F455515

General Info

Members Datasets Scaffolds Average Seq Length
500 187 1000 271

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10004813|Ga0070717_100048132
Length 287
Sequence MMMAVSFERYGRLYYLDPGAYSPSIGDKVLVPTDSGPEVAECIWAPQWVSEEVGGLPVCAGLASQADLARNETNRRKRAEAKVAARRLVREHGLPMKVTAVDYLDPRDGTPSGPTVVVIYFSAPHRVDFRALVRDLAGRLRARVELRQIGPRDEARLQGGIGPCGRDLCCATFLKDFEPVSVRMAKDQDLPVNPLRIAKYEHPLYQEFHEQAPKIGEEVESPEGPGTVVGYNVPSDTVVMKLTADGRRCACSRASVCGSRQAYEAKYQAPEEAAGSGSAAGSDGDPG

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
187 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 1.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 4
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10004813 3300006028 Bacteria 9819
2 Ga0070658_10001733 3300005327 Bacteria 18381
3 Ga0070683_100177844 3300005329 Bacteria 2020
4 Ga0070690_100026333 3300005330 Bacteria 3587
5 Ga0070680_100000141 3300005336 Bacteria 43838
6 Ga0070680_100159058 3300005336 Bacteria 1898
7 Ga0070680_100204100 3300005336 Bacteria 1667
8 Ga0070660_100047500 3300005339 Bacteria 3295
9 Ga0070660_100348138 3300005339 Bacteria 1220
10 Ga0070660_100350443 3300005339 Bacteria 1216
11 Ga0070671_100169585 3300005355 Bacteria 1846
12 Ga0070659_100000415 3300005366 Bacteria 32411
13 Ga0070659_100001235 3300005366 Bacteria 18545
14 Ga0070667_100027849 3300005367 Bacteria 4703
15 Ga0070709_10036171 3300005434 Bacteria 3006
16 Ga0070709_10056864 3300005434 Bacteria 2476
17 Ga0070709_10132452 3300005434 Bacteria 1703
18 Ga0070709_10133988 3300005434 Bacteria 1695
19 Ga0070714_100061477 3300005435 Bacteria 3226
20 Ga0070714_100341599 3300005435 Bacteria 1404
21 Ga0070714_100472600 3300005435 Bacteria 1193
22 Ga0070713_100111039 3300005436 Bacteria 2390
23 Ga0070713_100123987 3300005436 Bacteria 2270
24 Ga0070713_100193739 3300005436 Bacteria 1833
25 Ga0070710_10000280 3300005437 Bacteria 24115
26 Ga0070710_10007351 3300005437 Bacteria 5331
27 Ga0070710_10028643 3300005437 Bacteria 2981
28 Ga0070710_10183558 3300005437 Bacteria 1311
29 Ga0070711_100020949 3300005439 Bacteria 4222
30 Ga0070711_100021086 3300005439 Bacteria 4209
31 Ga0070708_100002556 3300005445 Bacteria 14073
32 Ga0070708_100022993 3300005445 Bacteria 5294
33 Ga0070708_100087673 3300005445 Bacteria 2829
34 Ga0070708_100250843 3300005445 Bacteria 1663
35 Ga0070708_100343992 3300005445 Bacteria 1405
36 Ga0070662_100261513 3300005457 Bacteria 1394
37 Ga0070681_10000038 3300005458 Bacteria 94717
38 Ga0070681_10009110 3300005458 Bacteria 9754
39 Ga0070681_10020719 3300005458 Bacteria 6587
40 Ga0070681_10131058 3300005458 Bacteria 2439
41 Ga0070706_100002465 3300005467 Bacteria 18649
42 Ga0070706_100008418 3300005467 Bacteria 9609
43 Ga0070706_100036051 3300005467 Bacteria 4568
44 Ga0070706_100041250 3300005467 Bacteria 4261
45 Ga0070706_100064862 3300005467 Bacteria 3376
46 Ga0070706_100073168 3300005467 Bacteria 3171
47 Ga0070706_100171067 3300005467 Bacteria 2028
48 Ga0070706_100602675 3300005467 Bacteria 1021
49 Ga0070707_100005590 3300005468 Bacteria 11747
50 Ga0070707_100008378 3300005468 Bacteria 9601
