495610_0153105_189_647 151
268 3300046513 Ga0495616_0026170 Ga0495616_0026170_1951_2409 151
269 3300046513 Ga0495616_0085074 Ga0495616_0085074_940_1398 151
270 3300046513 Ga0495616_0095976 Ga0495616_0095976_391_849 151
271 3300046513 Ga0495616_0136670 Ga0495616_0136670_88_546 151
272 3300046513 Ga0495616_0168051 Ga0495616_0168051_130_588 151
273 3300046515 Ga0495620_0014528 Ga0495620_0014528_2739_3197 151
274 3300046515 Ga0495620_0052703 Ga0495620_0052703_581_1039 151
275 3300046515 Ga0495620_0056351 Ga0495620_0056351_612_1070 151
276 3300046515 Ga0495620_0096581 Ga0495620_0096581_475_933 151
277 3300046515 Ga0495620_0104092 Ga0495620_0104092_361_819 151
278 3300046515 Ga0495620_0107998 Ga0495620_0107998_430_888 151
279 3300046516 Ga0495628_0706503 Ga0495628_0706503_199_684 151
280 3300046518 Ga0495631_0001379 Ga0495631_0001379_4248_4706 151
281 3300046518 Ga0495631_0090121 Ga0495631_0090121_530_988 151
282 3300046518 Ga0495631_0094423 Ga0495631_0094423_100_558 151
283 3300046519 Ga0495632_0009300 Ga0495632_0009300_4854_5312 151
284 3300046519 Ga0495632_0033620 Ga0495632_0033620_389_847 151
285 3300046519 Ga0495632_0089235 Ga0495632_0089235_576_1034 151
286 3300046519 Ga0495632_0103634 Ga0495632_0103634_72_530 151
287 3300046519 Ga0495632_0157998 Ga0495632_0157998_285_743 151
288 3300046519 Ga0495632_0199257 Ga0495632_0199257_190_648 151
289 3300046519 Ga0495632_0431262 Ga0495632_0431262_34_492 151
290 3300046520 Ga0495637_0010319 Ga0495637_0010319_3209_3667 151
291 3300046520 Ga0495637_0012773 Ga0495637_0012773_783_1241 151
292 3300046520 Ga0495637_0039263 Ga0495637_0039263_500_958 151
293 3300046520 Ga0495637_0067134 Ga0495637_0067134_337_795 151
294 3300046520 Ga0495637_0068424 Ga0495637_0068424_456_914 151
295 3300046520 Ga0495637_0071769 Ga0495637_0071769_302_760 151
296 3300046520 Ga0495637_0120761 Ga0495637_0120761_155_613 151
297 3300046520 Ga0495637_0124822 Ga0495637_0124822_431_889 151
298 3300046520 Ga0495637_0277515 Ga0495637_0277515_117_575 151
299 3300046522 Ga0495643_0068733 Ga0495643_0068733_911_1369 151
300 3300046522 Ga0495643_0123914 Ga0495643_0123914_577_1035 151
301 3300046522 Ga0495643_0144845 Ga0495643_0144845_253_711 151
302 3300046522 Ga0495643_0146703 Ga0495643_0146703_457_915 151
303 3300046522 Ga0495643_0213500 Ga0495643_0213500_303_761 151
304 3300046522 Ga0495643_0220311 Ga0495643_0220311_342_800 151
305 3300046522 Ga0495643_0258980 Ga0495643_0258980_109_567 151
306 3300046523 Ga0495644_0031647 Ga0495644_0031647_841_1299 151
307 3300046524 Ga0495648_0011366 Ga0495648_0011366_5121_5579 151
308 3300046524 Ga0495648_0040024 Ga0495648_0040024_763_1221 151
309 3300046524 Ga0495648_0090022 Ga0495648_0090022_441_899 151
310 3300046524 Ga0495648_0121074 Ga0495648_0121074_296_754 151
311 3300046524 Ga0495648_0198717 Ga0495648_0198717_45_503 151
312 3300046524 Ga0495648_0325099 Ga0495648_0325099_207_665 151
313 3300046526 Ga0495666_0058872 Ga0495666_0058872_1055_1513 151
314 3300046526 Ga0495666_0082249 Ga0495666_0082249_335_820 151
315 3300046526 Ga0495666_0102383 Ga0495666_0102383_380_838 151
316 3300046526 Ga0495666_0136066 Ga0495666_0136066_302_787 151
317 3300046528 Ga0495642_0008536 Ga0495642_0008536_709_1167 151
318 3300046530 Ga0495654_0023933 Ga0495654_0023933_763_1221 151
319 3300046530 Ga0495654_0032535 Ga0495654_0032535_754_1212 151
