F455554

General Info

Members Datasets Scaffolds Average Seq Length
500 247 1000 162

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10132614|Ga0207641_101326142
Length 194
Sequence VTGAGLRIGLGVDAHAFGDGVPLVLGGVTIDHPRGLVGHSDGDVIAHALTDALLGAAGLADIGALFPSDDERYRGADSLALLTGAYAQVRAAGYVLVNADCVVIGQEPRVAPHREEMRRRLAGALGVEEGAVNVRATTTDRLGFTGRGEQDRLNRALAGSRLTVYSGTGHCPHWEEPERFAADVVAFVRSVDAP

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 5.8
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10132614 3300026088 Bacteria 2239
2 JGI24738J21930_10001943 3300002075 Bacteria 5573
3 Ga0070658_10002754 3300005327 Bacteria 14633
4 Ga0070658_10614141 3300005327 Bacteria 943
5 Ga0070676_10371483 3300005328 Bacteria 988
6 Ga0070683_100008650 3300005329 Bacteria 8653
7 Ga0070683_100014453 3300005329 Bacteria 6906
8 Ga0070683_100036804 3300005329 Bacteria 4479
9 Ga0070683_100095452 3300005329 Bacteria 2796
10 Ga0070683_100133785 3300005329 Bacteria 2347
11 Ga0070683_100403351 3300005329 Bacteria 1304
12 Ga0070690_100110670 3300005330 Bacteria 1832
13 Ga0070670_100260524 3300005331 Bacteria 1511
14 Ga0070670_100491990 3300005331 Bacteria 1090
15 Ga0068869_101357764 3300005334 Bacteria 628
16 Ga0070680_100579841 3300005336 Unclassified 962
17 Ga0070682_100044615 3300005337 Bacteria 2745
18 Ga0070682_100099446 3300005337 Bacteria 1917
19 Ga0068868_100019265 3300005338 Bacteria 5112
20 Ga0068868_100019932 3300005338 Bacteria 5030
21 Ga0068868_100129756 3300005338 Bacteria 2062
22 Ga0070660_100008249 3300005339 Bacteria 7281
23 Ga0070660_100065507 3300005339 Bacteria 2828
24 Ga0070689_100006015 3300005340 Bacteria 8356
25 Ga0070689_100114717 3300005340 Bacteria 2146
26 Ga0070691_10022478 3300005341 Bacteria 2926
27 Ga0070691_10109170 3300005341 Bacteria 1382
28 Ga0070691_10317142 3300005341 Bacteria 856
29 Ga0070687_100006281 3300005343 Bacteria 4865
30 Ga0070661_100021170 3300005344 Bacteria 4641
31 Ga0070661_100047222 3300005344 Bacteria 3150
32 Ga0070692_10001205 3300005345 Bacteria 9169
33 Ga0070692_10055831 3300005345 Bacteria 2066
34 Ga0070692_10205360 3300005345 Bacteria 1156
35 Ga0070668_100069410 3300005347 Bacteria 2741
36 Ga0070675_100001962 3300005354 Bacteria 15223
37 Ga0070675_100038932 3300005354 Bacteria 3877
38 Ga0070675_100171357 3300005354 Bacteria 1872
39 Ga0070675_100537485 3300005354 Bacteria 1056
40 Ga0070671_100027530 3300005355 Bacteria 4679
41 Ga0070674_100067631 3300005356 Bacteria 2513
42 Ga0070673_100133619 3300005364 Bacteria 2085
43 Ga0070673_100216968 3300005364 Bacteria 1654
44 Ga0070688_100036619 3300005365 Bacteria 2985
45 Ga0070659_100009783 3300005366 Bacteria 7047
46 Ga0070667_100434717 3300005367 Bacteria 1198
47 Ga0070701_10041611 3300005438 Bacteria 2342
48 Ga0070701_10129569 3300005438 Bacteria 1432
49 Ga0070705_100283225 3300005440 Bacteria 1179
50 Ga0070700_100032393 3300005441 Bacteria 3140
51 Ga0070700_100425368 3300005441 Bacteria 1005
52 Ga0070694_100042131 3300005444 Bacteria 3048
53 Ga0070694_100227162 3300005444 Bacteria 1403
54 Ga0070708_100243227 3300005445 Bacteria 1690
55 Ga0070663_100065346 3300005455 Bacteria 2633
56 Ga0070678_100056619 3300005456 Bacteria 2868
57 Ga0070678_100744948 3300005456 Bacteria 886
58 Ga0070662_100002776 3300005457 Bacteria 10837
59 Ga0070681_11107138 3300005458 Bacteria 713
60 Ga0068867_100151169 3300005459 Bacteria 1824
61 Ga0070685_10006839 3300005466 Bacteria 5823
62 Ga0070685_10033982 3300005466 Bacteria 2870
63 Ga0070685_10325863 3300005466 Bacteria 1043
64 Ga0070684_100015038 3300005535 Bacteria 6288
65 Ga0070684_100022022 3300005535 Bacteria 5310
66 Ga0070684_100025991 3300005535 Bacteria 4928
67 Ga0070684_100162058 3300005535 Bacteria 2029
68 Ga0070684_100180358 3300005535 Bacteria 1920
69 Ga0070684_100552541 3300005535 Bacteria 1069
70 Ga0068853_100006378 3300005539 Bacteria 9370
71 Ga0068853_100037826 3300005539 Bacteria 4108
72 Ga0068853_100316422 3300005539 Bacteria 1446
73 Ga0070672_100033042 3300005543 Bacteria 3914
74 Ga0070672_100102632 3300005543 Bacteria 2321
75 Ga0070686_100062684 3300005544 Bacteria 2406
76 Ga0070696_100160599 3300005546 Bacteria 1655
77 Ga0070693_100125604 3300005547 Bacteria 1597
78 Ga0070665_100435703 3300005548 Bacteria 1320
79 Ga0070704_100047185 3300005549 Bacteria 3009
80 Ga0068855_100135775 3300005563 Bacteria 2807
81 Ga0070664_100026425 3300005564 Bacteria 4815
82 Ga0070664_100113914 3300005564 Bacteria 2362
83 Ga0070664_100193945 3300005564 Bacteria 1811
84 Ga0070664_100257491 3300005564 Bacteria 1570
85 Ga0070664_100682296 3300005564 Bacteria 956
86 Ga0068857_100136345 3300005577 Bacteria 2216
87 Ga0068854_100025196 3300005578 Bacteria 4081
88 Ga0068854_100115265 3300005578 Bacteria 2032