51 Ga0070707_100069315 3300005468 Bacteria 3395
52 Ga0070707_100186986 3300005468 Bacteria 2020
53 Ga0070707_100248630 3300005468 Bacteria 1730
54 Ga0070707_100283875 3300005468 Bacteria 1609
55 Ga0070698_100000045 3300005471 Bacteria 87520
56 Ga0070698_100003802 3300005471 Bacteria 16587
57 Ga0070698_100005001 3300005471 Bacteria 14524
58 Ga0070698_100032639 3300005471 Bacteria 5391
59 Ga0070698_100041673 3300005471 Bacteria 4713
60 Ga0070698_100049166 3300005471 Bacteria 4306
61 Ga0070698_100212136 3300005471 Bacteria 1871
62 Ga0070699_100001685 3300005518 Bacteria 20113
63 Ga0070699_100592422 3300005518 Bacteria 1011
64 Ga0070679_100000016 3300005530 Bacteria 139454
65 Ga0070679_100046139 3300005530 Bacteria 4342
66 Ga0070679_100106385 3300005530 Bacteria 2791
67 Ga0070679_100108940 3300005530 Bacteria 2756
68 Ga0070697_100014235 3300005536 Bacteria 6250
69 Ga0070697_100221955 3300005536 Bacteria 1611
70 Ga0068853_100100255 3300005539 Bacteria 2560
71 Ga0070686_100036637 3300005544 Bacteria 3039
72 Ga0070693_100192605 3300005547 Bacteria 1319
73 Ga0070665_100012780 3300005548 Bacteria 8458
74 Ga0070665_100338493 3300005548 Bacteria 1509
75 Ga0070665_100718090 3300005548 Bacteria 1012
76 Ga0070704_100186477 3300005549 Bacteria 1664
77 Ga0068855_100005376 3300005563 Bacteria 15620
78 Ga0068854_100001392 3300005578 Bacteria 14572
79 Ga0068856_100006922 3300005614 Bacteria 11092
80 Ga0068856_100074021 3300005614 Bacteria 3372
81 Ga0068858_100340787 3300005842 Bacteria 1435
82 Ga0081540_1003229 3300005983 Bacteria 12994
83 Ga0070717_10010396 3300006028 Bacteria 7025
84 Ga0070717_10034365 3300006028 Bacteria 4098
85 Ga0070717_10122438 3300006028 Bacteria 2229
86 Ga0070717_10143988 3300006028 Bacteria 2057
87 Ga0070717_10227742 3300006028 Bacteria 1640
88 Ga0070715_10068084 3300006163 Bacteria 1582
89 Ga0070716_100018849 3300006173 Bacteria 3599
90 Ga0070716_100029916 3300006173 Bacteria 2950
91 Ga0070712_100048993 3300006175 Bacteria 2931
92 Ga0070712_100405749 3300006175 Bacteria 1127
93 Ga0075433_10204255 3300006852 Bacteria 1756
94 Ga0075434_100263864 3300006871 Bacteria 1741
95 Ga0075434_100640140 3300006871 Bacteria 1082
96 Ga0075436_100005574 3300006914 Bacteria 8644
97 Ga0075436_100077738 3300006914 Bacteria 2298
98 Ga0075435_100197165 3300007076 Bacteria 1705
99 Ga0075435_100239362 3300007076 Bacteria 1543
100 Ga0099794_10104422 3300007265 Bacteria 1416
101 Ga0105240_10207684 3300009093 Bacteria 2290
102 Ga0105240_10318522 3300009093 Bacteria 1773
103 Ga0105245_10574919 3300009098 Bacteria 1151
104 Ga0114129_10055908 3300009147 Bacteria 5530
105 Ga0105241_10039898 3300009174 Bacteria 3542
106 Ga0105241_10492109 3300009174 Bacteria 1092
107 Ga0105237_10029363 3300009545 Bacteria 5590
108 Ga0105237_10099072 3300009545 Bacteria 2906
109 Ga0105238_10027434 3300009551 Bacteria 5803
110 Ga0105239_10038389 3300010375 Bacteria 5248
111 Ga0157369_10002668 3300013105 Bacteria 21274
112 Ga0157369_10003779 3300013105 Bacteria 18002
113 Ga0157369_10005662 3300013105 Bacteria 14514
114 Ga0157369_10010502 3300013105 Bacteria 10539
115 Ga0157369_10080206 3300013105 Bacteria 3495
