F455610

General Info

Members Datasets Scaffolds Average Seq Length
500 238 1000 69

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0502733|Ga0501034_0502733_156_395
Length 79
Sequence MRNTETPEPPARATDVETLAELLHETSIRHGAFEAVTPPHNWWDWYAAYMAARQSGESPDASSAAADRYMAEVKHVLPG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 14
Rhizosphere 84.6
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0502733 3300049571 Bacteria 1126
2 JGI24743J22301_10016958 3300001991 Bacteria 1363
3 JGI24751J29686_10132805 3300002459 Bacteria 526
4 JGI25406J46586_10021921 3300003203 Bacteria 2556
5 JGI25407J50210_10037295 3300003373 Bacteria 1249
6 Ga0070683_100655536 3300005329 Bacteria 1005
7 Ga0070683_102012607 3300005329 Bacteria 555
8 Ga0068869_100439271 3300005334 Bacteria 1080
9 Ga0068869_100548875 3300005334 Bacteria 970
10 Ga0070666_10319354 3300005335 Bacteria 1108
11 Ga0070682_100004276 3300005337 Bacteria 7926
12 Ga0068868_100034172 3300005338 Bacteria 3924
13 Ga0068868_100039372 3300005338 Bacteria 3673
14 Ga0070660_100367782 3300005339 Bacteria 1186
15 Ga0070660_100632795 3300005339 Bacteria 896
16 Ga0070689_101395787 3300005340 Bacteria 633
17 Ga0070687_100757817 3300005343 Unclassified 684
18 Ga0070661_100191988 3300005344 Bacteria 1558
19 Ga0070661_100240818 3300005344 Bacteria 1393
20 Ga0070692_10745007 3300005345 Bacteria 664
21 Ga0070668_100039300 3300005347 Bacteria 3619
22 Ga0070668_100053243 3300005347 Bacteria 3121
23 Ga0070668_100629558 3300005347 Bacteria 941
24 Ga0070668_101873020 3300005347 Bacteria 552
25 Ga0070669_101511519 3300005353 Bacteria 584
26 Ga0070675_100012232 3300005354 Bacteria 6727
27 Ga0070675_100245029 3300005354 Bacteria 1567
28 Ga0070671_100548396 3300005355 Bacteria 997
29 Ga0070671_101243881 3300005355 Bacteria 656
30 Ga0070674_100060770 3300005356 Bacteria 2635
31 Ga0070674_100107874 3300005356 Unclassified 2040
32 Ga0070673_100125235 3300005364 Bacteria 2149
33 Ga0070673_100649265 3300005364 Bacteria 966
34 Ga0070673_101383441 3300005364 Bacteria 662
35 Ga0070688_100341821 3300005365 Bacteria 1093
36 Ga0070659_100010246 3300005366 Bacteria 6894
37 Ga0070667_100205908 3300005367 Bacteria 1747
38 Ga0070667_100315145 3300005367 Bacteria 1411
39 Ga0070703_10277886 3300005406 Bacteria 690
40 Ga0070709_10111139 3300005434 Bacteria 1842
41 Ga0070714_100071706 3300005435 Bacteria 2996
42 Ga0070714_100706637 3300005435 Bacteria 973
43 Ga0070713_100055146 3300005436 Bacteria 3301
44 Ga0070713_101328763 3300005436 Bacteria 697
45 Ga0070710_10679389 3300005437 Bacteria 725
46 Ga0070701_10084627 3300005438 Bacteria 1725
47 Ga0070701_10105986 3300005438 Bacteria 1564
48 Ga0070705_100080582 3300005440 Bacteria 1998
49 Ga0070700_100021473 3300005441 Bacteria 3753
50 Ga0070700_101070925 3300005441 Bacteria 667
51 Ga0070694_100072793 3300005444 Bacteria 2371
52 Ga0070694_100461143 3300005444 Bacteria 1005
53 Ga0070694_101814596 3300005444 Bacteria 520
54 Ga0070708_101699519 3300005445 Bacteria 587
55 Ga0070663_100029419 3300005455 Bacteria 3754
56 Ga0070678_100011859 3300005456 Bacteria 5393
57 Ga0070678_100060155 3300005456 Bacteria 2795
58 Ga0070678_100196580 3300005456 Bacteria 1661
59 Ga0070678_100472283 3300005456 Bacteria 1102
60 Ga0070678_100476079 3300005456 Bacteria 1098
61 Ga0068867_100195657 3300005459 Bacteria 1616
62 Ga0070685_10356315 3300005466 Bacteria 1002
63 Ga0070684_100046838 3300005535 Bacteria 3747
64 Ga0070684_102101035 3300005535 Bacteria 533
65 Ga0070697_100120329 3300005536 Bacteria 2196
66 Ga0068853_100098294 3300005539 Bacteria 2585
67 Ga0068853_100455284 3300005539 Bacteria 1204
68 Ga0068853_100463276 3300005539 Bacteria 1193
69 Ga0070672_101936739 3300005543 Bacteria 530
70 Ga0070695_100006583 3300005545 Bacteria 6864
71 Ga0070695_100428328 3300005545 Bacteria 1009
72 Ga0070695_101257873 3300005545 Bacteria 610
73 Ga0070696_101988393 3300005546 Bacteria 505
74 Ga0070693_100420892 3300005547 Bacteria 931
75 Ga0070665_100084007 3300005548 Bacteria 3189
76 Ga0070665_100297002 3300005548 Unclassified 1618
77 Ga0070665_100454294 3300005548 Bacteria 1291
78 Ga0070704_100235138 3300005549 Bacteria 1497
79 Ga0070704_100635012 3300005549 Bacteria 941
80 Ga0068855_100104481 3300005563 Bacteria 3258
81 Ga0068855_100196475 3300005563 Bacteria 2273
82 Ga0070664_100115716 3300005564 Bacteria 2344
83 Ga0070664_102034146 3300005564 Unclassified 545
84 Ga0068854_100088639 3300005578 Bacteria 2298
85 Ga0068854_100223370 3300005578 Bacteria 1491
86 Ga0068856_100038895 3300005614 Bacteria 4670
87 Ga0068856_100086643 3300005614 Bacteria 3112
88 Ga0068856_101270048 3300005614 Bacteria 752
89 Ga0068856_101921375 3300005614 Bacteria 603