89 Ga0068854_100368132 3300005578 Bacteria 1181
90 Ga0068856_100036227 3300005614 Bacteria 4837
91 Ga0070702_100008891 3300005615 Bacteria 4888
92 Ga0070702_100064905 3300005615 Bacteria 2137
93 Ga0070702_100281919 3300005615 Bacteria 1141
94 Ga0070702_100372710 3300005615 Bacteria 1012
95 Ga0068852_100004178 3300005616 Bacteria 10175
96 Ga0068852_100055517 3300005616 Bacteria 3419
97 Ga0068852_100484192 3300005616 Bacteria 1230
98 Ga0068852_100901265 3300005616 Bacteria 901
99 Ga0068864_100094511 3300005618 Bacteria 2642
100 Ga0068866_10032711 3300005718 Bacteria 2517
101 Ga0068861_100018568 3300005719 Bacteria 4954
102 Ga0068861_100164680 3300005719 Bacteria 1832
103 Ga0068861_100402261 3300005719 Bacteria 1215
104 Ga0068851_10035132 3300005834 Bacteria 2505
105 Ga0068870_10183986 3300005840 Unclassified 1256
106 Ga0068858_100174253 3300005842 Bacteria 2029
107 Ga0068858_101828113 3300005842 Bacteria 600
108 Ga0068860_100200028 3300005843 Bacteria 1936
109 Ga0068862_100425051 3300005844 Bacteria 1248
110 Ga0081455_10014777 3300005937 Bacteria 7618
111 Ga0081539_10000936 3300005985 Bacteria 54722
112 Ga0081539_10159548 3300005985 Bacteria 1076
113 Ga0075365_10080522 3300006038 Bacteria 2205
114 Ga0075364_10099413 3300006051 Bacteria 1936
115 Ga0097621_100137555 3300006237 Bacteria 2085
116 Ga0068871_100053590 3300006358 Bacteria 3270
117 Ga0068871_100450903 3300006358 Bacteria 1153
118 Ga0068871_100588461 3300006358 Bacteria 1011
119 Ga0075428_100507600 3300006844 Bacteria 1290
120 Ga0075428_100781804 3300006844 Bacteria 1015
121 Ga0075433_10101363 3300006852 Bacteria 2549
122 Ga0075433_10212403 3300006852 Bacteria 1719
123 Ga0068865_100001977 3300006881 Bacteria 12107
124 Ga0068865_100029477 3300006881 Bacteria 3642
125 Ga0111539_10013291 3300009094 Bacteria 10287
126 Ga0111539_10105374 3300009094 Bacteria 3308
127 Ga0111539_10252036 3300009094 Bacteria 2055
128 Ga0111539_10949967 3300009094 Bacteria 999
129 Ga0111539_11413502 3300009094 Bacteria 807
130 Ga0105245_10006930 3300009098 Bacteria 9934
131 Ga0105245_10230648 3300009098 Bacteria 1790
132 Ga0105247_10190980 3300009101 Bacteria 1371
133 Ga0114129_10894491 3300009147 Bacteria 1125
134 Ga0105243_10005440 3300009148 Bacteria 9937
135 Ga0105243_10066193 3300009148 Bacteria 2905
136 Ga0105243_10300105 3300009148 Bacteria 1455
137 Ga0105241_11140856 3300009174 Bacteria 736
138 Ga0105242_10006684 3300009176 Bacteria 8900
139 Ga0105242_10041194 3300009176 Bacteria 3724
140 Ga0105242_10248291 3300009176 Bacteria 1602
141 Ga0105242_10530017 3300009176 Bacteria 1125
142 Ga0105242_10757337 3300009176 Bacteria 957
143 Ga0105242_10820452 3300009176 Bacteria 922
144 Ga0105248_10351102 3300009177 Bacteria 1660
145 Ga0105248_11092277 3300009177 Bacteria 902
146 Ga0105237_10187588 3300009545 Bacteria 2068
147 Ga0105237_10380766 3300009545 Bacteria 1416
148 Ga0105238_10009978 3300009551 Bacteria 9522
149 Ga0105238_10139001 3300009551 Bacteria 2406
150 Ga0105249_10196101 3300009553 Bacteria 1974
151 Ga0105249_10577092 3300009553 Bacteria 1177
152 Ga0105239_10013973 3300010375 Bacteria 8915
153 Ga0105239_10166490 3300010375 Bacteria 2465
154 Ga0105239_11730917 3300010375 Bacteria 724
155 Ga0105246_10021125 3300011119 Bacteria 4185
156 Ga0105246_10082082 3300011119 Bacteria 2300
157 Ga0157371_10008665 3300013102 Bacteria 8079
158 Ga0157370_10293193 3300013104 Bacteria 1502
159 Ga0157369_10748822 3300013105 Bacteria 1005
160 Ga0157374_10332040 3300013296 Bacteria 1508
161 Ga0157374_11288834 3300013296 Bacteria 753
162 Ga0157378_11090894 3300013297 Bacteria 835
163 Ga0163162_10196016 3300013306 Bacteria 2148
164 Ga0163162_10369220 3300013306 Bacteria 1568
165 Ga0157372_10013322 3300013307 Bacteria 8777
166 Ga0157372_10175923 3300013307 Bacteria 2477
167 Ga0157375_10054007 3300013308 Bacteria 3955
168 Ga0157375_10058470 3300013308 Bacteria 3815
169 Ga0157375_10551206 3300013308 Unclassified 1315
170 Ga0163163_10073591 3300014325 Bacteria 3408
171 Ga0163163_10218821 3300014325 Bacteria 1953
172 Ga0157380_10096268 3300014326 Bacteria 2454
173 Ga0157380_10193854 3300014326 Bacteria 1796
174 Ga0157380_10226311 3300014326 Bacteria 1677
175 Ga0157377_10021834 3300014745 Bacteria 3372
176 Ga0157377_10164039 3300014745 Bacteria 1384
177 Ga0157377_10259399 3300014745 Unclassified 1130
178 Ga0157377_10360919 3300014745 Bacteria 978
179 Ga0157379_10037867 3300014968 Bacteria 4302
180 Ga0157379_10276495 3300014968 Bacteria 1528
181 Ga0157376_10083664 3300014969 Bacteria 2745
182 Ga0163161_10031711 3300017792 Bacteria 3767
183 Ga0163161_10157253 3300017792 Bacteria 1731
184 Ga0163161_10306488 3300017792 Bacteria 1252