116 Ga0157369_10118517 3300013105 Bacteria 2810
117 Ga0157374_10064370 3300013296 Bacteria 3441
118 Ga0157372_10711654 3300013307 Bacteria 1168
119 Ga0157375_10008436 3300013308 Bacteria 9026
120 Ga0157376_10146108 3300014969 Bacteria 2127
121 Ga0197907_10389062 3300020069 Bacteria 2143
122 Ga0197907_10426641 3300020069 Bacteria 2008
123 Ga0197907_11374872 3300020069 Bacteria 1044
124 Ga0206353_11556915 3300020082 Bacteria 1949
125 Ga0206353_11834524 3300020082 Bacteria 1043
126 Ga0206353_11928085 3300020082 Bacteria 1783
127 Ga0213876_10001852 3300021384 Bacteria 12746
128 Ga0224712_10204376 3300022467 Bacteria 899
129 Ga0224572_1000446 3300024225 Bacteria 4829
130 Ga0207692_10001374 3300025898 Bacteria 9097
131 Ga0207692_10019391 3300025898 Bacteria 3073
132 Ga0207692_10020561 3300025898 Bacteria 3005
133 Ga0207692_10037410 3300025898 Bacteria 2374
134 Ga0207647_10005491 3300025904 Bacteria 9281
135 Ga0207699_10002646 3300025906 Bacteria 8454
136 Ga0207699_10003956 3300025906 Bacteria 7086
137 Ga0207705_10002348 3300025909 Bacteria 14626
138 Ga0207705_10174887 3300025909 Bacteria 1618
139 Ga0207705_10381738 3300025909 Bacteria 1088
140 Ga0207684_10002592 3300025910 Bacteria 18109
141 Ga0207684_10003713 3300025910 Bacteria 14784
142 Ga0207684_10018428 3300025910 Bacteria 5977
143 Ga0207684_10141379 3300025910 Bacteria 2069
144 Ga0207684_10440445 3300025910 Bacteria 1119
145 Ga0207654_10057129 3300025911 Bacteria 2267
146 Ga0207707_10000085 3300025912 Bacteria 94740
147 Ga0207707_10014939 3300025912 Bacteria 6760
148 Ga0207707_10052662 3300025912 Bacteria 3543
149 Ga0207695_10001544 3300025913 Bacteria 37922
150 Ga0207671_10000328 3300025914 Bacteria 69635
151 Ga0207671_10021725 3300025914 Bacteria 4863
152 Ga0207693_10019948 3300025915 Bacteria 5332
153 Ga0207693_10020898 3300025915 Bacteria 5204
154 Ga0207693_10022122 3300025915 Bacteria 5055
155 Ga0207693_10113700 3300025915 Bacteria 2124
156 Ga0207693_10163396 3300025915 Bacteria 1752
157 Ga0207663_10049533 3300025916 Bacteria 2606
158 Ga0207663_10301031 3300025916 Bacteria 1198
159 Ga0207660_10000359 3300025917 Bacteria 29714
160 Ga0207660_10017533 3300025917 Bacteria 4759
161 Ga0207660_10130384 3300025917 Bacteria 1913
162 Ga0207660_10234642 3300025917 Bacteria 1443
163 Ga0207657_10061444 3300025919 Bacteria 3221
164 Ga0207657_10116082 3300025919 Bacteria 2206
165 Ga0207652_10000015 3300025921 Bacteria 193042
166 Ga0207652_10073068 3300025921 Bacteria 2983
167 Ga0207646_10000788 3300025922 Bacteria 41124
168 Ga0207646_10003008 3300025922 Bacteria 19428
169 Ga0207646_10018938 3300025922 Bacteria 6408
170 Ga0207646_10032754 3300025922 Bacteria 4702
171 Ga0207646_10087148 3300025922 Bacteria 2794
172 Ga0207646_10175706 3300025922 Bacteria 1934
173 Ga0207646_10279700 3300025922 Bacteria 1508
174 Ga0207694_10003715 3300025924 Bacteria 12091
175 Ga0207700_10004374 3300025928 Bacteria 8318
176 Ga0207700_10038625 3300025928 Bacteria 3467
177 Ga0207700_10068582 3300025928 Bacteria 2719
178 Ga0207700_10098835 3300025928 Bacteria 2322
179 Ga0207700_10501327 3300025928 Bacteria 1074