90 Ga0070702_100097491 3300005615 Bacteria 1797
91 Ga0070702_100098931 3300005615 Bacteria 1785
92 Ga0068852_100055156 3300005616 Bacteria 3429
93 Ga0068852_100492014 3300005616 Bacteria 1220
94 Ga0068852_100693305 3300005616 Bacteria 1028
95 Ga0068852_101535569 3300005616 Bacteria 688
96 Ga0068859_100308141 3300005617 Bacteria 1677
97 Ga0068859_101444512 3300005617 Bacteria 759
98 Ga0068859_101463086 3300005617 Bacteria 754
99 Ga0068864_100007191 3300005618 Bacteria 9145
100 Ga0068864_100251699 3300005618 Bacteria 1640
101 Ga0068866_10064570 3300005718 Bacteria 1912
102 Ga0068866_10168247 3300005718 Bacteria 1284
103 Ga0068861_100181028 3300005719 Bacteria 1754
104 Ga0068861_100209507 3300005719 Bacteria 1641
105 Ga0068861_100285937 3300005719 Bacteria 1422
106 Ga0068861_101040022 3300005719 Unclassified 784
107 Ga0068851_10052306 3300005834 Bacteria 2077
108 Ga0068851_11073671 3300005834 Bacteria 510
109 Ga0068870_10128679 3300005840 Bacteria 1468
110 Ga0068870_11017135 3300005840 Bacteria 592
111 Ga0068863_100036250 3300005841 Bacteria 4698
112 Ga0068863_100147869 3300005841 Bacteria 2248
113 Ga0068863_101752848 3300005841 Bacteria 631
114 Ga0068858_100511485 3300005842 Bacteria 1161
115 Ga0068860_100186041 3300005843 Bacteria 2009
116 Ga0068860_100919861 3300005843 Unclassified 891
117 Ga0068862_100081465 3300005844 Bacteria 2808
118 Ga0068862_100436480 3300005844 Bacteria 1232
119 Ga0068862_102630963 3300005844 Bacteria 515
120 Ga0081538_10000064 3300005981 Bacteria 99059
121 Ga0081538_10000561 3300005981 Bacteria 41243
122 Ga0081538_10001237 3300005981 Bacteria 26766
123 Ga0081538_10003565 3300005981 Bacteria 14644
124 Ga0081540_1000899 3300005983 Bacteria 26887
125 Ga0081540_1064370 3300005983 Bacteria 1730
126 Ga0081539_10001782 3300005985 Bacteria 34184
127 Ga0070717_10224064 3300006028 Bacteria 1654
128 Ga0070717_11047454 3300006028 Bacteria 743
129 Ga0070717_11702720 3300006028 Bacteria 571
130 Ga0075432_10103786 3300006058 Bacteria 1053
131 Ga0075432_10219463 3300006058 Bacteria 760
132 Ga0075432_10411794 3300006058 Bacteria 586
133 Ga0070716_100003932 3300006173 Bacteria 7050
134 Ga0070712_100053031 3300006175 Bacteria 2830
135 Ga0070712_100214624 3300006175 Bacteria 1519
136 Ga0068871_100562285 3300006358 Bacteria 1034
137 Ga0068871_101083456 3300006358 Bacteria 749
138 Ga0068871_102063475 3300006358 Bacteria 543
139 Ga0075433_10451037 3300006852 Bacteria 1134
140 Ga0075433_11092806 3300006852 Bacteria 694
141 Ga0075434_101206516 3300006871 Bacteria 769
142 Ga0068865_100057445 3300006881 Bacteria 2714
143 Ga0068865_100945315 3300006881 Bacteria 752
144 Ga0075436_100212168 3300006914 Bacteria 1373
145 Ga0097620_100308149 3300006931 Bacteria 1677
146 Ga0097620_101444449 3300006931 Bacteria 759
147 Ga0097620_101463026 3300006931 Bacteria 754
148 Ga0075435_100028064 3300007076 Bacteria 4411
149 Ga0105244_10434553 3300009036 Bacteria 604
150 Ga0105240_10097667 3300009093 Bacteria 3579
151 Ga0105240_10675095 3300009093 Bacteria 1130
152 Ga0105240_12387260 3300009093 Bacteria 547
153 Ga0111539_10307440 3300009094 Bacteria 1845
154 Ga0111539_10618751 3300009094 Bacteria 1261
155 Ga0111539_10712208 3300009094 Bacteria 1168
156 Ga0111539_12213550 3300009094 Bacteria 638
157 Ga0105245_10008765 3300009098 Bacteria 8822
158 Ga0105245_10036775 3300009098 Bacteria 4351
159 Ga0105245_10061897 3300009098 Bacteria 3375
160 Ga0105245_10723668 3300009098 Bacteria 1030
161 Ga0105245_12252170 3300009098 Bacteria 599
162 Ga0105245_12717715 3300009098 Bacteria 548
163 Ga0105247_11262087 3300009101 Bacteria 591
164 Ga0105243_10012210 3300009148 Bacteria 6494
165 Ga0105243_10061636 3300009148 Bacteria 3001
166 Ga0105243_10119360 3300009148 Bacteria 2220
167 Ga0105243_12802178 3300009148 Bacteria 528
168 Ga0105241_10179338 3300009174 Bacteria 1756
169 Ga0105241_10330495 3300009174 Bacteria 1317
170 Ga0105241_11387001 3300009174 Bacteria 672
171 Ga0105241_12106869 3300009174 Bacteria 557
172 Ga0105242_10243188 3300009176 Bacteria 1619
173 Ga0105242_10560189 3300009176 Bacteria 1097
174 Ga0105242_10594053 3300009176 Bacteria 1068
175 Ga0105242_10977862 3300009176 Bacteria 852
176 Ga0105242_11860606 3300009176 Bacteria 641
177 Ga0105248_10163966 3300009177 Bacteria 2506
178 Ga0105248_11096846 3300009177 Bacteria 900
179 Ga0105248_12927985 3300009177 Bacteria 544
180 Ga0105237_10221087 3300009545 Bacteria 1894
181 Ga0105237_10760397 3300009545 Bacteria 975
182 Ga0105238_10125123 3300009551 Bacteria 2550
183 Ga0105238_10786066 3300009551 Bacteria 967
184 Ga0105238_11824929 3300009551 Bacteria 640
185 Ga0105238_11890686 3300009551 Bacteria 630
186 Ga0105249_10023116 3300009553 Bacteria 5575