320 3300046530 Ga0495654_0034346 Ga0495654_0034346_23_481 151
321 3300046530 Ga0495654_0062590 Ga0495654_0062590_808_1266 151
322 3300046530 Ga0495654_0074391 Ga0495654_0074391_396_869 151
323 3300046530 Ga0495654_0082341 Ga0495654_0082341_466_924 151
324 3300046530 Ga0495654_0101467 Ga0495654_0101467_341_799 151
325 3300046530 Ga0495654_0113436 Ga0495654_0113436_661_1134 151
326 3300046530 Ga0495654_0149654 Ga0495654_0149654_276_734 151
327 3300046530 Ga0495654_0208046 Ga0495654_0208046_31_489 151
328 3300046530 Ga0495654_0299914 Ga0495654_0299914_120_578 151
329 3300046536 Ga0495587_0057256 Ga0495587_0057256_1710_2168 151
330 3300046538 Ga0495609_0014758 Ga0495609_0014758_703_1161 151
331 3300046538 Ga0495609_0089792 Ga0495609_0089792_351_809 151
332 3300046538 Ga0495609_0303029 Ga0495609_0303029_36_494 151
333 3300046542 Ga0495597_0033963 Ga0495597_0033963_372_830 151
334 3300046542 Ga0495597_0036314 Ga0495597_0036314_1504_1959 151
335 3300046542 Ga0495597_0045887 Ga0495597_0045887_1025_1483 151
336 3300046542 Ga0495597_0075174 Ga0495597_0075174_661_1119 151
337 3300046542 Ga0495597_0092947 Ga0495597_0092947_414_872 151
338 3300046542 Ga0495597_0132202 Ga0495597_0132202_64_522 151
339 3300046543 Ga0495645_0075857 Ga0495645_0075857_1632_2090 151
340 3300046557 Ga0495622_0132974 Ga0495622_0132974_185_643 151
341 3300046558 Ga0495633_0074901 Ga0495633_0074901_663_1121 151
342 3300046616 Ga0495668_0005069 Ga0495668_0005069_328_786 151
343 3300046616 Ga0495668_0038947 Ga0495668_0038947_1860_2333 151
344 3300046642 Ga0495634_0047668 Ga0495634_0047668_279_737 151
345 3300046648 Ga0495611_0495152 Ga0495611_0495152_42_500 151
346 3300046660 Ga0495625_0027685 Ga0495625_0027685_1060_1518 151
347 3300046660 Ga0495625_0049909 Ga0495625_0049909_1848_2306 151
348 3300046660 Ga0495625_0067122 Ga0495625_0067122_2020_2478 151
349 3300046660 Ga0495625_0176348 Ga0495625_0176348_634_1092 151
350 3300046660 Ga0495625_0253930 Ga0495625_0253930_294_752 151
351 3300046660 Ga0495625_0288991 Ga0495625_0288991_467_925 151
352 3300046660 Ga0495625_0319205 Ga0495625_0319205_344_802 151
353 3300046665 Ga0495661_0004285 Ga0495661_0004285_9244_9702 151
354 3300046665 Ga0495661_0160874 Ga0495661_0160874_587_1045 151
355 3300046665 Ga0495661_0274929 Ga0495661_0274929_191_649 151
356 3300046674 Ga0495588_0115358 Ga0495588_0115358_431_889 151
357 3300046679 Ga0495623_0141937 Ga0495623_0141937_343_828 151
358 3300046684 Ga0495669_0094876 Ga0495669_0094876_500_958 151
359 3300046689 Ga0495613_0072718 Ga0495613_0072718_1724_2182 151
360 3300046690 Ga0495624_0041511 Ga0495624_0041511_326_784 151
361 3300046691 Ga0495670_0025293 Ga0495670_0025293_640_1098 151
362 3300046691 Ga0495670_0095444 Ga0495670_0095444_614_1072 151
363 3300046691 Ga0495670_0182521 Ga0495670_0182521_515_973 151
364 3300046691 Ga0495670_0331677 Ga0495670_0331677_293_751 151
365 3300046691 Ga0495670_0468356 Ga0495670_0468356_24_482 151
366 3300046691 Ga0495670_0697807 Ga0495670_0697807_72_530 151
367 3300046692 Ga0495671_0007405 Ga0495671_0007405_5693_6151 151
368 3300046692 Ga0495671_0071490 Ga0495671_0071490_662_1120 151
369 3300046692 Ga0495671_0090162 Ga0495671_0090162_765_1223 151
370 3300046692 Ga0495671_0107457 Ga0495671_0107457_533_991 151
371 3300046692 Ga0495671_0146659 Ga0495671_0146659_356_814 151
372 3300046692 Ga0495671_0269180 Ga0495671_0269180_83_541 151