180 Ga0207664_10015272 3300025929 Bacteria 5567
181 Ga0207664_10067035 3300025929 Bacteria 2879
182 Ga0207664_10246565 3300025929 Bacteria 1557
183 Ga0207664_10375020 3300025929 Bacteria 1262
184 Ga0207690_10000636 3300025932 Bacteria 22491
185 Ga0207690_10002637 3300025932 Bacteria 10799
186 Ga0207706_10350256 3300025933 Bacteria 1284
187 Ga0207665_10006975 3300025939 Bacteria 7478
188 Ga0207665_10017526 3300025939 Bacteria 4707
189 Ga0207665_10023373 3300025939 Bacteria 4072
190 Ga0207665_10121195 3300025939 Bacteria 1848
191 Ga0207667_10236422 3300025949 Bacteria 1870
192 Ga0207640_10006800 3300025981 Bacteria 6289
193 Ga0207639_10079286 3300026041 Bacteria 2595
194 Ga0207678_10139066 3300026067 Bacteria 2072
195 Ga0207702_10067892 3300026078 Bacteria 3062
196 Ga0207702_10197309 3300026078 Bacteria 1864
197 Ga0207702_10203327 3300026078 Bacteria 1837
198 Ga0207702_10390289 3300026078 Bacteria 1340
199 Ga0268266_10012426 3300028379 Bacteria 7362
200 Ga0268266_10401004 3300028379 Bacteria 1297
201 Ga0265336_10016723 3300028666 Bacteria 2397
202 Ga0265338_10020836 3300028800 Bacteria 6871
203 Ga0373926_0002022 3300035083 Bacteria 6376
204 Ga0373928_0003912 3300035084 Bacteria 2840
205 Ga0373934_0000042 3300035086 Bacteria 42219
206 Ga0373934_0021923 3300035086 Bacteria 2462
207 Ga0373923_0011037 3300035111 Bacteria 3304
208 Ga0373923_0014747 3300035111 Bacteria 2941
209 Ga0373923_0033332 3300035111 Bacteria 2085
210 Ga0373923_0039807 3300035111 Bacteria 1932
211 Ga0373936_0002453 3300035113 Bacteria 6937
212 Ga0373936_0006923 3300035113 Bacteria 4267
213 Ga0373936_0008102 3300035113 Bacteria 3951
214 Ga0373936_0042554 3300035113 Bacteria 1824
215 Ga0373936_0068147 3300035113 Bacteria 1463
216 Ga0373939_0006046 3300035114 Bacteria 2904
217 Ga0373941_0017308 3300035115 Bacteria 1973
218 Ga0373953_0000135 3300035117 Bacteria 18303
219 Ga0373953_0028755 3300035117 Bacteria 2146
220 Ga0373953_0053241 3300035117 Bacteria 1640
221 Ga0373953_0071645 3300035117 Bacteria 1430
222 Ga0373954_0056898 3300035118 Bacteria 1841
223 Ga0373954_0057408 3300035118 Bacteria 1833
224 Ga0373954_0149893 3300035118 Bacteria 1139
225 Ga0373956_0000834 3300035119 Bacteria 12807
226 Ga0373956_0016207 3300035119 Bacteria 3127
227 Ga0373956_0023525 3300035119 Bacteria 2645
228 Ga0373956_0028942 3300035119 Bacteria 2414
229 Ga0373957_0000085 3300035120 Bacteria 22122
230 Ga0373957_0010321 3300035120 Bacteria 3083
231 Ga0373957_0075238 3300035120 Bacteria 1326
232 Ga0373957_0150717 3300035120 Bacteria 954
233 Ga0373960_0008001 3300035121 Bacteria 2520
234 Ga0373943_0068285 3300035170 Bacteria 1794
235 Ga0373943_0144835 3300035170 Bacteria 1283
236 Ga0373946_0000568 3300035171 Bacteria 12188
237 Ga0373955_0001095 3300035172 Bacteria 11501
238 Ga0373955_0005226 3300035172 Bacteria 5818
239 Ga0373955_0026659 3300035172 Bacteria 2980
240 Ga0373955_0028663 3300035172 Bacteria 2889
241 Ga0373955_0035650 3300035172 Bacteria 2635
242 Ga0373942_0084247 3300035207 Bacteria 949
243 Ga0373924_0000482 3300035410 Bacteria 12190
244 Ga0373924_0005164 3300035410 Bacteria 4610