187 Ga0105249_10225952 3300009553 Unclassified 1844
188 Ga0105239_10015247 3300010375 Bacteria 8516
189 Ga0105239_10183202 3300010375 Bacteria 2343
190 Ga0105239_10197691 3300010375 Bacteria 2252
191 Ga0105239_11644290 3300010375 Unclassified 743
192 Ga0105239_11983576 3300010375 Bacteria 676
193 Ga0105246_10007986 3300011119 Bacteria 6496
194 Ga0157370_10111428 3300013104 Bacteria 2558
195 Ga0157369_11608489 3300013105 Bacteria 661
196 Ga0157374_10030391 3300013296 Bacteria 4904
197 Ga0157374_10571259 3300013296 Bacteria 1139
198 Ga0157374_12268283 3300013296 Bacteria 570
199 Ga0157378_10014287 3300013297 Bacteria 6951
200 Ga0157378_10830727 3300013297 Bacteria 951
201 Ga0163162_10066548 3300013306 Bacteria 3652
202 Ga0163162_10185335 3300013306 Bacteria 2208
203 Ga0163162_11280657 3300013306 Bacteria 833
204 Ga0163162_11873209 3300013306 Bacteria 686
205 Ga0163162_12164452 3300013306 Bacteria 638
206 Ga0157372_10030762 3300013307 Bacteria 5874
207 Ga0157372_10245991 3300013307 Bacteria 2075
208 Ga0157372_10518664 3300013307 Archaea 1389
209 Ga0157372_11866076 3300013307 Bacteria 691
210 Ga0157375_10037427 3300013308 Bacteria 4649
211 Ga0157375_10499051 3300013308 Unclassified 1381
212 Ga0157375_10520611 3300013308 Bacteria 1353
213 Ga0157375_10563478 3300013308 Bacteria 1300
214 Ga0157375_11965223 3300013308 Bacteria 695
215 Ga0157375_12132714 3300013308 Bacteria 667
216 Ga0163163_10125798 3300014325 Bacteria 2601
217 Ga0163163_10451485 3300014325 Bacteria 1346
218 Ga0163163_10582149 3300014325 Bacteria 1182
219 Ga0163163_10661252 3300014325 Bacteria 1108
220 Ga0163163_11224877 3300014325 Bacteria 813
221 Ga0163163_11692319 3300014325 Bacteria 693
222 Ga0157380_10155919 3300014326 Bacteria 1979
223 Ga0157380_10158272 3300014326 Bacteria 1966
224 Ga0157377_10003613 3300014745 Bacteria 7004
225 Ga0157377_10169833 3300014745 Unclassified 1363
226 Ga0157377_10266403 3300014745 Unclassified 1117
227 Ga0157377_11618101 3300014745 Bacteria 519
228 Ga0157379_10721720 3300014968 Bacteria 937
229 Ga0157376_10079947 3300014969 Bacteria 2803
230 Ga0157376_10104624 3300014969 Bacteria 2481
231 Ga0157376_10171385 3300014969 Bacteria 1977
232 Ga0163161_10117884 3300017792 Bacteria 1992
233 Ga0163161_10897419 3300017792 Bacteria 751
234 Ga0197907_11434645 3300020069 Bacteria 1200
235 Ga0206356_10255899 3300020070 Bacteria 678
236 Ga0207692_10052412 3300025898 Bacteria 2073
237 Ga0207642_10854892 3300025899 Bacteria 581
238 Ga0207710_10299484 3300025900 Bacteria 812
239 Ga0207688_10010026 3300025901 Bacteria 5152
240 Ga0207688_10011602 3300025901 Bacteria 4793
241 Ga0207680_10198735 3300025903 Bacteria 1365
242 Ga0207647_10112212 3300025904 Bacteria 1611
243 Ga0207699_10023840 3300025906 Bacteria 3336
244 Ga0207645_10636916 3300025907 Bacteria 724
245 Ga0207645_11024625 3300025907 Bacteria 558
246 Ga0207645_11208684 3300025907 Bacteria 507
247 Ga0207654_10038903 3300025911 Bacteria 2672
248 Ga0207654_11320209 3300025911 Bacteria 526
249 Ga0207695_10727015 3300025913 Bacteria 873
250 Ga0207671_11468951 3300025914 Bacteria 527
251 Ga0207693_10014424 3300025915 Bacteria 6355
252 Ga0207693_10119486 3300025915 Bacteria 2070
253 Ga0207663_11179838 3300025916 Bacteria 616
254 Ga0207662_10046833 3300025918 Bacteria 2560
255 Ga0207657_10075401 3300025919 Bacteria 2846
256 Ga0207657_10097558 3300025919 Bacteria 2443
257 Ga0207649_10034260 3300025920 Bacteria 3041
258 Ga0207649_10961554 3300025920 Bacteria 671
259 Ga0207681_10243662 3300025923 Bacteria 1400
260 Ga0207694_10370004 3300025924 Bacteria 1189
261 Ga0207650_11747024 3300025925 Bacteria 527
262 Ga0207659_10139596 3300025926 Bacteria 1880
263 Ga0207687_10020634 3300025927 Bacteria 4372
264 Ga0207687_11008307 3300025927 Viruses 714
265 Ga0207700_10271944 3300025928 Bacteria 1454
266 Ga0207664_11949610 3300025929 Bacteria 510
267 Ga0207644_11027891 3300025931 Bacteria 692
268 Ga0207690_10868748 3300025932 Bacteria 747
269 Ga0207706_10034554 3300025933 Bacteria 4497
270 Ga0207706_10767179 3300025933 Bacteria 821
271 Ga0207706_11337366 3300025933 Bacteria 591
272 Ga0207686_10307360 3300025934 Bacteria 1180
273 Ga0207686_11122665 3300025934 Bacteria 642
274 Ga0207709_10017698 3300025935 Bacteria 3981
275 Ga0207709_10098137 3300025935 Bacteria 1931
276 Ga0207709_11243370 3300025935 Bacteria 614
277 Ga0207670_10498405 3300025936 Bacteria 988
278 Ga0207669_10024539 3300025937 Bacteria 3242
279 Ga0207669_10345304 3300025937 Bacteria 1148
280 Ga0207669_10734854 3300025937 Bacteria 814
281 Ga0207669_11484699 3300025937 Bacteria 578
282 Ga0207704_10023372 3300025938 Bacteria 3330
283 Ga0207704_11080719 3300025938 Bacteria 681
