F455964

General Info

Members Datasets Scaffolds Average Seq Length
503 229 1006 330

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100093000|Ga0070671_1000930003
Length 379
Sequence LCDAFGDKTMPERLHFLLGRLAAADSFAGRPRDFAESPKDPMDAFSEILSGVKLSGAVFFTAEFSAPWGLTTPASSLMAAKFAPEAEHIVLYHLVIEGGAVIEMTDGQRTELKAGDIVVFPHGDSHHMSSGNGATRPFPNYGIAAKIQSRDLSPLHAGGGGEIARFVCGYMTCDPYLSRPILSGLPPVFKVNIRTDRSGHWLENSILHLVEEAASGRVGSEAMLAKLSEALFVDTLRRYVAGLPEHQMGWLTGARDPVVGKSLGLLHSRIAHPWTIADLADEVGISRSALVDRFTRYLSEPPMAYLTRWRLQLAARSLESTSRGVAEIAAAVGYESEAAFNRAFKREFGQPPGRYRSDHKSAPIKKTMGQVDAKAAPER

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 2.58
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 16.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100093000 3300005355 Unclassified 2527
2 Ga0070658_10016488 3300005327 Bacteria 5913
3 Ga0070690_100068681 3300005330 Bacteria 2299
4 Ga0068869_100001964 3300005334 Bacteria 12326
5 Ga0070666_10000945 3300005335 Bacteria 17686
6 Ga0068868_100023791 3300005338 Unclassified 4639
7 Ga0070660_100056871 3300005339 Bacteria 3028
8 Ga0070689_100096754 3300005340 Bacteria 2334
9 Ga0070668_100348903 3300005347 Unclassified 1252
10 Ga0070669_100106872 3300005353 Bacteria 2119
11 Ga0070669_100271887 3300005353 Bacteria 1355
12 Ga0070675_100153101 3300005354 Bacteria 1978
13 Ga0070671_100004108 3300005355 Bacteria 11496
14 Ga0070671_100180430 3300005355 Bacteria 1787
15 Ga0070674_100065647 3300005356 Bacteria 2548
16 Ga0070674_100223154 3300005356 Bacteria 1467
17 Ga0070688_100233491 3300005365 Bacteria 1302
18 Ga0070659_100028922 3300005366 Bacteria 4281
19 Ga0070659_100079162 3300005366 Bacteria 2623
20 Ga0070667_100143074 3300005367 Bacteria 2096
21 Ga0070709_10083231 3300005434 Unclassified 2092
22 Ga0070714_100000417 3300005435 Bacteria 31156
23 Ga0070713_100036273 3300005436 Bacteria 3978
24 Ga0070711_100045831 3300005439 Bacteria 2977
25 Ga0070711_100109798 3300005439 Bacteria 2023
26 Ga0070678_100045599 3300005456 Bacteria 3138
27 Ga0070662_100113790 3300005457 Bacteria 2065
28 Ga0070681_10031695 3300005458 Bacteria 5307
29 Ga0070681_10093826 3300005458 Bacteria 2950
30 Ga0070681_10175386 3300005458 Unclassified 2065
31 Ga0070699_100050708 3300005518 Bacteria 3594
32 Ga0070679_100111535 3300005530 Bacteria 2722
33 Ga0070679_100213010 3300005530 Unclassified 1895
34 Ga0070679_100304869 3300005530 Bacteria 1543
35 Ga0070684_100011965 3300005535 Bacteria 6931
36 Ga0070684_100147435 3300005535 Bacteria 2130
37 Ga0070684_100370012 3300005535 Bacteria 1319
38 Ga0070684_100387685 3300005535 Bacteria 1287
39 Ga0068853_100014521 3300005539 Bacteria 6454
40 Ga0068853_100080716 3300005539 Bacteria 2847
41 Ga0068853_100089155 3300005539 Bacteria 2709
42 Ga0068855_100052455 3300005563 Bacteria 4802
43 Ga0068855_100077322 3300005563 Bacteria 3861
44 Ga0068855_100091802 3300005563 Bacteria 3502
45 Ga0068855_100102673 3300005563 Bacteria 3291
46 Ga0070664_100044672 3300005564 Bacteria 3740
47 Ga0068857_100004111 3300005577 Bacteria 12267
48 Ga0068857_100008108 3300005577 Bacteria 9067
49 Ga0068857_100105095 3300005577 Bacteria 2535
50 Ga0068857_100143697 3300005577 Bacteria 2158
51 Ga0068857_100224126 3300005577 Bacteria 1718
52 Ga0068856_100018528 3300005614 Bacteria 6746
53 Ga0068856_100025884 3300005614 Bacteria 5722
54 Ga0068856_100129401 3300005614 Bacteria 2529
55 Ga0068852_100152092 3300005616 Unclassified 2153
56 Ga0068852_100476618 3300005616 Bacteria 1239
57 Ga0068859_100009349 3300005617 Bacteria 9897
58 Ga0068859_100178178 3300005617 Unclassified 2208
59 Ga0068859_100234877 3300005617 Bacteria 1922
60 Ga0068859_100611045 3300005617 Bacteria 1183
61 Ga0068864_100033889 3300005618 Bacteria 4342
62 Ga0068864_100151170 3300005618 Bacteria 2103
63 Ga0068863_100003785 3300005841 Bacteria 14967
64 Ga0068863_100027558 3300005841 Bacteria 5420
65 Ga0068858_100000372 3300005842 Bacteria 46871
66 Ga0068858_100013587 3300005842 Bacteria 7684
67 Ga0068858_100018982 3300005842 Bacteria 6434
68 Ga0068860_100026616 3300005843 Bacteria 5575
69 Ga0068860_100061799 3300005843 Bacteria 3559
70 Ga0068862_100351196 3300005844 Bacteria 1368
71 Ga0081455_10026465 3300005937 Bacteria 5333
72 Ga0070717_10064745 3300006028 Unclassified 3037
73 Ga0070712_100112245 3300006175 Bacteria 2036
74 Ga0097621_100002285 3300006237 Bacteria 13129
75 Ga0097621_100004531 3300006237 Bacteria 9688
76 Ga0097621_100017360 3300006237 Bacteria 5463
77 Ga0097621_100260168 3300006237 Unclassified 1522
78 Ga0068871_100031005 3300006358 Bacteria 4213
79 Ga0068871_100043431 3300006358 Bacteria 3610
80 Ga0068871_100132782 3300006358 Bacteria 2112
81 Ga0068871_100138415 3300006358 Bacteria 2069
82 Ga0068871_100282733 3300006358 Unclassified 1452
83 Ga0075428_100587838 3300006844 Unclassified 1189