373 3300046692 Ga0495671_0289544 Ga0495671_0289544_186_644 151
374 3300046694 Ga0495649_0096034 Ga0495649_0096034_497_955 151
375 3300046694 Ga0495649_0116317 Ga0495649_0116317_849_1307 151
376 3300046694 Ga0495649_0168138 Ga0495649_0168138_320_793 151
377 3300046694 Ga0495649_0302183 Ga0495649_0302183_155_640 151
378 3300046794 Ga0495589_0014607 Ga0495589_0014607_920_1378 151
379 3300046794 Ga0495589_0017326 Ga0495589_0017326_512_970 151
380 3300046794 Ga0495589_0047054 Ga0495589_0047054_1526_1984 151
381 3300046794 Ga0495589_0101698 Ga0495589_0101698_510_968 151
382 3300046794 Ga0495589_0111629 Ga0495589_0111629_618_1076 151
383 3300046794 Ga0495589_0180719 Ga0495589_0180719_157_615 151
384 3300046809 Ga0495600_0052079 Ga0495600_0052079_325_783 151
385 3300046809 Ga0495600_0400067 Ga0495600_0400067_77_562 151
386 3300046810 Ga0495660_0000616 Ga0495660_0000616_26511_26969 151
387 3300046810 Ga0495660_0041437 Ga0495660_0041437_459_917 151
388 3300046810 Ga0495660_0081564 Ga0495660_0081564_716_1174 151
389 3300046810 Ga0495660_0085932 Ga0495660_0085932_286_744 151
390 3300046810 Ga0495660_0090739 Ga0495660_0090739_677_1135 151
391 3300046810 Ga0495660_0101809 Ga0495660_0101809_818_1276 151
392 3300046810 Ga0495660_0106333 Ga0495660_0106333_184_642 151
393 3300046810 Ga0495660_0195940 Ga0495660_0195940_301_759 151
394 3300046810 Ga0495660_0205041 Ga0495660_0205041_66_524 151
395 3300046810 Ga0495660_0245474 Ga0495660_0245474_220_678 151
396 3300046810 Ga0495660_0265012 Ga0495660_0265012_179_637 151
397 3300047317 Ga0495604_0201281 Ga0495604_0201281_569_1054 151
398 3300047320 Ga0495672_0006681 Ga0495672_0006681_807_1265 151
399 3300047320 Ga0495672_0037891 Ga0495672_0037891_330_788 151
400 3300047320 Ga0495672_0104377 Ga0495672_0104377_339_797 151
401 3300047320 Ga0495672_0113797 Ga0495672_0113797_313_771 151
402 3300047320 Ga0495672_0162356 Ga0495672_0162356_109_567 151
403 3300047320 Ga0495672_0217855 Ga0495672_0217855_455_913 151
404 3300047320 Ga0495672_0322989 Ga0495672_0322989_169_642 151
405 3300047320 Ga0495672_0469859 Ga0495672_0469859_54_512 151
406 3300047321 Ga0495676_0079497 Ga0495676_0079497_1709_2167 151
407 3300047321 Ga0495676_0137658 Ga0495676_0137658_626_1084 151
408 3300047322 Ga0495680_0085258 Ga0495680_0085258_328_786 151
409 3300047322 Ga0495680_0178990 Ga0495680_0178990_526_984 151
410 3300047323 Ga0495683_0003171 Ga0495683_0003171_8232_8690 151
411 3300047323 Ga0495683_0003249 Ga0495683_0003249_8001_8459 151
412 3300047323 Ga0495683_0046939 Ga0495683_0046939_57_515 151
413 3300047323 Ga0495683_0094852 Ga0495683_0094852_680_1138 151
414 3300047323 Ga0495683_0109184 Ga0495683_0109184_410_868 151
415 3300047323 Ga0495683_0137334 Ga0495683_0137334_390_848 151
416 3300047443 Ga0495687_007225 Ga0495687_007225_5546_6004 151
417 3300047444 Ga0495675_0285348 Ga0495675_0285348_252_737 151
418 3300047444 Ga0495675_0522936 Ga0495675_0522936_95_553 151
419 3300047446 Ga0495679_076086 Ga0495679_076086_311_784 151
420 3300047469 Ga0495673_0014503 Ga0495673_0014503_2703_3161 151
421 3300047469 Ga0495673_0016649 Ga0495673_0016649_2677_3135 151
422 3300047469 Ga0495673_0041461 Ga0495673_0041461_681_1139 151
423 3300047469 Ga0495673_0054079 Ga0495673_0054079_693_1151 151
424 3300047469 Ga0495673_0062877 Ga0495673_0062877_570_1028 151
425 3300047469 Ga0495673_0104364 Ga0495673_0104364_402_860 151