284 Ga0207704_11161739 3300025938 Bacteria 657
285 Ga0207704_11742353 3300025938 Bacteria 536
286 Ga0207665_10000295 3300025939 Bacteria 34463
287 Ga0207665_11574513 3300025939 Bacteria 521
288 Ga0207691_10125139 3300025940 Bacteria 2275
289 Ga0207711_10113952 3300025941 Bacteria 2407
290 Ga0207711_10674369 3300025941 Bacteria 964
291 Ga0207689_10121240 3300025942 Bacteria 2151
292 Ga0207689_10736350 3300025942 Bacteria 832
293 Ga0207689_11482346 3300025942 Bacteria 567
294 Ga0207661_10005822 3300025944 Bacteria 8694
295 Ga0207661_10756257 3300025944 Bacteria 895
296 Ga0207661_11111707 3300025944 Bacteria 728
297 Ga0207679_10062821 3300025945 Bacteria 2769
298 Ga0207667_10386062 3300025949 Bacteria 1427
299 Ga0207667_10439768 3300025949 Bacteria 1326
300 Ga0207651_10278217 3300025960 Bacteria 1382
301 Ga0207651_10356391 3300025960 Bacteria 1233
302 Ga0207668_10031937 3300025972 Bacteria 3474
303 Ga0207668_10050454 3300025972 Bacteria 2868
304 Ga0207668_10234246 3300025972 Bacteria 1482
305 Ga0207668_10259214 3300025972 Bacteria 1416
306 Ga0207668_11179755 3300025972 Bacteria 688
307 Ga0207640_10730154 3300025981 Bacteria 852
308 Ga0207658_10020525 3300025986 Bacteria 4575
309 Ga0207677_10045305 3300026023 Bacteria 2937
310 Ga0207703_10323193 3300026035 Bacteria 1413
311 Ga0207703_10420423 3300026035 Bacteria 1244
312 Ga0207639_10579591 3300026041 Bacteria 1033
313 Ga0207639_11153421 3300026041 Bacteria 727
314 Ga0207639_11968758 3300026041 Bacteria 545
315 Ga0207678_10034847 3300026067 Bacteria 4383
316 Ga0207678_10537966 3300026067 Bacteria 1021
317 Ga0207678_10592101 3300026067 Bacteria 972
318 Ga0207708_10000898 3300026075 Bacteria 22330
319 Ga0207702_10789679 3300026078 Bacteria 938
320 Ga0207702_11319656 3300026078 Bacteria 716
321 Ga0207702_11809095 3300026078 Bacteria 603
322 Ga0207641_10165628 3300026088 Bacteria 2013
323 Ga0207641_11411589 3300026088 Bacteria 697
324 Ga0207648_10149941 3300026089 Bacteria 2057
325 Ga0207648_10455133 3300026089 Bacteria 1166
326 Ga0207648_11257721 3300026089 Bacteria 695
327 Ga0207676_10024152 3300026095 Bacteria 4496
328 Ga0207676_10584119 3300026095 Bacteria 1071
329 Ga0207676_10868239 3300026095 Bacteria 883
330 Ga0207676_11885801 3300026095 Bacteria 596
331 Ga0207675_100119222 3300026118 Bacteria 2496
332 Ga0207675_100218762 3300026118 Bacteria 1834
333 Ga0207675_100380053 3300026118 Bacteria 1389
334 Ga0207675_100710725 3300026118 Bacteria 1014
335 Ga0207683_10088646 3300026121 Bacteria 2753
336 Ga0207683_10126425 3300026121 Bacteria 2298
337 Ga0207683_10457645 3300026121 Bacteria 1177
338 Ga0207683_10470580 3300026121 Bacteria 1159
339 Ga0207683_10549429 3300026121 Bacteria 1068
340 Ga0207698_10001490 3300026142 Bacteria 13624
341 Ga0207698_10055303 3300026142 Bacteria 3058
342 Ga0207698_10692822 3300026142 Bacteria 1013
343 Ga0207698_11148493 3300026142 Bacteria 790
344 Ga0207428_10246134 3300027907 Bacteria 1334
345 Ga0207428_10711865 3300027907 Bacteria 717
346 Ga0268266_10423187 3300028379 Bacteria 1262
347 Ga0268266_10432562 3300028379 Bacteria 1249
348 Ga0268266_11656196 3300028379 Bacteria 615
349 Ga0268265_10249297 3300028380 Bacteria 1572
350 Ga0268265_10724992 3300028380 Bacteria 963
351 Ga0268264_10845332 3300028381 Unclassified 916
352 Ga0268264_10902103 3300028381 Bacteria 887
353 Ga0265318_10188059 3300028577 Bacteria 756
354 Ga0265328_10420436 3300031239 Bacteria 526
355 Ga0265320_10546560 3300031240 Bacteria 512
356 Ga0265325_10021575 3300031241 Bacteria 3536
357 Ga0307405_10280416 3300031731 Bacteria 1254
358 Ga0307405_10610166 3300031731 Bacteria 892
359 Ga0307409_101781806 3300031995 Bacteria 645
360 Ga0373938_0048457 3300034957 Bacteria 964
361 Ga0373928_0004556 3300035084 Bacteria 2642
362 Ga0373929_0025288 3300035085 Bacteria 1232
363 Ga0373949_0253073 3300035090 Bacteria 545
364 Ga0373939_0112864 3300035114 Bacteria 949
365 Ga0373943_0562617 3300035170 Bacteria 670
366 Ga0373961_0065693 3300035241 Bacteria 1111
367 Ga0373961_0356815 3300035241 Bacteria 552
368 Ga0373962_0338921 3300035242 Bacteria 541
369 Ga0373931_0161252 3300035691 Bacteria 1315
370 Ga0395900_0496058 3300037418 Bacteria 1172
371 Ga0395900_0617305 3300037418 Bacteria 1023
372 Ga0395898_0110026 3300037466 Bacteria 2641
373 Ga0395898_0375801 3300037466 Bacteria 1355
374 Ga0395898_1843870 3300037466 Bacteria 525
375 Ga0395905_0179563 3300037471 Unclassified 1987
376 Ga0395905_0678152 3300037471 Bacteria 933
377 Ga0395901_0033341 3300038443 Bacteria 5316
378 Ga0395901_0592880 3300038443 Bacteria 1118
379 Ga0395901_0595806 3300038443 Bacteria 1115
380 Ga0395901_1245379 3300038443 Bacteria 708
381 Ga0395901_1620211 3300038443 Bacteria 600