245 Ga0373924_0020950 3300035410 Bacteria 2546
246 Ga0373924_0037181 3300035410 Bacteria 1981
247 Ga0373924_0057500 3300035410 Bacteria 1622
248 Ga0373935_0002179 3300035692 Bacteria 11129
249 Ga0373935_0013520 3300035692 Bacteria 4926
250 Ga0373935_0046995 3300035692 Bacteria 2727
251 Ga0373935_0485047 3300035692 Bacteria 896
252 Ga0373927_0002116 3300035695 Bacteria 14633
253 Ga0373933_0000931 3300035724 Bacteria 17852
254 Ga0373933_0000986 3300035724 Bacteria 17381
255 Ga0373933_0013459 3300035724 Bacteria 4535
256 Ga0373933_0022326 3300035724 Bacteria 3602
257 Ga0373933_0036567 3300035724 Bacteria 2875
258 Ga0373933_0052370 3300035724 Bacteria 2442
259 Ga0373947_0001471 3300035725 Bacteria 14505
260 Ga0373947_0061791 3300035725 Bacteria 2277
261 Ga0373937_0001918 3300036401 Bacteria 17381
262 Ga0373937_0014129 3300036401 Bacteria 7041
263 Ga0373937_0034169 3300036401 Bacteria 4624
264 Ga0373937_0043923 3300036401 Bacteria 4081
265 Ga0373937_0123951 3300036401 Bacteria 2409
266 Ga0373925_0003609 3300037068 Bacteria 11925
267 Ga0373925_0062015 3300037068 Bacteria 2810
268 Ga0373925_0111189 3300037068 Bacteria 2116
269 Ga0373925_0154590 3300037068 Bacteria 1803
270 Ga0395900_0226074 3300037418 Bacteria 1884
271 Ga0436364_0375473 3300037853 Bacteria 19996
272 Ga0436364_0932226 3300037853 Bacteria 1480
273 Ga0395901_0145518 3300038443 Bacteria 2491
274 Ga0436365_1121404 3300039437 Bacteria 19951
275 Ga0436363_0539752 3300039450 Bacteria 2198
276 Ga0436363_1605063 3300039450 Bacteria 1339
277 Ga0436362_0030334 3300039453 Bacteria 961
278 Ga0436362_0761962 3300039453 Bacteria 1914
279 Ga0466969_0008726 3300044656 Bacteria 5375
280 Ga0466969_0087582 3300044656 Bacteria 1479
281 Ga0466966_0072607 3300044684 Bacteria 2154
282 Ga0466966_0084218 3300044684 Bacteria 1978
283 Ga0466961_0006780 3300044693 Bacteria 7290
284 Ga0466961_0008716 3300044693 Bacteria 6465
285 Ga0466961_0013736 3300044693 Bacteria 5189
286 Ga0466961_0115038 3300044693 Bacteria 1691
287 Ga0466961_0157873 3300044693 Bacteria 1414
288 Ga0466961_0166447 3300044693 Bacteria 1372
289 Ga0466970_0044861 3300044765 Bacteria 2354
290 Ga0466970_0214245 3300044765 Bacteria 1074
291 Ga0466957_0046519 3300044842 Bacteria 2634
292 Ga0466959_0163900 3300045049 Bacteria 1562
293 Ga0466958_0026814 3300045836 Bacteria 3406
294 Ga0466967_0000799 3300045976 Bacteria 16449
295 Ga0466967_0017359 3300045976 Bacteria 5711
296 Ga0466967_0019250 3300045976 Bacteria 5485
297 Ga0466967_0484285 3300045976 Bacteria 1212
298 Ga0466967_0730915 3300045976 Bacteria 981
299 Ga0495592_0001289 3300046454 Bacteria 17381
300 Ga0495592_0011963 3300046454 Bacteria 6577
301 Ga0495592_0061403 3300046454 Bacteria 2762
302 Ga0495592_0145581 3300046454 Bacteria 1643
303 Ga0495592_0153503 3300046454 Bacteria 1590
304 Ga0495629_0021515 3300046459 Bacteria 4602
305 Ga0495629_0072903 3300046459 Bacteria 2398
306 Ga0495641_0013901 3300046461 Bacteria 4388
307 Ga0495651_0000402 3300046462 Bacteria 33417
308 Ga0495651_0001630 3300046462 Bacteria 17381
309 Ga0495651_0008112 3300046462 Bacteria 8050
310 Ga0495651_0024913 3300046462 Bacteria 4655