185 Ga0207656_10068491 3300025321 Bacteria 1572
186 Ga0207642_10015128 3300025899 Bacteria 2866
187 Ga0207642_10261246 3300025899 Bacteria 987
188 Ga0207688_10054283 3300025901 Bacteria 2248
189 Ga0207688_10359194 3300025901 Unclassified 898
190 Ga0207647_10075722 3300025904 Bacteria 2025
191 Ga0207645_10045725 3300025907 Bacteria 2797
192 Ga0207643_10017877 3300025908 Bacteria 3882
193 Ga0207643_10399868 3300025908 Bacteria 868
194 Ga0207705_10618014 3300025909 Bacteria 843
195 Ga0207707_10219888 3300025912 Bacteria 1653
196 Ga0207707_10906771 3300025912 Bacteria 728
197 Ga0207671_10964411 3300025914 Bacteria 673
198 Ga0207693_10229140 3300025915 Bacteria 1459
199 Ga0207662_10020189 3300025918 Bacteria 3801
200 Ga0207657_10005297 3300025919 Bacteria 13512
201 Ga0207657_10051237 3300025919 Bacteria 3588
202 Ga0207657_10365934 3300025919 Bacteria 1136
203 Ga0207649_10248932 3300025920 Bacteria 1279
204 Ga0207646_10693581 3300025922 Bacteria 911
205 Ga0207694_10377326 3300025924 Bacteria 1176
206 Ga0207650_10091589 3300025925 Bacteria 2324
207 Ga0207650_10133674 3300025925 Bacteria 1944
208 Ga0207650_10517192 3300025925 Bacteria 999
209 Ga0207659_10007147 3300025926 Bacteria 6852
210 Ga0207659_10054657 3300025926 Bacteria 2852
211 Ga0207687_10037999 3300025927 Bacteria 3288
212 Ga0207687_10153111 3300025927 Bacteria 1762
213 Ga0207687_10233573 3300025927 Bacteria 1454
214 Ga0207687_11112045 3300025927 Bacteria 679
215 Ga0207690_10061951 3300025932 Bacteria 2545
216 Ga0207690_10081674 3300025932 Bacteria 2259
217 Ga0207706_10002091 3300025933 Bacteria 19529
218 Ga0207706_10065843 3300025933 Bacteria 3190
219 Ga0207706_10157073 3300025933 Bacteria 2000
220 Ga0207686_10347097 3300025934 Bacteria 1116
221 Ga0207709_10008614 3300025935 Bacteria 5632
222 Ga0207709_10039472 3300025935 Bacteria 2820
223 Ga0207709_10334845 3300025935 Bacteria 1137
224 Ga0207709_10671758 3300025935 Bacteria 827
225 Ga0207669_10175715 3300025937 Bacteria 1529
226 Ga0207669_10199124 3300025937 Bacteria 1452
227 Ga0207704_10042579 3300025938 Bacteria 2674
228 Ga0207704_10386462 3300025938 Bacteria 1100
229 Ga0207691_10007012 3300025940 Bacteria 10872
230 Ga0207689_10165018 3300025942 Bacteria 1825
231 Ga0207689_10644211 3300025942 Bacteria 892
232 Ga0207661_10037541 3300025944 Bacteria 3789
233 Ga0207661_10038743 3300025944 Bacteria 3738
234 Ga0207661_10122272 3300025944 Bacteria 2218
235 Ga0207661_10199722 3300025944 Bacteria 1757
236 Ga0207661_10295460 3300025944 Bacteria 1451
237 Ga0207679_10101583 3300025945 Bacteria 2250
238 Ga0207679_10119595 3300025945 Bacteria 2094
239 Ga0207679_10251252 3300025945 Bacteria 1503
240 Ga0207679_11245608 3300025945 Bacteria 683
241 Ga0207667_10255567 3300025949 Bacteria 1792
242 Ga0207651_10032773 3300025960 Bacteria 3342
243 Ga0207651_10241404 3300025960 Bacteria 1473
244 Ga0207712_10699194 3300025961 Bacteria 885
245 Ga0207668_10117683 3300025972 Bacteria 2006
246 Ga0207668_10843222 3300025972 Bacteria 813
247 Ga0207640_10013198 3300025981 Bacteria 4729
248 Ga0207640_10332946 3300025981 Bacteria 1213
249 Ga0207677_10085097 3300026023 Bacteria 2281
250 Ga0207677_10137158 3300026023 Bacteria 1867
251 Ga0207677_10581668 3300026023 Bacteria 980
252 Ga0207703_10356844 3300026035 Bacteria 1347
253 Ga0207639_10060481 3300026041 Bacteria 2922
254 Ga0207639_10183548 3300026041 Bacteria 1781
255 Ga0207639_10505073 3300026041 Bacteria 1105
256 Ga0207678_10009264 3300026067 Bacteria 8664
257 Ga0207678_10050886 3300026067 Bacteria 3578
258 Ga0207708_10048704 3300026075 Bacteria 3227
259 Ga0207708_10500945 3300026075 Bacteria 1018
260 Ga0207702_10064422 3300026078 Bacteria 3136
261 Ga0207648_10123532 3300026089 Bacteria 2277
262 Ga0207648_10634308 3300026089 Bacteria 987
263 Ga0207674_10049321 3300026116 Bacteria 4306
264 Ga0207674_10236197 3300026116 Bacteria 1775
265 Ga0207675_100102113 3300026118 Bacteria 2702
266 Ga0207675_100159869 3300026118 Bacteria 2148
267 Ga0207675_100486169 3300026118 Bacteria 1227
268 Ga0207683_10100782 3300026121 Bacteria 2578
269 Ga0207683_10117169 3300026121 Bacteria 2388
270 Ga0207683_10386050 3300026121 Bacteria 1287
271 Ga0207698_10173111 3300026142 Bacteria 1903
272 Ga0207698_10282790 3300026142 Bacteria 1535
273 Ga0207698_11403252 3300026142 Bacteria 713
274 Ga0207428_10033738 3300027907 Bacteria 4200
275 Ga0207428_10068895 3300027907 Bacteria 2782
276 Ga0207428_10150674 3300027907 Bacteria 1770
277 Ga0268266_10108889 3300028379 Bacteria 2452
278 Ga0268264_10095020 3300028381 Bacteria 2579
279 Ga0307408_100331869 3300031548 Bacteria 1285
280 Ga0307409_100083060 3300031995 Bacteria 2596
281 Ga0307409_100427265 3300031995 Bacteria 1272
282 Ga0307409_100873656 3300031995 Unclassified 911