382 Ga0451802_1289627 3300041460 Bacteria 514
383 Ga0451853_2631757 3300041512 Bacteria 928
384 Ga0439448_0100295 3300042005 Bacteria 984
385 Ga0439444_0064292 3300042437 Bacteria 773
386 Ga0439464_0253055 3300042439 Bacteria 569
387 Ga0439460_0017268 3300042461 Bacteria 1932
388 Ga0466972_0211469 3300044658 Unclassified 908
389 Ga0466963_0217633 3300044694 Bacteria 1337
390 Ga0466963_0278661 3300044694 Bacteria 1175
391 Ga0466964_0747073 3300044706 Bacteria 549
392 Ga0466971_0087651 3300044719 Bacteria 1423
393 Ga0466970_0560447 3300044765 Unclassified 661
394 Ga0466957_0577421 3300044842 Bacteria 785
395 Ga0466960_0400349 3300044901 Bacteria 791
396 Ga0466959_0603711 3300045049 Bacteria 738
397 Ga0466967_0007798 3300045976 Bacteria 7775
398 Ga0466967_0387350 3300045976 Bacteria 1358
399 Ga0466967_0625631 3300045976 Bacteria 1063
400 Ga0466967_0669973 3300045976 Bacteria 1027
401 Ga0466967_0859769 3300045976 Bacteria 901
402 Ga0495603_0164815 3300046455 Bacteria 1285
403 Ga0495629_0844745 3300046459 Bacteria 602
404 Ga0495653_0871500 3300046463 Unclassified 538
405 Ga0495582_0387082 3300046473 Bacteria 806
406 Ga0495594_0058507 3300046499 Bacteria 2130
407 Ga0495596_0124888 3300046500 Bacteria 999
408 Ga0495608_0187372 3300046511 Bacteria 1307
409 Ga0495667_0215417 3300046559 Bacteria 1226
410 Ga0495623_0066787 3300046679 Bacteria 2246
411 Ga0495658_0367027 3300046683 Bacteria 916
412 Ga0495658_0982511 3300046683 Bacteria 539
413 Ga0495624_0425060 3300046690 Bacteria 797
414 Ga0495581_0243888 3300047315 Bacteria 1051
415 Ga0495679_210868 3300047446 Bacteria 509
416 Ga0496100_0042868 3300048903 Bacteria 2892
417 Ga0496100_0223736 3300048903 Bacteria 1382
418 Ga0496101_0019953 3300048904 Bacteria 4584
419 Ga0496101_0098931 3300048904 Bacteria 2180
420 Ga0496101_0220720 3300048904 Unclassified 1471
421 Ga0496102_0003150 3300048905 Bacteria 13987
422 Ga0496102_0008261 3300048905 Bacteria 8916
423 Ga0496102_0284899 3300048905 Bacteria 1557
424 Ga0496102_0320014 3300048905 Bacteria 1461
425 Ga0496102_0335807 3300048905 Bacteria 1423
426 Ga0496102_0560493 3300048905 Bacteria 1065
427 Ga0496103_0017038 3300048906 Bacteria 4344
428 Ga0496103_0035226 3300048906 Bacteria 3064
429 Ga0496103_0808415 3300048906 Bacteria 591
430 Ga0496104_0001187 3300048907 Bacteria 22383
431 Ga0496104_0055617 3300048907 Bacteria 3742
432 Ga0496104_0195379 3300048907 Unclassified 1935
433 Ga0496104_0888481 3300048907 Bacteria 796
434 Ga0496104_0919922 3300048907 Bacteria 779
435 Ga0496105_0006154 3300048908 Bacteria 9201
436 Ga0496105_0066011 3300048908 Bacteria 2986
437 Ga0496105_0557594 3300048908 Bacteria 893
438 Ga0496105_0782413 3300048908 Bacteria 727
439 Ga0496106_0021433 3300048909 Bacteria 4798
440 Ga0496106_0448439 3300048909 Bacteria 1036
441 Ga0496106_0738872 3300048909 Bacteria 783
442 Ga0496107_0333113 3300048910 Bacteria 1129
443 Ga0496108_0004215 3300048911 Bacteria 11583
444 Ga0496108_0009046 3300048911 Bacteria 8068
445 Ga0496108_0068465 3300048911 Bacteria 2995
446 Ga0496108_0184497 3300048911 Bacteria 1807
447 Ga0496108_0391638 3300048911 Bacteria 1213
448 Ga0496108_1411234 3300048911 Bacteria 582
449 Ga0496109_0009562 3300048912 Bacteria 8266
450 Ga0496109_0053145 3300048912 Bacteria 3693
451 Ga0496109_0081680 3300048912 Bacteria 2978
452 Ga0496109_0084254 3300048912 Bacteria 2932
453 Ga0496109_0263671 3300048912 Bacteria 1623
454 Ga0496109_0324077 3300048912 Bacteria 1454
455 Ga0496109_0804153 3300048912 Bacteria 878
456 Ga0496110_0000668 3300048913 Bacteria 23526
457 Ga0496110_0046166 3300048913 Bacteria 3810
458 Ga0496110_0264122 3300048913 Bacteria 1567
459 Ga0496110_0311974 3300048913 Unclassified 1432
460 Ga0496110_0891487 3300048913 Bacteria 795
461 Ga0496111_0012127 3300048914 Bacteria 5829
462 Ga0496111_0023969 3300048914 Bacteria 4290
463 Ga0496111_0053997 3300048914 Bacteria 2903
464 Ga0496112_0009100 3300048915 Bacteria 8925
465 Ga0496112_0047982 3300048915 Bacteria 4188
466 Ga0496112_0624305 3300048915 Bacteria 1008
467 Ga0496112_0858717 3300048915 Bacteria 831
468 Ga0496112_1715762 3300048915 Bacteria 540
469 Ga0496113_0023471 3300048916 Bacteria 4373
470 Ga0496113_0054946 3300048916 Bacteria 2983
471 Ga0496113_0182972 3300048916 Bacteria 1661
472 Ga0496114_0019187 3300048917 Bacteria 5540
473 Ga0496114_0062869 3300048917 Bacteria 3108
474 Ga0496114_0065914 3300048917 Bacteria 3035
475 Ga0496114_0336332 3300048917 Unclassified 1335
476 Ga0496114_0410587 3300048917 Bacteria 1199
477 Ga0496114_0457735 3300048917 Bacteria 1129
478 Ga0496114_0584487 3300048917 Bacteria 985
479 Ga0496115_0056499 3300048918 Bacteria 3155
480 Ga0496115_0097036 3300048918 Bacteria 2414