84 Ga0075430_100033245 3300006846 Unclassified 4378
85 Ga0075431_100105101 3300006847 Unclassified 2914
86 Ga0075431_100266602 3300006847 Bacteria 1737
87 Ga0075433_10010881 3300006852 Bacteria 7316
88 Ga0075434_100004978 3300006871 Bacteria 12052
89 Ga0075434_100037166 3300006871 Bacteria 4820
90 Ga0068865_100002615 3300006881 Bacteria 10705
91 Ga0068865_100008054 3300006881 Bacteria 6506
92 Ga0097620_100000031 3300006931 Bacteria 174715
93 Ga0097620_100009350 3300006931 Bacteria 9897
94 Ga0097620_100178182 3300006931 Unclassified 2208
95 Ga0097620_100234898 3300006931 Bacteria 1922
96 Ga0097620_100611008 3300006931 Bacteria 1183
97 Ga0075435_100052668 3300007076 Bacteria 3279
98 Ga0075435_100258891 3300007076 Bacteria 1482
99 Ga0105240_10013594 3300009093 Bacteria 11168
100 Ga0105240_10051233 3300009093 Bacteria 5197
101 Ga0105240_10080296 3300009093 Bacteria 4011
102 Ga0105240_10080622 3300009093 Unclassified 4002
103 Ga0105240_10293934 3300009093 Unclassified 1861
104 Ga0105240_10296558 3300009093 Bacteria 1851
105 Ga0105245_10010454 3300009098 Bacteria 8079
106 Ga0105245_10028332 3300009098 Bacteria 4940
107 Ga0105245_10054458 3300009098 Bacteria 3592
108 Ga0114129_10008410 3300009147 Bacteria 14697
109 Ga0114129_10131485 3300009147 Bacteria 3436
110 Ga0105243_10113082 3300009148 Bacteria 2276
111 Ga0105243_10235821 3300009148 Bacteria 1625
112 Ga0105241_10025442 3300009174 Bacteria 4398
113 Ga0105241_10035619 3300009174 Bacteria 3743
114 Ga0105241_10043152 3300009174 Bacteria 3415
115 Ga0105241_10069446 3300009174 Bacteria 2732
116 Ga0105242_10006636 3300009176 Bacteria 8925
117 Ga0105242_10011071 3300009176 Bacteria 6930
118 Ga0105242_10082375 3300009176 Bacteria 2693
119 Ga0105242_10093863 3300009176 Bacteria 2530
120 Ga0105242_10312612 3300009176 Unclassified 1438
121 Ga0105248_10003181 3300009177 Bacteria 18199
122 Ga0105248_10019713 3300009177 Bacteria 7467
123 Ga0105248_10029694 3300009177 Bacteria 6100
124 Ga0105248_10036674 3300009177 Bacteria 5484
125 Ga0105248_10049012 3300009177 Unclassified 4738
126 Ga0105248_10070503 3300009177 Bacteria 3925
127 Ga0105248_10103532 3300009177 Bacteria 3209
128 Ga0105248_10158808 3300009177 Bacteria 2551
129 Ga0105248_10334673 3300009177 Bacteria 1705
130 Ga0105248_10341318 3300009177 Bacteria 1686
131 Ga0105248_10584940 3300009177 Bacteria 1259
132 Ga0105237_10004603 3300009545 Bacteria 15912
133 Ga0105237_10046789 3300009545 Bacteria 4351
134 Ga0105237_10061660 3300009545 Bacteria 3749
135 Ga0105237_10064414 3300009545 Bacteria 3662
136 Ga0105237_10194200 3300009545 Unclassified 2029
137 Ga0105237_10267637 3300009545 Bacteria 1712
138 Ga0105238_10013624 3300009551 Bacteria 8213
139 Ga0105238_10015296 3300009551 Bacteria 7771
140 Ga0105238_10026384 3300009551 Bacteria 5923
141 Ga0105238_10089255 3300009551 Bacteria 3070
142 Ga0105238_10272655 3300009551 Bacteria 1673
143 Ga0105249_10012188 3300009553 Bacteria 7572
144 Ga0105249_10118766 3300009553 Bacteria 2510
145 Ga0105239_10013971 3300010375 Bacteria 8915
146 Ga0105239_10026240 3300010375 Bacteria 6413
147 Ga0105239_10060693 3300010375 Bacteria 4150
148 Ga0105239_10099385 3300010375 Unclassified 3217
149 Ga0105239_10257608 3300010375 Unclassified 1960
150 Ga0105239_10323660 3300010375 Bacteria 1739
151 Ga0105239_10355196 3300010375 Unclassified 1655
152 Ga0105246_10006754 3300011119 Bacteria 7015
153 Ga0105246_10032563 3300011119 Unclassified 3458
154 Ga0157369_10002887 3300013105 Bacteria 20533
155 Ga0157369_10036207 3300013105 Bacteria 5408
156 Ga0157369_10054814 3300013105 Bacteria 4304
157 Ga0157369_10130329 3300013105 Bacteria 2665
158 Ga0157369_10371263 3300013105 Bacteria 1485
159 Ga0157374_10019744 3300013296 Bacteria 5970
160 Ga0157374_10027305 3300013296 Bacteria 5146
161 Ga0157374_10061450 3300013296 Bacteria 3518
162 Ga0157374_10329327 3300013296 Unclassified 1515
163 Ga0157378_10054354 3300013297 Unclassified 3565
164 Ga0157378_10264701 3300013297 Bacteria 1651
165 Ga0163162_10003329 3300013306 Bacteria 15376
166 Ga0163162_10030390 3300013306 Bacteria 5353
167 Ga0163162_10038268 3300013306 Bacteria 4787
168 Ga0163162_10073863 3300013306 Bacteria 3467
169 Ga0163162_10103210 3300013306 Bacteria 2945
170 Ga0157372_10079823 3300013307 Bacteria 3701
171 Ga0157372_10354139 3300013307 Bacteria 1710
172 Ga0157372_10522537 3300013307 Bacteria 1384
173 Ga0157372_10704040 3300013307 Bacteria 1175
174 Ga0157375_10004390 3300013308 Bacteria 12246
175 Ga0157375_10073765 3300013308 Bacteria 3432
176 Ga0157375_10097731 3300013308 Unclassified 3011
177 Ga0157375_10329957 3300013308 Bacteria 1690
178 Ga0163163_10076209 3300014325 Bacteria 3348
179 Ga0163163_10101392 3300014325 Bacteria 2901
180 Ga0163163_10189588 3300014325 Unclassified 2104