283 Ga0307416_100140934 3300032002 Bacteria 2191
284 Ga0307415_100642937 3300032126 Bacteria 950
285 Ga0307415_100814141 3300032126 Unclassified 854
286 Ga0373950_0008443 3300034818 Bacteria 1622
287 Ga0373940_0036628 3300035088 Bacteria 1333
288 Ga0373949_0026937 3300035090 Bacteria 1349
289 Ga0373951_0040129 3300035091 Bacteria 1127
290 Ga0373952_0042971 3300035092 Bacteria 1051
291 Ga0373941_0004354 3300035115 Bacteria 3265
292 Ga0373960_0028786 3300035121 Bacteria 1535
293 Ga0373942_0097057 3300035207 Bacteria 896
294 Ga0373961_0163882 3300035241 Bacteria 765
295 Ga0373931_0102385 3300035691 Bacteria 1612
296 Ga0395899_0200864 3300037312 Bacteria 1390
297 Ga0395900_0353639 3300037418 Bacteria 1442
298 Ga0395900_0474961 3300037418 Bacteria 1203
299 Ga0395898_0201639 3300037466 Bacteria 1899
300 Ga0395898_0231280 3300037466 Bacteria 1763
301 Ga0395905_0145123 3300037471 Bacteria 2233
302 Ga0395905_0181206 3300037471 Bacteria 1978
303 Ga0395901_0030627 3300038443 Bacteria 5544
304 Ga0395901_0257647 3300038443 Bacteria 1816
305 Ga0439436_0025466 3300041404 Bacteria 1738
306 Ga0439439_0001451 3300041406 Bacteria 4723
307 Ga0439461_0011036 3300041410 Bacteria 1670
308 Ga0451835_1259863 3300041492 Bacteria 1006
309 Ga0451853_2001011 3300041512 Unclassified 728
310 Ga0439431_0008547 3300041997 Bacteria 2305
311 Ga0439431_0040919 3300041997 Bacteria 1180
312 Ga0439432_097008 3300042006 Bacteria 884
313 Ga0439449_0042562 3300042007 Bacteria 1687
314 Ga0439457_070230 3300042014 Bacteria 798
315 Ga0439462_0007340 3300042015 Bacteria 2757
316 Ga0450906_036908 3300042145 Bacteria 862
317 Ga0439446_0015903 3300042156 Bacteria 2091
318 Ga0450916_006545 3300042530 Bacteria 1375
319 Ga0495603_0076399 3300046455 Bacteria 1966
320 Ga0495629_0242568 3300046459 Bacteria 1241
321 Ga0495629_0424239 3300046459 Unclassified 902
322 Ga0495605_0332627 3300046474 Bacteria 639
323 Ga0495584_0066367 3300046491 Bacteria 1815
324 Ga0495584_0336438 3300046491 Bacteria 767
325 Ga0495585_0145496 3300046492 Bacteria 1239
326 Ga0495596_0120230 3300046500 Bacteria 1020
327 Ga0495596_0171525 3300046500 Bacteria 843
328 Ga0495616_0172291 3300046513 Bacteria 967
329 Ga0495630_0144025 3300046517 Bacteria 1812
330 Ga0495645_0944213 3300046543 Bacteria 510
331 Ga0495656_0269725 3300046615 Bacteria 864
332 Ga0495661_0326293 3300046665 Bacteria 762
333 Ga0495658_0769846 3300046683 Bacteria 616
334 Ga0495670_0163312 3300046691 Unclassified 1171
335 Ga0495670_0167568 3300046691 Bacteria 1156
336 Ga0495589_0201369 3300046794 Unclassified 940
337 Ga0495589_0343704 3300046794 Bacteria 688
338 Ga0495600_0218149 3300046809 Bacteria 1221
339 Ga0495676_0496609 3300047321 Bacteria 801
340 Ga0495675_0505461 3300047444 Bacteria 694
341 Ga0495677_0103570 3300047445 Bacteria 1079
342 Ga0495602_0355230 3300048088 Bacteria 1057
343 Ga0496100_1092803 3300048903 Bacteria 628
344 Ga0496101_0022965 3300048904 Bacteria 4302
345 Ga0496101_0065227 3300048904 Bacteria 2654
346 Ga0496101_1424677 3300048904 Bacteria 540
347 Ga0496102_0939905 3300048905 Bacteria 786
348 Ga0496104_0022916 3300048907 Bacteria 5738
349 Ga0496104_0136130 3300048907 Bacteria 2360
350 Ga0496105_0086586 3300048908 Bacteria 2589
351 Ga0496105_0119104 3300048908 Bacteria 2178
352 Ga0496105_0986832 3300048908 Bacteria 631
353 Ga0496106_0542796 3300048909 Bacteria 933
354 Ga0496108_0030910 3300048911 Bacteria 4438
355 Ga0496108_0078816 3300048911 Bacteria 2789
356 Ga0496108_0181477 3300048911 Bacteria 1823
357 Ga0496108_0276084 3300048911 Bacteria 1463
358 Ga0496109_0022773 3300048912 Bacteria 5550
359 Ga0496109_0129268 3300048912 Bacteria 2357
360 Ga0496109_0136852 3300048912 Bacteria 2289
361 Ga0496109_0645710 3300048912 Bacteria 995
362 Ga0496110_0040457 3300048913 Bacteria 4062
363 Ga0496110_0090328 3300048913 Bacteria 2739
364 Ga0496110_0490041 3300048913 Bacteria 1120
365 Ga0496111_0081886 3300048914 Bacteria 2356
366 Ga0496111_0131446 3300048914 Bacteria 1852
367 Ga0496111_0468939 3300048914 Bacteria 928
368 Ga0496113_0394241 3300048916 Bacteria 1111
369 Ga0496114_0068538 3300048917 Bacteria 2978
370 Ga0496114_0219534 3300048917 Bacteria 1668
371 Ga0496115_0036644 3300048918 Bacteria 3885
372 Ga0496126_0040391 3300048929 Bacteria 4325
373 Ga0501031_0002893 3300049568 Bacteria 10973
374 Ga0501031_0007590 3300049568 Bacteria 7064
375 Ga0501031_0305905 3300049568 Bacteria 1030
376 Ga0501032_0011223 3300049569 Bacteria 6435
377 Ga0501032_0052177 3300049569 Bacteria 2756
378 Ga0501032_0239576 3300049569 Bacteria 1179
379 Ga0501033_0055751 3300049570 Bacteria 2921
380 Ga0501033_0389903 3300049570 Bacteria 972
381 Ga0501034_0099011 3300049571 Bacteria 2911