481 Ga0496115_0148321 3300048918 Bacteria 1936
482 Ga0496115_0424070 3300048918 Bacteria 1077
483 Ga0496115_0553715 3300048918 Bacteria 919
484 Ga0496115_0809351 3300048918 Bacteria 729
485 Ga0496124_0151867 3300048927 Bacteria 1816
486 Ga0496124_0502381 3300048927 Bacteria 813
487 Ga0496124_0582209 3300048927 Bacteria 732
488 Ga0496126_0383862 3300048929 Bacteria 1143
489 Ga0501067_0222878 3300049583 Bacteria 1050
490 Ga0501081_0549552 3300049743 Bacteria 863
491 nmdc:mga03n38_189367_c1 3300050490 Bacteria 1059
492 nmdc:mga08y16_1202684_c1 3300050511 Bacteria 728
493 nmdc:mga08y16_1368957_c1 3300050511 Bacteria 672
494 nmdc:mga08y16_152332_c1 3300050511 Bacteria 2403
495 nmdc:mga08y16_610775_c1 3300050511 Bacteria 1098
496 nmdc:mga0n895_44849_c1 3300050512 Bacteria 4312
497 nmdc:mga08x19_263614_c1 3300050514 Bacteria 1192
498 nmdc:mga0a205_76319_c1 3300050515 Bacteria 3238
499 Ga0500651_0287328 3300053093 Bacteria 947
500 Ga0466962_0062394 3300061719 Bacteria 1779
501 Ga0501034_0502733
502 JGI24743J22301_10016958
503 JGI24751J29686_10132805
504 JGI25406J46586_10021921
505 JGI25407J50210_10037295
506 Ga0070683_100655536
507 Ga0070683_102012607
508 Ga0068869_100439271
509 Ga0068869_100548875
510 Ga0070666_10319354
511 Ga0070682_100004276
512 Ga0068868_100034172
513 Ga0068868_100039372
514 Ga0070660_100367782
515 Ga0070660_100632795
516 Ga0070689_101395787
517 Ga0070687_100757817
518 Ga0070661_100191988
519 Ga0070661_100240818
520 Ga0070692_10745007
521 Ga0070668_100039300
522 Ga0070668_100053243
523 Ga0070668_100629558
524 Ga0070668_101873020
525 Ga0070669_101511519
526 Ga0070675_100012232
527 Ga0070675_100245029
528 Ga0070671_100548396
529 Ga0070671_101243881
530 Ga0070674_100060770
531 Ga0070674_100107874
532 Ga0070673_100125235
533 Ga0070673_100649265
534 Ga0070673_101383441
535 Ga0070688_100341821
536 Ga0070659_100010246
537 Ga0070667_100205908
538 Ga0070667_100315145
539 Ga0070703_10277886
540 Ga0070709_10111139
541 Ga0070714_100071706
542 Ga0070714_100706637
543 Ga0070713_100055146
544 Ga0070713_101328763
545 Ga0070710_10679389
546 Ga0070701_10084627
547 Ga0070701_10105986
548 Ga0070705_100080582
549 Ga0070700_100021473
550 Ga0070700_101070925
551 Ga0070694_100072793
552 Ga0070694_100461143
553 Ga0070694_101814596
554 Ga0070708_101699519
555 Ga0070663_100029419
556 Ga0070678_100011859
557 Ga0070678_100060155
558 Ga0070678_100196580
559 Ga0070678_100472283
560 Ga0070678_100476079
561 Ga0068867_100195657
562 Ga0070685_10356315
563 Ga0070684_100046838
564 Ga0070684_102101035
565 Ga0070697_100120329
566 Ga0068853_100098294
567 Ga0068853_100455284
568 Ga0068853_100463276
569 Ga0070672_101936739
570 Ga0070695_100006583
571 Ga0070695_100428328
572 Ga0070695_101257873
573 Ga0070696_101988393
574 Ga0070693_100420892
575 Ga0070665_100084007
576 Ga0070665_100297002
577 Ga0070665_100454294
578 Ga0070704_100235138
579 Ga0070704_100635012
580 Ga0068855_100104481
581 Ga0068855_100196475
582 Ga0070664_100115716
583 Ga0070664_102034146
584 Ga0068854_100088639
585 Ga0068854_100223370
586 Ga0068856_100038895
587 Ga0068856_100086643
588 Ga0068856_101270048
589 Ga0068856_101921375
590 Ga0070702_100097491
591 Ga0070702_100098931
592 Ga0068852_100055156
593 Ga0068852_100492014
594 Ga0068852_100693305
595 Ga0068852_101535569
596 Ga0068859_100308141
597 Ga0068859_101444512
598 Ga0068859_101463086
599 Ga0068864_100007191
600 Ga0068864_100251699
601 Ga0068866_10064570
602 Ga0068866_10168247
603 Ga0068861_100181028
604 Ga0068861_100209507
605 Ga0068861_100285937
606 Ga0068861_101040022
607 Ga0068851_10052306
608 Ga0068851_11073671
609 Ga0068870_10128679
610 Ga0068870_11017135
611 Ga0068863_100036250
612 Ga0068863_100147869
613 Ga0068863_101752848
614 Ga0068858_100511485
615 Ga0068860_100186041
616 Ga0068860_100919861
617 Ga0068862_100081465
618 Ga0068862_100436480
619 Ga0068862_102630963
620 Ga0081538_10000064
621 Ga0081538_10000561
622 Ga0081538_10001237
623 Ga0081538_10003565
624 Ga0081540_1000899
625 Ga0081540_1064370
626 Ga0081539_10001782
627 Ga0070717_10224064
628 Ga0070717_11047454
629 Ga0070717_11702720
630 Ga0075432_10103786
631 Ga0075432_10219463
632 Ga0075432_10411794
633 Ga0070716_100003932
634 Ga0070712_100053031
635 Ga0070712_100214624
636 Ga0068871_100562285
637 Ga0068871_101083456
638 Ga0068871_102063475
639 Ga0075433_10451037
640 Ga0075433_11092806
641 Ga0075434_101206516
642 Ga0068865_100057445
643 Ga0068865_100945315
644 Ga0075436_100212168
645 Ga0097620_100308149
646 Ga0097620_101444449
647 Ga0097620_101463026
648 Ga0075435_100028064
649 Ga0105244_10434553
650 Ga0105240_10097667
651 Ga0105240_10675095
652 Ga0105240_12387260
653 Ga0111539_10307440