311 Ga0495651_0048999 3300046462 Bacteria 3261
312 Ga0495651_0053534 3300046462 Bacteria 3106
313 Ga0495651_0086375 3300046462 Bacteria 2360
314 Ga0495651_0150738 3300046462 Bacteria 1676
315 Ga0495653_0008379 3300046463 Bacteria 8474
316 Ga0495653_0010052 3300046463 Bacteria 7740
317 Ga0495653_0178875 3300046463 Bacteria 1457
318 Ga0495582_0013571 3300046473 Bacteria 4485
319 Ga0495639_0024166 3300046475 Bacteria 2674
320 Ga0495639_0029142 3300046475 Bacteria 2450
321 Ga0495662_0001925 3300046476 Bacteria 10422
322 Ga0495662_0040208 3300046476 Bacteria 2258
323 Ga0495662_0117610 3300046476 Bacteria 1304
324 Ga0495664_0004783 3300046477 Bacteria 7408
325 Ga0495664_0013913 3300046477 Bacteria 4560
326 Ga0495664_0052991 3300046477 Bacteria 2412
327 Ga0495664_0104825 3300046477 Bacteria 1704
328 Ga0495608_0001399 3300046511 Bacteria 17164
329 Ga0495608_0006210 3300046511 Bacteria 8482
330 Ga0495608_0012084 3300046511 Bacteria 6002
331 Ga0495608_0013682 3300046511 Bacteria 5628
332 Ga0495608_0154071 3300046511 Bacteria 1463
333 Ga0495618_0004955 3300046514 Bacteria 8137
334 Ga0495618_0066629 3300046514 Bacteria 2289
335 Ga0495618_0105471 3300046514 Bacteria 1804
336 Ga0495628_0001970 3300046516 Bacteria 18609
337 Ga0495628_0022534 3300046516 Bacteria 5174
338 Ga0495628_0048216 3300046516 Bacteria 3377
339 Ga0495628_0054205 3300046516 Bacteria 3161
340 Ga0495628_0064661 3300046516 Bacteria 2863
341 Ga0495628_0104281 3300046516 Bacteria 2185
342 Ga0495628_0177734 3300046516 Bacteria 1611
343 Ga0495628_0276482 3300046516 Bacteria 1248
344 Ga0495630_0011468 3300046517 Bacteria 6417
345 Ga0495630_0064405 3300046517 Bacteria 2754
346 Ga0495652_0000199 3300046529 Bacteria 69104
347 Ga0495652_0001351 3300046529 Bacteria 27324
348 Ga0495652_0012573 3300046529 Bacteria 7635
349 Ga0495652_0028886 3300046529 Bacteria 4874
350 Ga0495652_0034373 3300046529 Bacteria 4418
351 Ga0495652_0066261 3300046529 Bacteria 3031
352 Ga0495652_0072927 3300046529 Bacteria 2860
353 Ga0495665_0002432 3300046531 Bacteria 10061
354 Ga0495665_0063492 3300046531 Bacteria 1949
355 Ga0495665_0066374 3300046531 Bacteria 1904
356 Ga0495640_0023238 3300046533 Bacteria 4523
357 Ga0495640_0024117 3300046533 Bacteria 4426
358 Ga0495640_0128663 3300046533 Bacteria 1640
359 Ga0495587_0001154 3300046536 Bacteria 17364
360 Ga0495587_0029687 3300046536 Bacteria 3318
361 Ga0495587_0080407 3300046536 Bacteria 1889
362 Ga0495587_0120016 3300046536 Bacteria 1506
363 Ga0495645_0006660 3300046543 Bacteria 8025
364 Ga0495645_0017410 3300046543 Bacteria 5146
365 Ga0495645_0019677 3300046543 Bacteria 4863
366 Ga0495645_0031476 3300046543 Bacteria 3866
367 Ga0495645_0118315 3300046543 Bacteria 1868
368 Ga0495645_0223686 3300046543 Bacteria 1264
369 Ga0495622_0045367 3300046557 Bacteria 2042
370 Ga0495667_0000847 3300046559 Bacteria 19788
371 Ga0495667_0001053 3300046559 Bacteria 17924
372 Ga0495667_0018883 3300046559 Bacteria 4656
373 Ga0495667_0033848 3300046559 Bacteria 3418
374 Ga0495667_0053655 3300046559 Bacteria 2654
375 Ga0495634_0011249 3300046642 Bacteria 6522
376 Ga0495634_0013139 3300046642 Bacteria 5983