382 Ga0501034_0167075 3300049571 Bacteria 2169
383 Ga0501036_0007261 3300049572 Bacteria 9022
384 Ga0501036_0017056 3300049572 Bacteria 6069
385 Ga0501036_0942985 3300049572 Bacteria 708
386 Ga0501037_0016243 3300049573 Bacteria 5478
387 Ga0501037_0078626 3300049573 Bacteria 2393
388 Ga0501038_0012888 3300049574 Bacteria 7629
389 Ga0501038_0125416 3300049574 Bacteria 2113
390 Ga0501038_0165046 3300049574 Bacteria 1797
391 Ga0501039_0067338 3300049575 Bacteria 2780
392 Ga0501039_0139477 3300049575 Bacteria 1904
393 Ga0501039_0193996 3300049575 Bacteria 1597
394 Ga0501039_0416748 3300049575 Bacteria 1055
395 Ga0501040_0009942 3300049576 Bacteria 6211
396 Ga0501040_0013159 3300049576 Bacteria 5441
397 Ga0501040_0247951 3300049576 Bacteria 1270
398 Ga0501040_0312879 3300049576 Bacteria 1123
399 Ga0501041_0003604 3300049577 Bacteria 8906
400 Ga0501041_0004463 3300049577 Bacteria 8102
401 Ga0501041_0133175 3300049577 Bacteria 1548
402 Ga0501041_0249599 3300049577 Bacteria 1116
403 Ga0501042_0008539 3300049578 Bacteria 6769
404 Ga0501042_0155130 3300049578 Bacteria 1651
405 Ga0501043_0017802 3300049579 Bacteria 5570
406 Ga0501043_0050755 3300049579 Bacteria 3260
407 Ga0501046_0020525 3300049580 Bacteria 5461
408 Ga0501046_0821874 3300049580 Bacteria 651
409 Ga0501047_0023880 3300049581 Bacteria 5872
410 Ga0501047_0146691 3300049581 Bacteria 2236
411 Ga0501047_0781227 3300049581 Bacteria 770
412 Ga0501048_0077756 3300049582 Bacteria 2341
413 Ga0501048_0120685 3300049582 Bacteria 1852
414 Ga0501048_0441558 3300049582 Bacteria 931
415 Ga0501048_0481456 3300049582 Unclassified 890
416 Ga0501067_0295074 3300049583 Bacteria 902
417 Ga0501067_0504869 3300049583 Bacteria 677
418 Ga0501068_0003598 3300049584 Bacteria 8378
419 Ga0501068_0048208 3300049584 Bacteria 2571
420 Ga0501068_0050293 3300049584 Bacteria 2519
421 Ga0501068_0082353 3300049584 Bacteria 1976
422 Ga0501068_0256786 3300049584 Bacteria 1114
423 Ga0501069_0046950 3300049585 Bacteria 2396
424 Ga0501069_0068580 3300049585 Bacteria 1984
425 Ga0501069_0151323 3300049585 Bacteria 1333
426 Ga0501069_0188813 3300049585 Bacteria 1192
427 Ga0501069_0300120 3300049585 Bacteria 942
428 Ga0501070_0028280 3300049586 Bacteria 4701
429 Ga0501070_0066676 3300049586 Bacteria 2981
430 Ga0501070_0364591 3300049586 Bacteria 1172
431 Ga0501071_0003985 3300049587 Bacteria 9319
432 Ga0501071_0027218 3300049587 Bacteria 4021
433 Ga0501071_0043838 3300049587 Bacteria 3209
434 Ga0501071_0076926 3300049587 Bacteria 2437
435 Ga0501072_0003319 3300049588 Bacteria 12108
436 Ga0501072_0014174 3300049588 Bacteria 6108
437 Ga0501072_0086844 3300049588 Bacteria 2482
438 Ga0501072_0119328 3300049588 Bacteria 2101
439 Ga0501072_0402263 3300049588 Bacteria 1086
440 Ga0501072_0498168 3300049588 Bacteria 964
441 Ga0501073_0014950 3300049589 Bacteria 5630
442 Ga0501073_0155730 3300049589 Bacteria 1583
443 Ga0501074_0005733 3300049590 Bacteria 8951
444 Ga0501074_0058530 3300049590 Bacteria 2776
445 Ga0501075_0021551 3300049591 Bacteria 4700
446 Ga0501075_0084780 3300049591 Bacteria 2400
447 Ga0501076_0015809 3300049592 Bacteria 5709
448 Ga0501076_0021276 3300049592 Bacteria 4974
449 Ga0501076_0049538 3300049592 Bacteria 3323
450 Ga0501076_0498166 3300049592 Bacteria 1004
451 Ga0501076_0621541 3300049592 Bacteria 891
452 Ga0501076_0962149 3300049592 Bacteria 704
453 Ga0501077_0022136 3300049593 Bacteria 4025
454 Ga0501077_0072846 3300049593 Bacteria 2176
455 Ga0501079_0010743 3300049741 Bacteria 6972
456 Ga0501079_0015206 3300049741 Bacteria 5869
457 Ga0501079_0293710 3300049741 Bacteria 1271
458 Ga0501079_0997657 3300049741 Bacteria 659
459 Ga0501080_0041457 3300049742 Bacteria 4289
460 Ga0501080_0043439 3300049742 Bacteria 4185
461 Ga0501080_0999745 3300049742 Bacteria 725
462 Ga0501081_0013810 3300049743 Bacteria 5314
463 Ga0501081_0022263 3300049743 Bacteria 4238
464 Ga0501081_0462759 3300049743 Unclassified 943
465 Ga0501083_0361757 3300049744 Bacteria 943
466 Ga0501083_0737978 3300049744 Bacteria 640
467 Ga0501035_0043823 3300049822 Bacteria 4031
468 Ga0501035_0116940 3300049822 Bacteria 2333
469 Ga0501044_0026003 3300049823 Bacteria 6201
470 Ga0501044_0132032 3300049823 Bacteria 2491
471 Ga0501044_0611572 3300049823 Bacteria 982
472 Ga0501045_0011952 3300049824 Bacteria 6103
473 Ga0501045_0015582 3300049824 Bacteria 5393
474 Ga0501045_0021374 3300049824 Bacteria 4628
475 Ga0501045_0024020 3300049824 Bacteria 4376
476 nmdc:mga00v17_332795_c1 3300050491 Bacteria 987
477 nmdc:mga0yw44_10705_c1 3300050492 Bacteria 2056
478 nmdc:mga0yw44_244871_c1 3300050492 Bacteria 1192
479 nmdc:mga08y16_325969_c1 3300050511 Bacteria 1580
480 nmdc:mga08y16_5680_c2 3300050511 Bacteria 10708