181 Ga0163163_10261875 3300014325 Bacteria 1780
182 Ga0163163_10594222 3300014325 Unclassified 1170
183 Ga0157380_10022087 3300014326 Bacteria 4783
184 Ga0157377_10047925 3300014745 Bacteria 2395
185 Ga0157379_10060769 3300014968 Plasmid 3379
186 Ga0157379_10109594 3300014968 Bacteria 2480
187 Ga0157376_10053278 3300014969 Bacteria 3368
188 Ga0157376_10090333 3300014969 Bacteria 2650
189 Ga0157376_10109458 3300014969 Unclassified 2429
190 Ga0157376_10129618 3300014969 Unclassified 2248
191 Ga0157376_10139466 3300014969 Unclassified 2173
192 Ga0213876_10049027 3300021384 Unclassified 2231
193 Ga0207710_10027585 3300025900 Bacteria 2460
194 Ga0207688_10052232 3300025901 Bacteria 2290
195 Ga0207680_10001961 3300025903 Bacteria 9627
196 Ga0207647_10014425 3300025904 Bacteria 5448
197 Ga0207699_10017598 3300025906 Bacteria 3767
198 Ga0207705_10010373 3300025909 Bacteria 6774
199 Ga0207654_10020316 3300025911 Bacteria 3519
200 Ga0207707_10033326 3300025912 Bacteria 4508
201 Ga0207707_10263294 3300025912 Bacteria 1496
202 Ga0207695_10026551 3300025913 Bacteria 6464
203 Ga0207695_10084007 3300025913 Bacteria 3215
204 Ga0207695_10153375 3300025913 Bacteria 2241
205 Ga0207671_10030506 3300025914 Unclassified 4021
206 Ga0207671_10033707 3300025914 Bacteria 3808
207 Ga0207671_10124696 3300025914 Bacteria 1971
208 Ga0207671_10214061 3300025914 Unclassified 1508
209 Ga0207660_10219442 3300025917 Unclassified 1492
210 Ga0207649_10238822 3300025920 Unclassified 1303
211 Ga0207652_10158339 3300025921 Bacteria 2029
212 Ga0207652_10279676 3300025921 Bacteria 1505
213 Ga0207681_10259542 3300025923 Bacteria 1360
214 Ga0207694_10006819 3300025924 Bacteria 8673
215 Ga0207694_10018203 3300025924 Bacteria 5311
216 Ga0207694_10022838 3300025924 Unclassified 4744
217 Ga0207694_10060461 3300025924 Bacteria 2948
218 Ga0207694_10080126 3300025924 Bacteria 2562
219 Ga0207694_10110377 3300025924 Bacteria 2188
220 Ga0207694_10261441 3300025924 Unclassified 1418
221 Ga0207687_10001558 3300025927 Bacteria 15752
222 Ga0207687_10007439 3300025927 Bacteria 7211
223 Ga0207700_10029459 3300025928 Bacteria 3874
224 Ga0207700_10250587 3300025928 Unclassified 1513
225 Ga0207644_10104877 3300025931 Bacteria 2129
226 Ga0207644_10224904 3300025931 Bacteria 1489
227 Ga0207690_10075343 3300025932 Bacteria 2340
228 Ga0207706_10310883 3300025933 Bacteria 1372
229 Ga0207686_10059678 3300025934 Bacteria 2411
230 Ga0207686_10068608 3300025934 Bacteria 2272
231 Ga0207709_10286365 3300025935 Unclassified 1219
232 Ga0207670_10071763 3300025936 Bacteria 2396
233 Ga0207669_10149477 3300025937 Bacteria 1634
234 Ga0207669_10347649 3300025937 Bacteria 1144
235 Ga0207711_10003495 3300025941 Bacteria 13600
236 Ga0207711_10006460 3300025941 Bacteria 9869
237 Ga0207711_10051409 3300025941 Plasmid 3529
238 Ga0207711_10084808 3300025941 Bacteria 2774
239 Ga0207711_10087373 3300025941 Bacteria 2735
240 Ga0207711_10118209 3300025941 Bacteria 2365
241 Ga0207689_10001891 3300025942 Bacteria 19805
242 Ga0207661_10213865 3300025944 Bacteria 1700
243 Ga0207661_10258366 3300025944 Unclassified 1551
244 Ga0207679_10116297 3300025945 Bacteria 2120
245 Ga0207679_10135134 3300025945 Bacteria 1985
246 Ga0207679_10233253 3300025945 Bacteria 1555
247 Ga0207667_10027183 3300025949 Bacteria 6235
248 Ga0207667_10072541 3300025949 Plasmid 3578
249 Ga0207667_10289558 3300025949 Bacteria 1673
250 Ga0207712_10053864 3300025961 Unclassified 2824
251 Ga0207658_10240749 3300025986 Bacteria 1533
252 Ga0207677_10049002 3300026023 Plasmid 2847
253 Ga0207703_10003472 3300026035 Bacteria 13199
254 Ga0207703_10012073 3300026035 Bacteria 6730
255 Ga0207703_10095326 3300026035 Unclassified 2510
256 Ga0207703_10154425 3300026035 Bacteria 2004
257 Ga0207639_10128969 3300026041 Bacteria 2091
258 Ga0207639_10166216 3300026041 Bacteria 1864
259 Ga0207702_10016600 3300026078 Bacteria 6093
260 Ga0207702_10064595 3300026078 Bacteria 3132
261 Ga0207702_10095902 3300026078 Bacteria 2607
262 Ga0207702_10167081 3300026078 Bacteria 2014
263 Ga0207641_10002814 3300026088 Bacteria 15835
264 Ga0207641_10025404 3300026088 Bacteria 4884
265 Ga0207641_10029576 3300026088 Bacteria 4532
266 Ga0207641_10113069 3300026088 Bacteria 2410
267 Ga0207648_10028189 3300026089 Bacteria 4980
268 Ga0207648_10111362 3300026089 Bacteria 2403
269 Ga0207648_10161974 3300026089 Bacteria 1976
270 Ga0207648_10431861 3300026089 Unclassified 1197
271 Ga0207676_10021279 3300026095 Bacteria 4758
272 Ga0207674_10010528 3300026116 Bacteria 10468
273 Ga0207674_10018951 3300026116 Bacteria 7461
274 Ga0207674_10077309 3300026116 Bacteria 3334
275 Ga0207674_10120697 3300026116 Bacteria 2589
276 Ga0207674_10129920 3300026116 Bacteria 2483
277 Ga0207674_10152213 3300026116 Unclassified 2270