377 Ga0495634_0035492 3300046642 Bacteria 3414
378 Ga0495634_0046509 3300046642 Bacteria 2928
379 Ga0495635_0004508 3300046663 Bacteria 9647
380 Ga0495635_0012528 3300046663 Bacteria 5941
381 Ga0495635_0035748 3300046663 Bacteria 3444
382 Ga0495635_0079281 3300046663 Bacteria 2247
383 Ga0495635_0255848 3300046663 Bacteria 1180
384 Ga0495657_0000305 3300046675 Bacteria 44779
385 Ga0495657_0002955 3300046675 Bacteria 14090
386 Ga0495657_0020471 3300046675 Bacteria 4754
387 Ga0495657_0039670 3300046675 Bacteria 3234
388 Ga0495657_0054785 3300046675 Bacteria 2662
389 Ga0495657_0054895 3300046675 Bacteria 2659
390 Ga0495599_0000311 3300046678 Bacteria 29221
391 Ga0495599_0034354 3300046678 Bacteria 3185
392 Ga0495599_0036881 3300046678 Bacteria 3071
393 Ga0495599_0057293 3300046678 Bacteria 2438
394 Ga0495599_0135094 3300046678 Bacteria 1531
395 Ga0495599_0146355 3300046678 Bacteria 1464
396 Ga0495623_0001258 3300046679 Bacteria 17208
397 Ga0495623_0025003 3300046679 Bacteria 3847
398 Ga0495623_0041568 3300046679 Bacteria 2931
399 Ga0495623_0045175 3300046679 Bacteria 2798
400 Ga0495623_0054946 3300046679 Bacteria 2511
401 Ga0495623_0140040 3300046679 Bacteria 1440
402 Ga0495646_0002608 3300046680 Bacteria 11121
403 Ga0495646_0011612 3300046680 Bacteria 5596
404 Ga0495646_0021825 3300046680 Bacteria 4043
405 Ga0495646_0049582 3300046680 Bacteria 2548
406 Ga0495658_0011661 3300046683 Bacteria 4428
407 Ga0495658_0082199 3300046683 Bacteria 1892
408 Ga0495658_0153637 3300046683 Bacteria 1415
409 Ga0495658_0171650 3300046683 Bacteria 1342
410 Ga0495613_0027423 3300046689 Bacteria 4238
411 Ga0495624_0012638 3300046690 Bacteria 5765
412 Ga0495624_0091047 3300046690 Bacteria 1882
413 Ga0495624_0097680 3300046690 Bacteria 1809
414 Ga0495600_0002422 3300046809 Bacteria 10702
415 Ga0495600_0007150 3300046809 Bacteria 6815
416 Ga0495600_0008346 3300046809 Bacteria 6360
417 Ga0495600_0018887 3300046809 Bacteria 4398
418 Ga0495600_0083901 3300046809 Bacteria 2079
419 Ga0495600_0252544 3300046809 Bacteria 1121
420 Ga0495581_0009715 3300047315 Bacteria 5568
421 Ga0495581_0014989 3300047315 Bacteria 4498
422 Ga0495604_0001815 3300047317 Bacteria 17381
423 Ga0495604_0012580 3300047317 Bacteria 6730
424 Ga0495604_0036652 3300047317 Bacteria 3866
425 Ga0495604_0040477 3300047317 Bacteria 3659
426 Ga0495604_0050469 3300047317 Bacteria 3230
427 Ga0495604_0053099 3300047317 Bacteria 3135
428 Ga0495604_0070274 3300047317 Bacteria 2651
429 Ga0495674_0035083 3300047319 Bacteria 4528
430 Ga0495674_0046950 3300047319 Bacteria 3831
431 Ga0495674_0068976 3300047319 Bacteria 3058
432 Ga0495674_0078482 3300047319 Bacteria 2836
433 Ga0495676_0002142 3300047321 Bacteria 17453
434 Ga0495680_0002941 3300047322 Bacteria 17052
435 Ga0495680_0003515 3300047322 Bacteria 15373
436 Ga0495680_0012480 3300047322 Bacteria 7475
437 Ga0495680_0028637 3300047322 Bacteria 4566
438 Ga0495680_0029662 3300047322 Bacteria 4477
439 Ga0495680_0045144 3300047322 Bacteria 3480
440 Ga0495680_0076452 3300047322 Bacteria 2538
441 Ga0495675_0000544 3300047444 Bacteria 24395
442 Ga0495675_0011673 3300047444 Bacteria 5516