481 nmdc:mga08y16_582479_c1 3300050511 Bacteria 1129
482 nmdc:mga08y16_72689_c1 3300050511 Bacteria 3584
483 nmdc:mga08y16_84800_c1 3300050511 Bacteria 3302
484 nmdc:mga0a205_33225_c1 3300050515 Bacteria 4946
485 nmdc:mga0a205_551107_c1 3300050515 Bacteria 1008
486 nmdc:mga0a205_677850_c1 3300050515 Bacteria 881
487 Ga0501084_0011205 3300054114 Bacteria 7427
488 Ga0501084_0026091 3300054114 Bacteria 4874
489 Ga0501084_0098693 3300054114 Bacteria 2452
490 Ga0501084_0598074 3300054114 Bacteria 932
491 Ga0501084_1022025 3300054114 Bacteria 694
492 Ga0501082_0011086 3300060353 Bacteria 7751
493 Ga0501082_0029060 3300060353 Bacteria 4762
494 Ga0501082_0086192 3300060353 Bacteria 2708
495 Ga0501082_0820429 3300060353 Bacteria 814
496 Ga0530510_0013561 3300061734 Bacteria 5732
497 Ga0530510_0018495 3300061734 Bacteria 4940
498 Ga0530510_0019938 3300061734 Bacteria 4764
499 Ga0530510_0418808 3300061734 Bacteria 1011
500 Ga0530510_0443075 3300061734 Bacteria 981
501 Ga0207641_10132614
502 JGI24738J21930_10001943
503 Ga0070658_10002754
504 Ga0070658_10614141
505 Ga0070676_10371483
506 Ga0070683_100008650
507 Ga0070683_100014453
508 Ga0070683_100036804
509 Ga0070683_100095452
510 Ga0070683_100133785
511 Ga0070683_100403351
512 Ga0070690_100110670
513 Ga0070670_100260524
514 Ga0070670_100491990
515 Ga0068869_101357764
516 Ga0070680_100579841
517 Ga0070682_100044615
518 Ga0070682_100099446
519 Ga0068868_100019265
520 Ga0068868_100019932
521 Ga0068868_100129756
522 Ga0070660_100008249
523 Ga0070660_100065507
524 Ga0070689_100006015
525 Ga0070689_100114717
526 Ga0070691_10022478
527 Ga0070691_10109170
528 Ga0070691_10317142
529 Ga0070687_100006281
530 Ga0070661_100021170
531 Ga0070661_100047222
532 Ga0070692_10001205
533 Ga0070692_10055831
534 Ga0070692_10205360
535 Ga0070668_100069410
536 Ga0070675_100001962
537 Ga0070675_100038932
538 Ga0070675_100171357
539 Ga0070675_100537485
540 Ga0070671_100027530
541 Ga0070674_100067631
542 Ga0070673_100133619
543 Ga0070673_100216968
544 Ga0070688_100036619
545 Ga0070659_100009783
546 Ga0070667_100434717
547 Ga0070701_10041611
548 Ga0070701_10129569
549 Ga0070705_100283225
550 Ga0070700_100032393
551 Ga0070700_100425368
552 Ga0070694_100042131
553 Ga0070694_100227162
554 Ga0070708_100243227
555 Ga0070663_100065346
556 Ga0070678_100056619
557 Ga0070678_100744948
558 Ga0070662_100002776
559 Ga0070681_11107138
560 Ga0068867_100151169
561 Ga0070685_10006839
562 Ga0070685_10033982
563 Ga0070685_10325863
564 Ga0070684_100015038
565 Ga0070684_100022022
566 Ga0070684_100025991
567 Ga0070684_100162058
568 Ga0070684_100180358
569 Ga0070684_100552541
570 Ga0068853_100006378
571 Ga0068853_100037826
572 Ga0068853_100316422
573 Ga0070672_100033042
574 Ga0070672_100102632
575 Ga0070686_100062684
576 Ga0070696_100160599
577 Ga0070693_100125604
578 Ga0070665_100435703
579 Ga0070704_100047185
580 Ga0068855_100135775
581 Ga0070664_100026425
582 Ga0070664_100113914
583 Ga0070664_100193945
584 Ga0070664_100257491
585 Ga0070664_100682296
586 Ga0068857_100136345
587 Ga0068854_100025196
588 Ga0068854_100115265
589 Ga0068854_100368132
590 Ga0068856_100036227
591 Ga0070702_100008891
592 Ga0070702_100064905
593 Ga0070702_100281919
594 Ga0070702_100372710
595 Ga0068852_100004178
596 Ga0068852_100055517
597 Ga0068852_100484192
598 Ga0068852_100901265
599 Ga0068864_100094511
600 Ga0068866_10032711
601 Ga0068861_100018568
602 Ga0068861_100164680
603 Ga0068861_100402261
604 Ga0068851_10035132
605 Ga0068870_10183986
606 Ga0068858_100174253
607 Ga0068858_101828113
608 Ga0068860_100200028
609 Ga0068862_100425051
610 Ga0081455_10014777
611 Ga0081539_10000936
612 Ga0081539_10159548
613 Ga0075365_10080522
614 Ga0075364_10099413
615 Ga0097621_100137555
616 Ga0068871_100053590
617 Ga0068871_100450903
618 Ga0068871_100588461
619 Ga0075428_100507600
620 Ga0075428_100781804
621 Ga0075433_10101363
622 Ga0075433_10212403
623 Ga0068865_100001977
624 Ga0068865_100029477
625 Ga0111539_10013291
626 Ga0111539_10105374
627 Ga0111539_10252036
628 Ga0111539_10949967
629 Ga0111539_11413502
630 Ga0105245_10006930
631 Ga0105245_10230648
632 Ga0105247_10190980
633 Ga0114129_10894491
634 Ga0105243_10005440
635 Ga0105243_10066193
636 Ga0105243_10300105
637 Ga0105241_11140856
638 Ga0105242_10006684
639 Ga0105242_10041194
640 Ga0105242_10248291
641 Ga0105242_10530017
642 Ga0105242_10757337
643 Ga0105242_10820452
644 Ga0105248_10351102
645 Ga0105248_11092277
646 Ga0105237_10187588
647 Ga0105237_10380766
648 Ga0105238_10009978
649 Ga0105238_10139001
650 Ga0105249_10196101
651 Ga0105249_10577092
652 Ga0105239_10013973
653 Ga0105239_10166490
654 Ga0105239_11730917
655 Ga0105246_10021125
656 Ga0105246_10082082
657 Ga0157371_10008665