278 Ga0207683_10033544 3300026121 Bacteria 4459
279 Ga0207683_10181991 3300026121 Bacteria 1906
280 Ga0207683_10247722 3300026121 Bacteria 1626
281 Ga0207698_10201992 3300026142 Bacteria 1780
282 Ga0207428_10050488 3300027907 Bacteria 3328
283 Ga0207428_10160238 3300027907 Bacteria 1709
284 Ga0268265_10298356 3300028380 Unclassified 1450
285 Ga0268264_10004215 3300028381 Bacteria 12271
286 Ga0268264_10033915 3300028381 Bacteria 4196
287 Ga0265314_10109023 3300031711 Bacteria 1763
288 Ga0373923_0123857 3300035111 Unclassified 1157
289 Ga0373923_0127590 3300035111 Bacteria 1141
290 Ga0373932_0037629 3300035112 Bacteria 1380
291 Ga0373953_0049458 3300035117 Unclassified 1696
292 Ga0373954_0064586 3300035118 Bacteria 1731
293 Ga0373943_0055946 3300035170 Bacteria 1956
294 Ga0373955_0029319 3300035172 Bacteria 2861
295 Ga0373931_0153083 3300035691 Bacteria 1346
296 Ga0373935_0284501 3300035692 Unclassified 1165
297 Ga0373927_0013045 3300035695 Bacteria 5527
298 Ga0373927_0063229 3300035695 Unclassified 2394
299 Ga0373933_0009076 3300035724 Bacteria 5428
300 Ga0373933_0034167 3300035724 Bacteria 2962
301 Ga0373947_0058449 3300035725 Unclassified 2337
302 Ga0373937_0010972 3300036401 Bacteria 7938
303 Ga0373937_0052940 3300036401 Bacteria 3723
304 Ga0373937_0133560 3300036401 Bacteria 2319
305 Ga0373937_0244548 3300036401 Bacteria 1691
306 Ga0373925_0025065 3300037068 Bacteria 4356
307 Ga0373925_0080183 3300037068 Unclassified 2481
308 Ga0373925_0087161 3300037068 Bacteria 2383
309 Ga0436364_0385342 3300037853 Bacteria 7311
310 Ga0436365_0700482 3300039437 Unclassified 3698
311 Ga0436365_1165425 3300039437 Plasmid 3872
312 Ga0439464_0031852 3300042439 Bacteria 1480
313 Ga0495592_0016775 3300046454 Bacteria 5560
314 Ga0495603_0081615 3300046455 Bacteria 1894
315 Ga0495629_0012324 3300046459 Bacteria 6191
316 Ga0495629_0031540 3300046459 Bacteria 3752
317 Ga0495629_0056875 3300046459 Bacteria 2735
318 Ga0495651_0011687 3300046462 Bacteria 6750
319 Ga0495651_0036748 3300046462 Bacteria 3813
320 Ga0495653_0031668 3300046463 Bacteria 4202
321 Ga0495580_0009128 3300046472 Bacteria 7823
322 Ga0495580_0010578 3300046472 Bacteria 7180
323 Ga0495580_0228734 3300046472 Bacteria 1277
324 Ga0495582_0000195 3300046473 Bacteria 33636
325 Ga0495582_0001130 3300046473 Bacteria 15020
326 Ga0495582_0001398 3300046473 Bacteria 13591
327 Ga0495639_0004212 3300046475 Bacteria 6169
328 Ga0495639_0040508 3300046475 Bacteria 2096
329 Ga0495662_0011483 3300046476 Bacteria 4327
330 Ga0495664_0006548 3300046477 Bacteria 6435
331 Ga0495664_0017470 3300046477 Unclassified 4102
332 Ga0495594_0001814 3300046499 Bacteria 11102
333 Ga0495594_0040075 3300046499 Bacteria 2562
334 Ga0495583_0030722 3300046506 Bacteria 2612
335 Ga0495608_0016041 3300046511 Bacteria 5184
336 Ga0495608_0096070 3300046511 Bacteria 1914
337 Ga0495618_0062973 3300046514 Bacteria 2354
338 Ga0495628_0092155 3300046516 Bacteria 2344
339 Ga0495628_0283865 3300046516 Bacteria 1229
340 Ga0495630_0117973 3300046517 Unclassified 2012
341 Ga0495630_0176340 3300046517 Bacteria 1629
342 Ga0495666_0005242 3300046526 Bacteria 6540
343 Ga0495652_0021532 3300046529 Bacteria 5729
344 Ga0495652_0057334 3300046529 Bacteria 3303
345 Ga0495652_0079562 3300046529 Bacteria 2709
346 Ga0495665_0023695 3300046531 Bacteria 3297
347 Ga0495665_0107267 3300046531 Bacteria 1465
348 Ga0495640_0017211 3300046533 Bacteria 5392
349 Ga0495640_0069425 3300046533 Bacteria 2370
350 Ga0495586_0011765 3300046535 Bacteria 4652
351 Ga0495587_0002935 3300046536 Bacteria 11406
352 Ga0495587_0016199 3300046536 Bacteria 4640
353 Ga0495587_0052583 3300046536 Bacteria 2403
354 Ga0495645_0013615 3300046543 Bacteria 5759
355 Ga0495645_0034942 3300046543 Bacteria 3664
356 Ga0495645_0252459 3300046543 Unclassified 1172
357 Ga0495622_0013163 3300046557 Bacteria 3840
358 Ga0495667_0004952 3300046559 Bacteria 9006
359 Ga0495667_0006097 3300046559 Bacteria 8162
360 Ga0495667_0023957 3300046559 Unclassified 4111
361 Ga0495667_0233032 3300046559 Unclassified 1174
362 Ga0495634_0010611 3300046642 Bacteria 6746
363 Ga0495634_0022427 3300046642 Bacteria 4448
364 Ga0495634_0088676 3300046642 Bacteria 2012
365 Ga0495625_0036401 3300046660 Bacteria 3618
366 Ga0495635_0033959 3300046663 Bacteria 3538
367 Ga0495659_0023653 3300046664 Bacteria 2089
368 Ga0495657_0031731 3300046675 Unclassified 3690
369 Ga0495599_0002009 3300046678 Bacteria 11761
370 Ga0495599_0081741 3300046678 Bacteria 2018
371 Ga0495599_0089149 3300046678 Bacteria 1925
372 Ga0495623_0028823 3300046679 Bacteria 3572
373 Ga0495623_0124831 3300046679 Bacteria 1546
374 Ga0495658_0006366 3300046683 Bacteria 5800
375 Ga0495658_0065388 3300046683 Bacteria 2098
376 Ga0495658_0082963 3300046683 Bacteria 1884
377 Ga0495669_0004344 3300046684 Bacteria 5851