426 3300047469 Ga0495673_0185873 Ga0495673_0185873_141_599 151
427 3300047469 Ga0495673_0226281 Ga0495673_0226281_180_638 151
428 3300047470 Ga0495681_0005425 Ga0495681_0005425_7387_7845 151
429 3300047470 Ga0495681_0014387 Ga0495681_0014387_2731_3189 151
430 3300047470 Ga0495681_0014892 Ga0495681_0014892_3435_3893 151
431 3300047470 Ga0495681_0073236 Ga0495681_0073236_649_1107 151
432 3300047470 Ga0495681_0097254 Ga0495681_0097254_109_567 151
433 3300047470 Ga0495681_0100323 Ga0495681_0100323_621_1079 151
434 3300047470 Ga0495681_0251658 Ga0495681_0251658_178_636 151
435 3300047471 Ga0495684_0081438 Ga0495684_0081438_1697_2155 151
436 3300047471 Ga0495684_0291155 Ga0495684_0291155_329_814 151
437 3300047472 Ga0495686_0027444 Ga0495686_0027444_2669_3127 151
438 3300047472 Ga0495686_0070356 Ga0495686_0070356_1383_1841 151
439 3300047472 Ga0495686_0193318 Ga0495686_0193318_65_523 151
440 3300047472 Ga0495686_0247125 Ga0495686_0247125_76_534 151
441 3300047472 Ga0495686_0565663 Ga0495686_0565663_36_494 151
442 3300047673 Ga0495593_0030774 Ga0495593_0030774_2160_2618 151
443 3300047673 Ga0495593_0123552 Ga0495593_0123552_326_811 151
444 3300048088 Ga0495602_0053700 Ga0495602_0053700_2782_3240 151
445 3300048090 Ga0495615_0068382 Ga0495615_0068382_267_725 151
446 3300048091 Ga0495626_0009227 Ga0495626_0009227_163_621 151
447 3300048091 Ga0495626_0009973 Ga0495626_0009973_1940_2398 151
448 3300048091 Ga0495626_0073672 Ga0495626_0073672_954_1412 151
449 3300048091 Ga0495626_0085827 Ga0495626_0085827_572_1030 151
450 3300048091 Ga0495626_0094557 Ga0495626_0094557_752_1225 151
451 3300048091 Ga0495626_0133438 Ga0495626_0133438_388_861 151
452 3300048091 Ga0495626_0136521 Ga0495626_0136521_260_718 151
453 3300048913 Ga0496110_1589601 Ga0496110_1589601_29_484 151
454 3300048917 Ga0496114_0006055 Ga0496114_0006055_731_1186 151
455 3300048919 Ga0496116_0030573 Ga0496116_0030573_2714_3172 151
456 3300048919 Ga0496116_0046424 Ga0496116_0046424_513_971 151
457 3300048920 Ga0496117_0002645 Ga0496117_0002645_4230_4685 151
458 3300048920 Ga0496117_0110583 Ga0496117_0110583_923_1396 151
459 3300048920 Ga0496117_0184223 Ga0496117_0184223_201_695 151
460 3300048921 Ga0496118_0007805 Ga0496118_0007805_2430_2885 151
461 3300048921 Ga0496118_0157453 Ga0496118_0157453_310_783 151
462 3300048921 Ga0496118_0219331 Ga0496118_0219331_410_904 151
463 3300048922 Ga0496119_0234028 Ga0496119_0234028_438_911 151
464 3300048924 Ga0496121_0067339 Ga0496121_0067339_2269_2724 151
465 3300048924 Ga0496121_0179308 Ga0496121_0179308_916_1389 151
466 3300048924 Ga0496121_0326811 Ga0496121_0326811_342_836 151
467 3300048925 Ga0496122_0001163 Ga0496122_0001163_36631_37110 151
468 3300048925 Ga0496122_0002835 Ga0496122_0002835_16893_17348 151
469 3300048925 Ga0496122_0246554 Ga0496122_0246554_318_791 151
470 3300048926 Ga0496123_0000088 Ga0496123_0000088_177554_178009 151
471 3300048926 Ga0496123_0253974 Ga0496123_0253974_157_630 151
472 3300048927 Ga0496124_0005913 Ga0496124_0005913_8906_9361 151
473 3300048927 Ga0496124_0022394 Ga0496124_0022394_4603_5061 151
474 3300048927 Ga0496124_0276562 Ga0496124_0276562_312_785 151
475 3300048927 Ga0496124_0396397 Ga0496124_0396397_366_824 151
476 3300048928 Ga0496125_0028879 Ga0496125_0028879_4275_4730 151
477 3300048928 Ga0496125_0235578 Ga0496125_0235578_133_591 151