658 Ga0157370_10293193
659 Ga0157369_10748822
660 Ga0157374_10332040
661 Ga0157374_11288834
662 Ga0157378_11090894
663 Ga0163162_10196016
664 Ga0163162_10369220
665 Ga0157372_10013322
666 Ga0157372_10175923
667 Ga0157375_10054007
668 Ga0157375_10058470
669 Ga0157375_10551206
670 Ga0163163_10073591
671 Ga0163163_10218821
672 Ga0157380_10096268
673 Ga0157380_10193854
674 Ga0157380_10226311
675 Ga0157377_10021834
676 Ga0157377_10164039
677 Ga0157377_10259399
678 Ga0157377_10360919
679 Ga0157379_10037867
680 Ga0157379_10276495
681 Ga0157376_10083664
682 Ga0163161_10031711
683 Ga0163161_10157253
684 Ga0163161_10306488
685 Ga0207656_10068491
686 Ga0207642_10015128
687 Ga0207642_10261246
688 Ga0207688_10054283
689 Ga0207688_10359194
690 Ga0207647_10075722
691 Ga0207645_10045725
692 Ga0207643_10017877
693 Ga0207643_10399868
694 Ga0207705_10618014
695 Ga0207707_10219888
696 Ga0207707_10906771
697 Ga0207671_10964411
698 Ga0207693_10229140
699 Ga0207662_10020189
700 Ga0207657_10005297
701 Ga0207657_10051237
702 Ga0207657_10365934
703 Ga0207649_10248932
704 Ga0207646_10693581
705 Ga0207694_10377326
706 Ga0207650_10091589
707 Ga0207650_10133674
708 Ga0207650_10517192
709 Ga0207659_10007147
710 Ga0207659_10054657
711 Ga0207687_10037999
712 Ga0207687_10153111
713 Ga0207687_10233573
714 Ga0207687_11112045
715 Ga0207690_10061951
716 Ga0207690_10081674
717 Ga0207706_10002091
718 Ga0207706_10065843
719 Ga0207706_10157073
720 Ga0207686_10347097
721 Ga0207709_10008614
722 Ga0207709_10039472
723 Ga0207709_10334845
724 Ga0207709_10671758
725 Ga0207669_10175715
726 Ga0207669_10199124
727 Ga0207704_10042579
728 Ga0207704_10386462
729 Ga0207691_10007012
730 Ga0207689_10165018
731 Ga0207689_10644211
732 Ga0207661_10037541
733 Ga0207661_10038743
734 Ga0207661_10122272
735 Ga0207661_10199722
736 Ga0207661_10295460
737 Ga0207679_10101583
738 Ga0207679_10119595
739 Ga0207679_10251252
740 Ga0207679_11245608
741 Ga0207667_10255567
742 Ga0207651_10032773
743 Ga0207651_10241404
744 Ga0207712_10699194
745 Ga0207668_10117683
746 Ga0207668_10843222
747 Ga0207640_10013198
748 Ga0207640_10332946
749 Ga0207677_10085097
750 Ga0207677_10137158
751 Ga0207677_10581668
752 Ga0207703_10356844
753 Ga0207639_10060481
754 Ga0207639_10183548
755 Ga0207639_10505073
756 Ga0207678_10009264
757 Ga0207678_10050886
758 Ga0207708_10048704
759 Ga0207708_10500945
760 Ga0207702_10064422
761 Ga0207648_10123532
762 Ga0207648_10634308
763 Ga0207674_10049321
764 Ga0207674_10236197
765 Ga0207675_100102113
766 Ga0207675_100159869
767 Ga0207675_100486169
768 Ga0207683_10100782
769 Ga0207683_10117169
770 Ga0207683_10386050
771 Ga0207698_10173111
772 Ga0207698_10282790
773 Ga0207698_11403252
774 Ga0207428_10033738
775 Ga0207428_10068895
776 Ga0207428_10150674
777 Ga0268266_10108889
778 Ga0268264_10095020
779 Ga0307408_100331869
780 Ga0307409_100083060
781 Ga0307409_100427265
782 Ga0307409_100873656
783 Ga0307416_100140934
784 Ga0307415_100642937
785 Ga0307415_100814141
786 Ga0373950_0008443
787 Ga0373940_0036628
788 Ga0373949_0026937
789 Ga0373951_0040129
790 Ga0373952_0042971
791 Ga0373941_0004354
792 Ga0373960_0028786
793 Ga0373942_0097057
794 Ga0373961_0163882
795 Ga0373931_0102385
796 Ga0395899_0200864
797 Ga0395900_0353639
798 Ga0395900_0474961
799 Ga0395898_0201639
800 Ga0395898_0231280
801 Ga0395905_0145123
802 Ga0395905_0181206
803 Ga0395901_0030627
804 Ga0395901_0257647
805 Ga0439436_0025466
806 Ga0439439_0001451
807 Ga0439461_0011036
808 Ga0451835_1259863
809 Ga0451853_2001011
810 Ga0439431_0008547
811 Ga0439431_0040919
812 Ga0439432_097008
813 Ga0439449_0042562
814 Ga0439457_070230
815 Ga0439462_0007340
816 Ga0450906_036908
817 Ga0439446_0015903
818 Ga0450916_006545
819 Ga0495603_0076399
820 Ga0495629_0242568
821 Ga0495629_0424239
822 Ga0495605_0332627
823 Ga0495584_0066367
824 Ga0495584_0336438
825 Ga0495585_0145496
826 Ga0495596_0120230
827 Ga0495596_0171525
828 Ga0495616_0172291
829 Ga0495630_0144025
830 Ga0495645_0944213
831 Ga0495656_0269725
832 Ga0495661_0326293
833 Ga0495658_0769846
834 Ga0495670_0163312
835 Ga0495670_0167568
836 Ga0495589_0201369
837 Ga0495589_0343704
838 Ga0495600_0218149
839 Ga0495676_0496609
840 Ga0495675_0505461
841 Ga0495677_0103570
842 Ga0495602_0355230
843 Ga0496100_1092803
844 Ga0496101_0022965
845 Ga0496101_0065227
846 Ga0496101_1424677
847 Ga0496102_0939905
848 Ga0496104_0022916
849 Ga0496104_0136130
850 Ga0496105_0086586
851 Ga0496105_0119104
852 Ga0496105_0986832
853 Ga0496106_0542796
854 Ga0496108_0030910
855 Ga0496108_0078816
856 Ga0496108_0181477
857 Ga0496108_0276084
858 Ga0496109_0022773
859 Ga0496109_0129268
860 Ga0496109_0136852
861 Ga0496109_0645710
862 Ga0496110_0040457
863 Ga0496110_0090328