378 Ga0495613_0084037 3300046689 Bacteria 2311
379 Ga0495613_0180026 3300046689 Bacteria 1497
380 Ga0495613_0264522 3300046689 Bacteria 1197
381 Ga0495624_0035079 3300046690 Bacteria 3239
382 Ga0495649_0011126 3300046694 Bacteria 5295
383 Ga0495600_0015165 3300046809 Bacteria 4869
384 Ga0495600_0042063 3300046809 Bacteria 2978
385 Ga0495581_0021200 3300047315 Bacteria 3768
386 Ga0495581_0050465 3300047315 Bacteria 2403
387 Ga0495581_0124770 3300047315 Bacteria 1499
388 Ga0495604_0018382 3300047317 Bacteria 5597
389 Ga0495604_0026462 3300047317 Unclassified 4618
390 Ga0495604_0039434 3300047317 Bacteria 3712
391 Ga0495604_0118619 3300047317 Bacteria 1918
392 Ga0495604_0142269 3300047317 Bacteria 1713
393 Ga0495674_0001437 3300047319 Bacteria 23339
394 Ga0495674_0033273 3300047319 Bacteria 4671
395 Ga0495674_0062960 3300047319 Unclassified 3228
396 Ga0495674_0067315 3300047319 Unclassified 3103
397 Ga0495674_0069820 3300047319 Bacteria 3037
398 Ga0495674_0073524 3300047319 Bacteria 2946
399 Ga0495674_0082569 3300047319 Unclassified 2755
400 Ga0495674_0222131 3300047319 Bacteria 1561
401 Ga0495680_0011017 3300047322 Bacteria 8033
402 Ga0495680_0072160 3300047322 Unclassified 2627
403 Ga0495680_0251932 3300047322 Unclassified 1251
404 Ga0495675_0002040 3300047444 Bacteria 12084
405 Ga0495675_0002400 3300047444 Bacteria 11187
406 Ga0495675_0008138 3300047444 Bacteria 6488
407 Ga0495675_0147210 3300047444 Bacteria 1457
408 Ga0495684_0020145 3300047471 Bacteria 5137
409 Ga0495684_0032827 3300047471 Bacteria 3987
410 Ga0495684_0043143 3300047471 Bacteria 3453
411 Ga0495684_0071951 3300047471 Unclassified 2627
412 Ga0495684_0073627 3300047471 Unclassified 2595
413 Ga0495684_0084801 3300047471 Bacteria 2403
414 Ga0495684_0089550 3300047471 Unclassified 2331
415 Ga0495684_0122528 3300047471 Bacteria 1957
416 Ga0495684_0192933 3300047471 Bacteria 1505
417 Ga0495684_0244112 3300047471 Bacteria 1309
418 Ga0495684_0286026 3300047471 Unclassified 1188
419 Ga0495593_0076117 3300047673 Bacteria 1739
420 Ga0495602_0055119 3300048088 Bacteria 3503
421 Ga0495602_0061248 3300048088 Bacteria 3274
422 Ga0495602_0258147 3300048088 Unclassified 1294
423 Ga0495614_0001188 3300048089 Bacteria 11176
424 Ga0496101_0179731 3300048904 Bacteria 1629
425 Ga0496102_0052582 3300048905 Bacteria 3712
426 Ga0496104_0097959 3300048907 Bacteria 2807
427 Ga0496104_0153410 3300048907 Bacteria 2211
428 Ga0496104_0190538 3300048907 Bacteria 1962
429 Ga0496104_0387079 3300048907 Bacteria 1311
430 Ga0496105_0086730 3300048908 Bacteria 2587
431 Ga0496109_0305028 3300048912 Unclassified 1502
432 Ga0496112_0000613 3300048915 Bacteria 24604
433 Ga0496112_0035019 3300048915 Bacteria 4887
434 Ga0496112_0119967 3300048915 Unclassified 2600
435 Ga0496112_0361981 3300048915 Bacteria 1392
436 Ga0496115_0292262 3300048918 Bacteria 1336
437 Ga0501031_0198148 3300049568 Bacteria 1311
438 Ga0501033_0053201 3300049570 Bacteria 2998
439 Ga0501034_0022072 3300049571 Bacteria 6485
440 Ga0501036_0001188 3300049572 Bacteria 19837
441 Ga0501036_0002381 3300049572 Bacteria 14697
442 Ga0501037_0007637 3300049573 Bacteria 7917
443 Ga0501038_0000669 3300049574 Bacteria 30504
444 Ga0501039_0001969 3300049575 Bacteria 15222
445 Ga0501039_0181365 3300049575 Bacteria 1656
446 Ga0501040_0001622 3300049576 Bacteria 14327
447 Ga0501040_0015576 3300049576 Bacteria 5025
448 Ga0501041_0003647 3300049577 Bacteria 8857
449 Ga0501041_0059035 3300049577 Bacteria 2348
450 Ga0501042_0047337 3300049578 Bacteria 3066
451 Ga0501043_0001678 3300049579 Bacteria 19230
452 Ga0501043_0147572 3300049579 Bacteria 1841
453 Ga0501046_0003160 3300049580 Bacteria 15207
454 Ga0501046_0145157 3300049580 Bacteria 1793
455 Ga0501047_0040618 3300049581 Unclassified 4498
456 Ga0501048_0003513 3300049582 Bacteria 11918
457 Ga0501048_0067213 3300049582 Bacteria 2534
458 Ga0501067_0001344 3300049583 Bacteria 13316
459 Ga0501068_0000439 3300049584 Bacteria 21128
460 Ga0501069_0003141 3300049585 Bacteria 8467
461 Ga0501070_0060961 3300049586 Bacteria 3126
462 Ga0501070_0104957 3300049586 Unclassified 2336
463 Ga0501071_0015086 3300049587 Bacteria 5297
464 Ga0501071_0019187 3300049587 Bacteria 4745
465 Ga0501072_0000247 3300049588 Bacteria 39831
466 Ga0501073_0026016 3300049589 Bacteria 4193
467 Ga0501075_0000797 3300049591 Bacteria 19717
468 Ga0501075_0064809 3300049591 Bacteria 2756
469 Ga0501076_0010840 3300049592 Bacteria 6777
470 Ga0501076_0080307 3300049592 Bacteria 2618
471 Ga0501076_0217290 3300049592 Unclassified 1562
472 Ga0501077_0010706 3300049593 Bacteria 5711
473 Ga0501079_0005087 3300049741 Bacteria 9767
474 Ga0501079_0122172 3300049741 Bacteria 2025
475 Ga0501079_0122422 3300049741 Bacteria 2023
476 Ga0501080_0000018 3300049742 Bacteria 95463