478 3300048928 Ga0496125_0321257 Ga0496125_0321257_257_751 151
479 3300048929 Ga0496126_0864321 Ga0496126_0864321_47_505 151
480 3300049459 Ga0495678_003757 Ga0495678_003757_8015_8473 151
481 3300049459 Ga0495678_021616 Ga0495678_021616_1848_2306 151
482 3300049459 Ga0495678_047403 Ga0495678_047403_528_986 151
483 3300049459 Ga0495678_058867 Ga0495678_058867_344_802 151
484 3300049459 Ga0495678_060439 Ga0495678_060439_605_1063 151
485 3300049459 Ga0495678_063966 Ga0495678_063966_823_1281 151
486 3300049459 Ga0495678_069730 Ga0495678_069730_72_530 151
487 3300049459 Ga0495678_083671 Ga0495678_083671_621_1094 151
488 3300049459 Ga0495678_096899 Ga0495678_096899_145_603 151
489 3300049459 Ga0495678_179220 Ga0495678_179220_78_563 151
490 3300049460 Ga0495682_0101716 Ga0495682_0101716_249_707 151
491 3300049571 Ga0501034_0000214 Ga0501034_0000214_36143_36622 151
492 3300049673 Ga0501240_048449 Ga0501240_048449_230_688 151
493 3300049766 Ga0501269_022960 Ga0501269_022960_251_709 151
494 3300050489 nmdc:mga03683_103525_c1 nmdc:mga03683_103525_c1_392_865 151
495 3300050491 nmdc:mga00v17_94050_c1 nmdc:mga00v17_94050_c1_697_1155 151
496 3300050514 nmdc:mga08x19_606270_c1 nmdc:mga08x19_606270_c1_244_702 151
497 3300050514 nmdc:mga08x19_761303_c1 nmdc:mga08x19_761303_c1_212_670 151
498 3300053111 Ga0500572_171046 Ga0500572_171046_109_567 151
499 3300053140 Ga0500573_0094388 Ga0500573_0094388_929_1387 151
500 3300053145 Ga0500586_011494 Ga0500586_011494_478_936 151
501 3300053145 Ga0500586_075054 Ga0500586_075054_124_582 151
502 3300053722 Ga0500649_178987 Ga0500649_178987_68_526 151
503 iso_pu_bacteria 3007619802 3007622336 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01797

Y1_Tnp

Transposase IS200 like

22

131

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xma-assembly1.cif.gz_B deinococcus radiodurans isdra2 transposase right end dna complex 0.7934 19 127
2xqc-assembly1.cif.gz_A deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn 0.7909 19 130
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.7828 13 144
2xo6-assembly1.cif.gz_D deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site 0.778 15 127
2a6m-assembly2.cif.gz_A-2 crystal structure of the ishp608 transposase 0.7533 19 130
ID Description Score Start End Superfamily
2xm3E00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8142 19 127 3.30.70.1290
2ec2F00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.79 19 127 3.30.70.1290
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7828 13 144 3.30.70.1290
2a6mB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7794 19 127 3.30.70.1290
2vjvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7465 18 127 3.30.70.1290
ID Description Score Start End GO Terms
AF-A0A089YT84-F1-model_v4 Transposase 0.9732 10 143 GO:0004803
GO:0006313
GO:0043565
AF-A0A1G0CVZ3-F1-model_v4 Transposase IS200-like domain-containing protein 0.9721 10 143 GO:0004803
GO:0006313
GO:0043565
AF-A0A524GPI4-F1-model_v4 Transposase IS200-like domain-containing protein 0.9518 22 145 GO:0004803
GO:0006313
GO:0043565
AF-A0A1H0E8C5-F1-model_v4 deleted 0.9484 1 144
AF-Q485N4-F1-model_v4 Transposase IS200-like domain-containing protein 0.9478 6 143 GO:0004803
GO:0006313
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.75 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map