864 Ga0496110_0490041
865 Ga0496111_0081886
866 Ga0496111_0131446
867 Ga0496111_0468939
868 Ga0496113_0394241
869 Ga0496114_0068538
870 Ga0496114_0219534
871 Ga0496115_0036644
872 Ga0496126_0040391
873 Ga0501031_0002893
874 Ga0501031_0007590
875 Ga0501031_0305905
876 Ga0501032_0011223
877 Ga0501032_0052177
878 Ga0501032_0239576
879 Ga0501033_0055751
880 Ga0501033_0389903
881 Ga0501034_0099011
882 Ga0501034_0167075
883 Ga0501036_0007261
884 Ga0501036_0017056
885 Ga0501036_0942985
886 Ga0501037_0016243
887 Ga0501037_0078626
888 Ga0501038_0012888
889 Ga0501038_0125416
890 Ga0501038_0165046
891 Ga0501039_0067338
892 Ga0501039_0139477
893 Ga0501039_0193996
894 Ga0501039_0416748
895 Ga0501040_0009942
896 Ga0501040_0013159
897 Ga0501040_0247951
898 Ga0501040_0312879
899 Ga0501041_0003604
900 Ga0501041_0004463
901 Ga0501041_0133175
902 Ga0501041_0249599
903 Ga0501042_0008539
904 Ga0501042_0155130
905 Ga0501043_0017802
906 Ga0501043_0050755
907 Ga0501046_0020525
908 Ga0501046_0821874
909 Ga0501047_0023880
910 Ga0501047_0146691
911 Ga0501047_0781227
912 Ga0501048_0077756
913 Ga0501048_0120685
914 Ga0501048_0441558
915 Ga0501048_0481456
916 Ga0501067_0295074
917 Ga0501067_0504869
918 Ga0501068_0003598
919 Ga0501068_0048208
920 Ga0501068_0050293
921 Ga0501068_0082353
922 Ga0501068_0256786
923 Ga0501069_0046950
924 Ga0501069_0068580
925 Ga0501069_0151323
926 Ga0501069_0188813
927 Ga0501069_0300120
928 Ga0501070_0028280
929 Ga0501070_0066676
930 Ga0501070_0364591
931 Ga0501071_0003985
932 Ga0501071_0027218
933 Ga0501071_0043838
934 Ga0501071_0076926
935 Ga0501072_0003319
936 Ga0501072_0014174
937 Ga0501072_0086844
938 Ga0501072_0119328
939 Ga0501072_0402263
940 Ga0501072_0498168
941 Ga0501073_0014950
942 Ga0501073_0155730
943 Ga0501074_0005733
944 Ga0501074_0058530
945 Ga0501075_0021551
946 Ga0501075_0084780
947 Ga0501076_0015809
948 Ga0501076_0021276
949 Ga0501076_0049538
950 Ga0501076_0498166
951 Ga0501076_0621541
952 Ga0501076_0962149
953 Ga0501077_0022136
954 Ga0501077_0072846
955 Ga0501079_0010743
956 Ga0501079_0015206
957 Ga0501079_0293710
958 Ga0501079_0997657
959 Ga0501080_0041457
960 Ga0501080_0043439
961 Ga0501080_0999745
962 Ga0501081_0013810
963 Ga0501081_0022263
964 Ga0501081_0462759
965 Ga0501083_0361757
966 Ga0501083_0737978
967 Ga0501035_0043823
968 Ga0501035_0116940
969 Ga0501044_0026003
970 Ga0501044_0132032
971 Ga0501044_0611572
972 Ga0501045_0011952
973 Ga0501045_0015582
974 Ga0501045_0021374
975 Ga0501045_0024020
976 nmdc:mga00v17_332795_c1
977 nmdc:mga0yw44_10705_c1
978 nmdc:mga0yw44_244871_c1
979 nmdc:mga08y16_325969_c1
980 nmdc:mga08y16_5680_c2
981 nmdc:mga08y16_582479_c1
982 nmdc:mga08y16_72689_c1
983 nmdc:mga08y16_84800_c1
984 nmdc:mga0a205_33225_c1
985 nmdc:mga0a205_551107_c1
986 nmdc:mga0a205_677850_c1
987 Ga0501084_0011205
988 Ga0501084_0026091
989 Ga0501084_0098693
990 Ga0501084_0598074
991 Ga0501084_1022025
992 Ga0501082_0011086
993 Ga0501082_0029060
994 Ga0501082_0086192
995 Ga0501082_0820429
996 Ga0530510_0013561
997 Ga0530510_0018495
998 Ga0530510_0019938
999 Ga0530510_0418808
1000 Ga0530510_0443075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

6

154

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f0d-assembly2.cif.gz_D high resolution crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphatase synthase from burkholderia pseudomallei 0.9882 6 161
3t80-assembly2.cif.gz_D crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine 0.9861 6 158
5l12-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9854 6 161
5iwx-assembly1.cif.gz_A crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9838 6 160
1t0a-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from shewanella oneidensis 0.9834 6 161
ID Description Score Start End Superfamily
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9773 6 158 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.966 6 162 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9657 6 162 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9649 6 161 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9604 6 161 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A7W0UDF0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9963 2 160 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A7V1N0S0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9963 6 160 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A3A9AWQ2-F1-model_v4 deleted 0.9962 6 160
AF-S0G250-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9961 6 161 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1Q6V5J0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9959 6 160 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Map