477 Ga0501081_0003349 3300049743 Bacteria 10195
478 Ga0501035_0018181 3300049822 Bacteria 6473
479 Ga0501035_0021783 3300049822 Bacteria 5891
480 Ga0501035_0142267 3300049822 Unclassified 2085
481 Ga0501044_0001899 3300049823 Bacteria 24178
482 Ga0501044_0024708 3300049823 Bacteria 6374
483 Ga0501044_0066240 3300049823 Bacteria 3683
484 Ga0501045_0000242 3300049824 Bacteria 31725
485 Ga0501045_0104012 3300049824 Unclassified 2103
486 nmdc:mga09592_96562_c1 3300050508 Unclassified 2528
487 nmdc:mga0qj67_63333_c1 3300050509 Unclassified 2940
488 nmdc:mga06r32_21881_c1 3300050510 Bacteria 5904
489 nmdc:mga06r32_411294_c1 3300050510 Bacteria 1334
490 nmdc:mga06r32_623886_c1 3300050510 Bacteria 1048
491 nmdc:mga06r32_80990_c1 3300050510 Bacteria 3161
492 nmdc:mga0n895_19687_c1 3300050512 Bacteria 6276
493 nmdc:mga0rr50_262196_c1 3300050513 Bacteria 1438
494 nmdc:mga0a205_292391_c1 3300050515 Unclassified 1503
495 nmdc:mga0a205_30354_c2 3300050515 Bacteria 4694
496 nmdc:mga0a205_65472_c1 3300050515 Bacteria 3511
497 Ga0500568_0007427 3300053139 Bacteria 5377
498 Ga0501084_0002332 3300054114 Bacteria 15252
499 Ga0501084_0064895 3300054114 Bacteria 3054
500 Ga0501082_0000404 3300060353 Bacteria 38169
501 Ga0501082_0118975 3300060353 Bacteria 2289
502 Ga0530510_0000156 3300061734 Bacteria 40875
503 Ga0530510_0012538 3300061734 Bacteria 5957
504 Ga0070671_100093000
505 Ga0070658_10016488
506 Ga0070690_100068681
507 Ga0068869_100001964
508 Ga0070666_10000945
509 Ga0068868_100023791
510 Ga0070660_100056871
511 Ga0070689_100096754
512 Ga0070668_100348903
513 Ga0070669_100106872
514 Ga0070669_100271887
515 Ga0070675_100153101
516 Ga0070671_100004108
517 Ga0070671_100180430
518 Ga0070674_100065647
519 Ga0070674_100223154
520 Ga0070688_100233491
521 Ga0070659_100028922
522 Ga0070659_100079162
523 Ga0070667_100143074
524 Ga0070709_10083231
525 Ga0070714_100000417
526 Ga0070713_100036273
527 Ga0070711_100045831
528 Ga0070711_100109798
529 Ga0070678_100045599
530 Ga0070662_100113790
531 Ga0070681_10031695
532 Ga0070681_10093826
533 Ga0070681_10175386
534 Ga0070699_100050708
535 Ga0070679_100111535
536 Ga0070679_100213010
537 Ga0070679_100304869
538 Ga0070684_100011965
539 Ga0070684_100147435
540 Ga0070684_100370012
541 Ga0070684_100387685
542 Ga0068853_100014521
543 Ga0068853_100080716
544 Ga0068853_100089155
545 Ga0068855_100052455
546 Ga0068855_100077322
547 Ga0068855_100091802
548 Ga0068855_100102673
549 Ga0070664_100044672
550 Ga0068857_100004111
551 Ga0068857_100008108
552 Ga0068857_100105095
553 Ga0068857_100143697
554 Ga0068857_100224126
555 Ga0068856_100018528
556 Ga0068856_100025884
557 Ga0068856_100129401
558 Ga0068852_100152092
559 Ga0068852_100476618
560 Ga0068859_100009349
561 Ga0068859_100178178
562 Ga0068859_100234877
563 Ga0068859_100611045
564 Ga0068864_100033889
565 Ga0068864_100151170
566 Ga0068863_100003785
567 Ga0068863_100027558
568 Ga0068858_100000372
569 Ga0068858_100013587
570 Ga0068858_100018982
571 Ga0068860_100026616
572 Ga0068860_100061799
573 Ga0068862_100351196
574 Ga0081455_10026465
575 Ga0070717_10064745
576 Ga0070712_100112245
577 Ga0097621_100002285
578 Ga0097621_100004531
579 Ga0097621_100017360
580 Ga0097621_100260168
581 Ga0068871_100031005
582 Ga0068871_100043431
583 Ga0068871_100132782
584 Ga0068871_100138415
585 Ga0068871_100282733
586 Ga0075428_100587838
587 Ga0075430_100033245
588 Ga0075431_100105101
589 Ga0075431_100266602
590 Ga0075433_10010881
591 Ga0075434_100004978
592 Ga0075434_100037166
593 Ga0068865_100002615
594 Ga0068865_100008054
595 Ga0097620_100000031
596 Ga0097620_100009350
597 Ga0097620_100178182
598 Ga0097620_100234898
599 Ga0097620_100611008
600 Ga0075435_100052668
601 Ga0075435_100258891
602 Ga0105240_10013594
603 Ga0105240_10051233
604 Ga0105240_10080296
605 Ga0105240_10080622
606 Ga0105240_10293934
607 Ga0105240_10296558
608 Ga0105245_10010454
609 Ga0105245_10028332
610 Ga0105245_10054458
611 Ga0114129_10008410
612 Ga0114129_10131485
613 Ga0105243_10113082
614 Ga0105243_10235821
615 Ga0105241_10025442
616 Ga0105241_10035619
617 Ga0105241_10043152
618 Ga0105241_10069446
619 Ga0105242_10006636
620 Ga0105242_10011071
621 Ga0105242_10082375
622 Ga0105242_10093863
623 Ga0105242_10312612
624 Ga0105248_10003181
625 Ga0105248_10019713
626 Ga0105248_10029694
627 Ga0105248_10036674
628 Ga0105248_10049012
629 Ga0105248_10070503
630 Ga0105248_10103532
631 Ga0105248_10158808
632 Ga0105248_10334673
633 Ga0105248_10341318
634 Ga0105248_10584940
635 Ga0105237_10004603
636 Ga0105237_10046789
637 Ga0105237_10061660
638 Ga0105237_10064414
639 Ga0105237_10194200
640 Ga0105237_10267637
641 Ga0105238_10013624
642 Ga0105238_10015296
643 Ga0105238_10026384
644 Ga0105238_10089255
645 Ga0105238_10272655
646 Ga0105249_10012188