654 Ga0111539_10618751
655 Ga0111539_10712208
656 Ga0111539_12213550
657 Ga0105245_10008765
658 Ga0105245_10036775
659 Ga0105245_10061897
660 Ga0105245_10723668
661 Ga0105245_12252170
662 Ga0105245_12717715
663 Ga0105247_11262087
664 Ga0105243_10012210
665 Ga0105243_10061636
666 Ga0105243_10119360
667 Ga0105243_12802178
668 Ga0105241_10179338
669 Ga0105241_10330495
670 Ga0105241_11387001
671 Ga0105241_12106869
672 Ga0105242_10243188
673 Ga0105242_10560189
674 Ga0105242_10594053
675 Ga0105242_10977862
676 Ga0105242_11860606
677 Ga0105248_10163966
678 Ga0105248_11096846
679 Ga0105248_12927985
680 Ga0105237_10221087
681 Ga0105237_10760397
682 Ga0105238_10125123
683 Ga0105238_10786066
684 Ga0105238_11824929
685 Ga0105238_11890686
686 Ga0105249_10023116
687 Ga0105249_10225952
688 Ga0105239_10015247
689 Ga0105239_10183202
690 Ga0105239_10197691
691 Ga0105239_11644290
692 Ga0105239_11983576
693 Ga0105246_10007986
694 Ga0157370_10111428
695 Ga0157369_11608489
696 Ga0157374_10030391
697 Ga0157374_10571259
698 Ga0157374_12268283
699 Ga0157378_10014287
700 Ga0157378_10830727
701 Ga0163162_10066548
702 Ga0163162_10185335
703 Ga0163162_11280657
704 Ga0163162_11873209
705 Ga0163162_12164452
706 Ga0157372_10030762
707 Ga0157372_10245991
708 Ga0157372_10518664
709 Ga0157372_11866076
710 Ga0157375_10037427
711 Ga0157375_10499051
712 Ga0157375_10520611
713 Ga0157375_10563478
714 Ga0157375_11965223
715 Ga0157375_12132714
716 Ga0163163_10125798
717 Ga0163163_10451485
718 Ga0163163_10582149
719 Ga0163163_10661252
720 Ga0163163_11224877
721 Ga0163163_11692319
722 Ga0157380_10155919
723 Ga0157380_10158272
724 Ga0157377_10003613
725 Ga0157377_10169833
726 Ga0157377_10266403
727 Ga0157377_11618101
728 Ga0157379_10721720
729 Ga0157376_10079947
730 Ga0157376_10104624
731 Ga0157376_10171385
732 Ga0163161_10117884
733 Ga0163161_10897419
734 Ga0197907_11434645
735 Ga0206356_10255899
736 Ga0207692_10052412
737 Ga0207642_10854892
738 Ga0207710_10299484
739 Ga0207688_10010026
740 Ga0207688_10011602
741 Ga0207680_10198735
742 Ga0207647_10112212
743 Ga0207699_10023840
744 Ga0207645_10636916
745 Ga0207645_11024625
746 Ga0207645_11208684
747 Ga0207654_10038903
748 Ga0207654_11320209
749 Ga0207695_10727015
750 Ga0207671_11468951
751 Ga0207693_10014424
752 Ga0207693_10119486
753 Ga0207663_11179838
754 Ga0207662_10046833
755 Ga0207657_10075401
756 Ga0207657_10097558
757 Ga0207649_10034260
758 Ga0207649_10961554
759 Ga0207681_10243662
760 Ga0207694_10370004
761 Ga0207650_11747024
762 Ga0207659_10139596
763 Ga0207687_10020634
764 Ga0207687_11008307
765 Ga0207700_10271944
766 Ga0207664_11949610
767 Ga0207644_11027891
768 Ga0207690_10868748
769 Ga0207706_10034554
770 Ga0207706_10767179
771 Ga0207706_11337366
772 Ga0207686_10307360
773 Ga0207686_11122665
774 Ga0207709_10017698
775 Ga0207709_10098137
776 Ga0207709_11243370
777 Ga0207670_10498405
778 Ga0207669_10024539
779 Ga0207669_10345304
780 Ga0207669_10734854
781 Ga0207669_11484699
782 Ga0207704_10023372
783 Ga0207704_11080719
784 Ga0207704_11161739
785 Ga0207704_11742353
786 Ga0207665_10000295
787 Ga0207665_11574513
788 Ga0207691_10125139
789 Ga0207711_10113952
790 Ga0207711_10674369
791 Ga0207689_10121240
792 Ga0207689_10736350
793 Ga0207689_11482346
794 Ga0207661_10005822
795 Ga0207661_10756257
796 Ga0207661_11111707
797 Ga0207679_10062821
798 Ga0207667_10386062
799 Ga0207667_10439768
800 Ga0207651_10278217
801 Ga0207651_10356391
802 Ga0207668_10031937
803 Ga0207668_10050454
804 Ga0207668_10234246
805 Ga0207668_10259214
806 Ga0207668_11179755
807 Ga0207640_10730154
808 Ga0207658_10020525
809 Ga0207677_10045305
810 Ga0207703_10323193
811 Ga0207703_10420423
812 Ga0207639_10579591
813 Ga0207639_11153421
814 Ga0207639_11968758
815 Ga0207678_10034847
816 Ga0207678_10537966
817 Ga0207678_10592101
818 Ga0207708_10000898
819 Ga0207702_10789679
820 Ga0207702_11319656
821 Ga0207702_11809095
822 Ga0207641_10165628
823 Ga0207641_11411589
824 Ga0207648_10149941
825 Ga0207648_10455133
826 Ga0207648_11257721
827 Ga0207676_10024152
828 Ga0207676_10584119
829 Ga0207676_10868239
830 Ga0207676_11885801
831 Ga0207675_100119222
832 Ga0207675_100218762
833 Ga0207675_100380053
834 Ga0207675_100710725
835 Ga0207683_10088646
836 Ga0207683_10126425
837 Ga0207683_10457645
838 Ga0207683_10470580
839 Ga0207683_10549429
840 Ga0207698_10001490
841 Ga0207698_10055303
842 Ga0207698_10692822
843 Ga0207698_11148493
844 Ga0207428_10246134
845 Ga0207428_10711865
846 Ga0268266_10423187
847 Ga0268266_10432562
848 Ga0268266_11656196
849 Ga0268265_10249297
850 Ga0268265_10724992
851 Ga0268264_10845332
852 Ga0268264_10902103
853 Ga0265318_10188059
854 Ga0265328_10420436