647 Ga0105249_10118766
648 Ga0105239_10013971
649 Ga0105239_10026240
650 Ga0105239_10060693
651 Ga0105239_10099385
652 Ga0105239_10257608
653 Ga0105239_10323660
654 Ga0105239_10355196
655 Ga0105246_10006754
656 Ga0105246_10032563
657 Ga0157369_10002887
658 Ga0157369_10036207
659 Ga0157369_10054814
660 Ga0157369_10130329
661 Ga0157369_10371263
662 Ga0157374_10019744
663 Ga0157374_10027305
664 Ga0157374_10061450
665 Ga0157374_10329327
666 Ga0157378_10054354
667 Ga0157378_10264701
668 Ga0163162_10003329
669 Ga0163162_10030390
670 Ga0163162_10038268
671 Ga0163162_10073863
672 Ga0163162_10103210
673 Ga0157372_10079823
674 Ga0157372_10354139
675 Ga0157372_10522537
676 Ga0157372_10704040
677 Ga0157375_10004390
678 Ga0157375_10073765
679 Ga0157375_10097731
680 Ga0157375_10329957
681 Ga0163163_10076209
682 Ga0163163_10101392
683 Ga0163163_10189588
684 Ga0163163_10261875
685 Ga0163163_10594222
686 Ga0157380_10022087
687 Ga0157377_10047925
688 Ga0157379_10060769
689 Ga0157379_10109594
690 Ga0157376_10053278
691 Ga0157376_10090333
692 Ga0157376_10109458
693 Ga0157376_10129618
694 Ga0157376_10139466
695 Ga0213876_10049027
696 Ga0207710_10027585
697 Ga0207688_10052232
698 Ga0207680_10001961
699 Ga0207647_10014425
700 Ga0207699_10017598
701 Ga0207705_10010373
702 Ga0207654_10020316
703 Ga0207707_10033326
704 Ga0207707_10263294
705 Ga0207695_10026551
706 Ga0207695_10084007
707 Ga0207695_10153375
708 Ga0207671_10030506
709 Ga0207671_10033707
710 Ga0207671_10124696
711 Ga0207671_10214061
712 Ga0207660_10219442
713 Ga0207649_10238822
714 Ga0207652_10158339
715 Ga0207652_10279676
716 Ga0207681_10259542
717 Ga0207694_10006819
718 Ga0207694_10018203
719 Ga0207694_10022838
720 Ga0207694_10060461
721 Ga0207694_10080126
722 Ga0207694_10110377
723 Ga0207694_10261441
724 Ga0207687_10001558
725 Ga0207687_10007439
726 Ga0207700_10029459
727 Ga0207700_10250587
728 Ga0207644_10104877
729 Ga0207644_10224904
730 Ga0207690_10075343
731 Ga0207706_10310883
732 Ga0207686_10059678
733 Ga0207686_10068608
734 Ga0207709_10286365
735 Ga0207670_10071763
736 Ga0207669_10149477
737 Ga0207669_10347649
738 Ga0207711_10003495
739 Ga0207711_10006460
740 Ga0207711_10051409
741 Ga0207711_10084808
742 Ga0207711_10087373
743 Ga0207711_10118209
744 Ga0207689_10001891
745 Ga0207661_10213865
746 Ga0207661_10258366
747 Ga0207679_10116297
748 Ga0207679_10135134
749 Ga0207679_10233253
750 Ga0207667_10027183
751 Ga0207667_10072541
752 Ga0207667_10289558
753 Ga0207712_10053864
754 Ga0207658_10240749
755 Ga0207677_10049002
756 Ga0207703_10003472
757 Ga0207703_10012073
758 Ga0207703_10095326
759 Ga0207703_10154425
760 Ga0207639_10128969
761 Ga0207639_10166216
762 Ga0207702_10016600
763 Ga0207702_10064595
764 Ga0207702_10095902
765 Ga0207702_10167081
766 Ga0207641_10002814
767 Ga0207641_10025404
768 Ga0207641_10029576
769 Ga0207641_10113069
770 Ga0207648_10028189
771 Ga0207648_10111362
772 Ga0207648_10161974
773 Ga0207648_10431861
774 Ga0207676_10021279
775 Ga0207674_10010528
776 Ga0207674_10018951
777 Ga0207674_10077309
778 Ga0207674_10120697
779 Ga0207674_10129920
780 Ga0207674_10152213
781 Ga0207683_10033544
782 Ga0207683_10181991
783 Ga0207683_10247722
784 Ga0207698_10201992
785 Ga0207428_10050488
786 Ga0207428_10160238
787 Ga0268265_10298356
788 Ga0268264_10004215
789 Ga0268264_10033915
790 Ga0265314_10109023
791 Ga0373923_0123857
792 Ga0373923_0127590
793 Ga0373932_0037629
794 Ga0373953_0049458
795 Ga0373954_0064586
796 Ga0373943_0055946
797 Ga0373955_0029319
798 Ga0373931_0153083
799 Ga0373935_0284501
800 Ga0373927_0013045
801 Ga0373927_0063229
802 Ga0373933_0009076
803 Ga0373933_0034167
804 Ga0373947_0058449
805 Ga0373937_0010972
806 Ga0373937_0052940
807 Ga0373937_0133560
808 Ga0373937_0244548
809 Ga0373925_0025065
810 Ga0373925_0080183
811 Ga0373925_0087161
812 Ga0436364_0385342
813 Ga0436365_0700482
814 Ga0436365_1165425
815 Ga0439464_0031852
816 Ga0495592_0016775
817 Ga0495603_0081615
818 Ga0495629_0012324
819 Ga0495629_0031540
820 Ga0495629_0056875
821 Ga0495651_0011687
822 Ga0495651_0036748
823 Ga0495653_0031668
824 Ga0495580_0009128
825 Ga0495580_0010578
826 Ga0495580_0228734
827 Ga0495582_0000195
828 Ga0495582_0001130
829 Ga0495582_0001398
830 Ga0495639_0004212
831 Ga0495639_0040508
832 Ga0495662_0011483
833 Ga0495664_0006548
834 Ga0495664_0017470
835 Ga0495594_0001814
836 Ga0495594_0040075
837 Ga0495583_0030722
838 Ga0495608_0016041
839 Ga0495608_0096070
840 Ga0495618_0062973
841 Ga0495628_0092155
842 Ga0495628_0283865
843 Ga0495630_0117973
844 Ga0495630_0176340
845 Ga0495666_0005242
846 Ga0495652_0021532
847 Ga0495652_0057334
848 Ga0495652_0079562
849 Ga0495665_0023695
850 Ga0495665_0107267
851 Ga0495640_0017211
852 Ga0495640_0069425
853 Ga0495586_0011765
854 Ga0495587_0002935
855 Ga0495587_0016199
856 Ga0495587_0052583
857 Ga0495645_0013615
858 Ga0495645_0034942
859 Ga0495645_0252459
860 Ga0495622_0013163
861 Ga0495667_0004952
862 Ga0495667_0006097
863 Ga0495667_0023957
864 Ga0495667_0233032
865 Ga0495634_0010611
866 Ga0495634_0022427
867 Ga0495634_0088676
868 Ga0495625_0036401
869 Ga0495635_0033959
870 Ga0495659_0023653
871 Ga0495657_0031731
872 Ga0495599_0002009
873 Ga0495599_0081741
874 Ga0495599_0089149
875 Ga0495623_0028823
876 Ga0495623_0124831
877 Ga0495658_0006366
878 Ga0495658_0065388
879 Ga0495658_0082963
880 Ga0495669_0004344
881 Ga0495613_0084037
882 Ga0495613_0180026
883 Ga0495613_0264522
884 Ga0495624_0035079
885 Ga0495649_0011126
886 Ga0495600_0015165
887 Ga0495600_0042063
888 Ga0495581_0021200
889 Ga0495581_0050465
890 Ga0495581_0124770
891 Ga0495604_0018382
892 Ga0495604_0026462
893 Ga0495604_0039434
894 Ga0495604_0118619
895 Ga0495604_0142269
896 Ga0495674_0001437
897 Ga0495674_0033273
898 Ga0495674_0062960
899 Ga0495674_0067315
900 Ga0495674_0069820
901 Ga0495674_0073524
902 Ga0495674_0082569
903 Ga0495674_0222131
904 Ga0495680_0011017
905 Ga0495680_0072160
906 Ga0495680_0251932
907 Ga0495675_0002040
908 Ga0495675_0002400
909 Ga0495675_0008138
910 Ga0495675_0147210
911 Ga0495684_0020145
912 Ga0495684_0032827
913 Ga0495684_0043143
914 Ga0495684_0071951
915 Ga0495684_0073627
916 Ga0495684_0084801
917 Ga0495684_0089550
918 Ga0495684_0122528
919 Ga0495684_0192933
920 Ga0495684_0244112
921 Ga0495684_0286026
922 Ga0495593_0076117
923 Ga0495602_0055119
924 Ga0495602_0061248
925 Ga0495602_0258147
926 Ga0495614_0001188
927 Ga0496101_0179731
928 Ga0496102_0052582
929 Ga0496104_0097959
930 Ga0496104_0153410
931 Ga0496104_0190538
932 Ga0496104_0387079
933 Ga0496105_0086730
934 Ga0496109_0305028
935 Ga0496112_0000613
936 Ga0496112_0035019
937 Ga0496112_0119967
938 Ga0496112_0361981
939 Ga0496115_0292262
940 Ga0501031_0198148
941 Ga0501033_0053201
942 Ga0501034_0022072
943 Ga0501036_0001188
944 Ga0501036_0002381
945 Ga0501037_0007637
946 Ga0501038_0000669
947 Ga0501039_0001969
948 Ga0501039_0181365
949 Ga0501040_0001622
950 Ga0501040_0015576
951 Ga0501041_0003647
952 Ga0501041_0059035
953 Ga0501042_0047337
954 Ga0501043_0001678
955 Ga0501043_0147572
956 Ga0501046_0003160
957 Ga0501046_0145157
958 Ga0501047_0040618
959 Ga0501048_0003513
960 Ga0501048_0067213
961 Ga0501067_0001344
962 Ga0501068_0000439
963 Ga0501069_0003141
964 Ga0501070_0060961
965 Ga0501070_0104957
966 Ga0501071_0015086
967 Ga0501071_0019187
968 Ga0501072_0000247
969 Ga0501073_0026016
970 Ga0501075_0000797
971 Ga0501075_0064809
972 Ga0501076_0010840
973 Ga0501076_0080307
974 Ga0501076_0217290
975 Ga0501077_0010706
976 Ga0501079_0005087
977 Ga0501079_0122172
978 Ga0501079_0122422
979 Ga0501080_0000018
980 Ga0501081_0003349
981 Ga0501035_0018181
982 Ga0501035_0021783
983 Ga0501035_0142267
984 Ga0501044_0001899
985 Ga0501044_0024708
986 Ga0501044_0066240
987 Ga0501045_0000242
988 Ga0501045_0104012
989 nmdc:mga09592_96562_c1
990 nmdc:mga0qj67_63333_c1
991 nmdc:mga06r32_21881_c1
992 nmdc:mga06r32_411294_c1
993 nmdc:mga06r32_623886_c1
994 nmdc:mga06r32_80990_c1
995 nmdc:mga0n895_19687_c1
996 nmdc:mga0rr50_262196_c1
997 nmdc:mga0a205_292391_c1
998 nmdc:mga0a205_30354_c2
999 nmdc:mga0a205_65472_c1
1000 Ga0500568_0007427
1001 Ga0501084_0002332
1002 Ga0501084_0064895
1003 Ga0501082_0000404
1004 Ga0501082_0118975
1005 Ga0530510_0000156
1006 Ga0530510_0012538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

279

358

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

266

307

0.96

PF12852

Cupin_6

Cupin

43

241

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9609 215 317
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.945 221 315
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9418 221 309
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9414 215 319
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9128 221 307
ID Description Score Start End Superfamily
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9986 269 316 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9842 271 315 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9806 267 318 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9778 273 315 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9594 273 316 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2W4NK05-F1-model_v4 deleted 0.9763 215 320
AF-A0A5R9AZN9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9705 221 306 GO:0003700
GO:0043565
AF-A0A069SXS9-F1-model_v4 deleted 0.9678 224 319
AF-A0A172TL64-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9615 217 316 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A7K1K0S1-F1-model_v4 Helix-turn-helix domain-containing protein 0.9593 222 317 GO:0003700
GO:0043565

Map