855 Ga0265320_10546560
856 Ga0265325_10021575
857 Ga0307405_10280416
858 Ga0307405_10610166
859 Ga0307409_101781806
860 Ga0373938_0048457
861 Ga0373928_0004556
862 Ga0373929_0025288
863 Ga0373949_0253073
864 Ga0373939_0112864
865 Ga0373943_0562617
866 Ga0373961_0065693
867 Ga0373961_0356815
868 Ga0373962_0338921
869 Ga0373931_0161252
870 Ga0395900_0496058
871 Ga0395900_0617305
872 Ga0395898_0110026
873 Ga0395898_0375801
874 Ga0395898_1843870
875 Ga0395905_0179563
876 Ga0395905_0678152
877 Ga0395901_0033341
878 Ga0395901_0592880
879 Ga0395901_0595806
880 Ga0395901_1245379
881 Ga0395901_1620211
882 Ga0451802_1289627
883 Ga0451853_2631757
884 Ga0439448_0100295
885 Ga0439444_0064292
886 Ga0439464_0253055
887 Ga0439460_0017268
888 Ga0466972_0211469
889 Ga0466963_0217633
890 Ga0466963_0278661
891 Ga0466964_0747073
892 Ga0466971_0087651
893 Ga0466970_0560447
894 Ga0466957_0577421
895 Ga0466960_0400349
896 Ga0466959_0603711
897 Ga0466967_0007798
898 Ga0466967_0387350
899 Ga0466967_0625631
900 Ga0466967_0669973
901 Ga0466967_0859769
902 Ga0495603_0164815
903 Ga0495629_0844745
904 Ga0495653_0871500
905 Ga0495582_0387082
906 Ga0495594_0058507
907 Ga0495596_0124888
908 Ga0495608_0187372
909 Ga0495667_0215417
910 Ga0495623_0066787
911 Ga0495658_0367027
912 Ga0495658_0982511
913 Ga0495624_0425060
914 Ga0495581_0243888
915 Ga0495679_210868
916 Ga0496100_0042868
917 Ga0496100_0223736
918 Ga0496101_0019953
919 Ga0496101_0098931
920 Ga0496101_0220720
921 Ga0496102_0003150
922 Ga0496102_0008261
923 Ga0496102_0284899
924 Ga0496102_0320014
925 Ga0496102_0335807
926 Ga0496102_0560493
927 Ga0496103_0017038
928 Ga0496103_0035226
929 Ga0496103_0808415
930 Ga0496104_0001187
931 Ga0496104_0055617
932 Ga0496104_0195379
933 Ga0496104_0888481
934 Ga0496104_0919922
935 Ga0496105_0006154
936 Ga0496105_0066011
937 Ga0496105_0557594
938 Ga0496105_0782413
939 Ga0496106_0021433
940 Ga0496106_0448439
941 Ga0496106_0738872
942 Ga0496107_0333113
943 Ga0496108_0004215
944 Ga0496108_0009046
945 Ga0496108_0068465
946 Ga0496108_0184497
947 Ga0496108_0391638
948 Ga0496108_1411234
949 Ga0496109_0009562
950 Ga0496109_0053145
951 Ga0496109_0081680
952 Ga0496109_0084254
953 Ga0496109_0263671
954 Ga0496109_0324077
955 Ga0496109_0804153
956 Ga0496110_0000668
957 Ga0496110_0046166
958 Ga0496110_0264122
959 Ga0496110_0311974
960 Ga0496110_0891487
961 Ga0496111_0012127
962 Ga0496111_0023969
963 Ga0496111_0053997
964 Ga0496112_0009100
965 Ga0496112_0047982
966 Ga0496112_0624305
967 Ga0496112_0858717
968 Ga0496112_1715762
969 Ga0496113_0023471
970 Ga0496113_0054946
971 Ga0496113_0182972
972 Ga0496114_0019187
973 Ga0496114_0062869
974 Ga0496114_0065914
975 Ga0496114_0336332
976 Ga0496114_0410587
977 Ga0496114_0457735
978 Ga0496114_0584487
979 Ga0496115_0056499
980 Ga0496115_0097036
981 Ga0496115_0148321
982 Ga0496115_0424070
983 Ga0496115_0553715
984 Ga0496115_0809351
985 Ga0496124_0151867
986 Ga0496124_0502381
987 Ga0496124_0582209
988 Ga0496126_0383862
989 Ga0501067_0222878
990 Ga0501081_0549552
991 nmdc:mga03n38_189367_c1
992 nmdc:mga08y16_1202684_c1
993 nmdc:mga08y16_1368957_c1
994 nmdc:mga08y16_152332_c1
995 nmdc:mga08y16_610775_c1
996 nmdc:mga0n895_44849_c1
997 nmdc:mga08x19_263614_c1
998 nmdc:mga0a205_76319_c1
999 Ga0500651_0287328
1000 Ga0466962_0062394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i5b-assembly2.cif.gz_D the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.9732 32 57
2i5b-assembly1.cif.gz_B the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.9719 32 57
4c5l-assembly2.cif.gz_B structure of the pyridoxal kinase from staphylococcus aureus in complex with pyridoxal 0.9641 31 58
7l07-assembly1.cif.gz_A last common ancestor of hmppk and plk/hmppk vitamin kinases 0.9615 32 59
4c5m-assembly2.cif.gz_C structure of the pyridoxal kinase from staphylococcus aureus in complex with amp-pcp 0.9538 31 53
ID Description Score Start End Superfamily
af_Q06490_24_336_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9811 31 56 3.40.1190.20
af_Q04013_4_135_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.9793 29 53 1.50.40.10
af_O94265_1_284_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9726 31 56 3.40.1190.20
2i5bB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9719 32 57 3.40.1190.20
af_Q57688_1_236_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9705 31 56 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A2V5TY32-F1-model_v4 Bleomycin resistance protein 0.9566 2 59
AF-A0A543KX06-F1-model_v4 deleted 0.9384 2 68
AF-A0A543KX06-F1-model_v4 deleted 0.9127 2 68
AF-A0A2V6B5A9-F1-model_v4 Bleomycin resistance protein 0.9118 1 66
AF-A0A317IX59-F1-model_v4 Glyoxalase 0.9065 1 68

Map