443 Ga0495675_0012427 3300047444 Bacteria 5360
444 Ga0495675_0019063 3300047444 Bacteria 4357
445 Ga0495684_0004014 3300047471 Bacteria 11477
446 Ga0495684_0066563 3300047471 Bacteria 2739
447 Ga0495593_0024433 3300047673 Bacteria 3349
448 Ga0495593_0082419 3300047673 Bacteria 1662
449 Ga0495593_0167965 3300047673 Bacteria 1106
450 Ga0495602_0003050 3300048088 Bacteria 17196
451 Ga0495602_0012551 3300048088 Bacteria 8697
452 Ga0495602_0098514 3300048088 Bacteria 2405
453 Ga0495602_0124055 3300048088 Bacteria 2072
454 Ga0495602_0209770 3300048088 Bacteria 1479
455 Ga0495602_0309798 3300048088 Bacteria 1152
456 Ga0495602_0316946 3300048088 Bacteria 1136
457 Ga0495614_0212381 3300048089 Bacteria 878
458 Ga0496100_0150257 3300048903 Bacteria 1660
459 Ga0496102_0107650 3300048905 Bacteria 2596
460 Ga0496102_0258975 3300048905 Bacteria 1640
461 Ga0496104_0050257 3300048907 Bacteria 3934
462 Ga0496104_0114192 3300048907 Bacteria 2590
463 Ga0496105_0014732 3300048908 Bacteria 6224
464 Ga0496105_0039437 3300048908 Bacteria 3893
465 Ga0496107_0016935 3300048910 Bacteria 5125
466 Ga0496108_0099245 3300048911 Bacteria 2482
467 Ga0496108_0117874 3300048911 Bacteria 2275
468 Ga0496108_0204364 3300048911 Bacteria 1714
469 Ga0496109_0026647 3300048912 Bacteria 5157
470 Ga0496109_0033500 3300048912 Bacteria 4622
471 Ga0496109_0204504 3300048912 Bacteria 1856
472 Ga0496110_0114477 3300048913 Bacteria 2427
473 Ga0496110_0136307 3300048913 Bacteria 2218
474 Ga0496112_0020575 3300048915 Bacteria 6256
475 Ga0496112_0046118 3300048915 Bacteria 4274
476 Ga0496113_0264107 3300048916 Bacteria 1375
477 Ga0496114_0069431 3300048917 Bacteria 2959
478 Ga0501042_0008155 3300049578 Bacteria 6900
479 nmdc:mga05p37_469795_c1 3300050507 Bacteria 1452
480 nmdc:mga0n895_168076_c1 3300050512 Bacteria 2225
481 nmdc:mga0n895_425236_c1 3300050512 Bacteria 1342
482 nmdc:mga0n895_87409_c1 3300050512 Bacteria 3115
483 nmdc:mga0n895_94686_c1 3300050512 Bacteria 2991
484 nmdc:mga0rr50_7685_c1 3300050513 Bacteria 6674
485 nmdc:mga08x19_30700_c1 3300050514 Bacteria 3377
486 nmdc:mga08x19_71911_c1 3300050514 Bacteria 2255
487 Ga0495601_0031889 3300053077 Bacteria 3277
488 Ga0495601_0071550 3300053077 Bacteria 2215
489 Ga0495601_0079183 3300053077 Bacteria 2106
490 Ga0495601_0179810 3300053077 Bacteria 1383
491 Ga0495601_0202598 3300053077 Bacteria 1296
492 Ga0495612_0019615 3300053078 Bacteria 2708
493 Ga0495595_0001519 3300053084 Bacteria 9073
494 Ga0495595_0030093 3300053084 Bacteria 2433
495 Ga0495619_0008852 3300053085 Bacteria 6363
496 Ga0495619_0009623 3300053085 Bacteria 6096
497 Ga0495619_0137143 3300053085 Bacteria 1683
498 Ga0500573_0029761 3300053140 Bacteria 3148
499 2837271589 2837268691 Bacteria 7850704
500 2868094153 2868088558 Bacteria 7609351
501 Ga0070717_10004813
502 Ga0070658_10001733
503 Ga0070683_100177844
504 Ga0070690_100026333
505 Ga0070680_100000141
506 Ga0070680_100159058
507 Ga0070680_100204100
508 Ga0070660_100047500
509 Ga0070660_100348138
510 Ga0070660_100350443
511 Ga0070671_100169585
512 Ga0070659_100000415
513 Ga0070659_100001235
514 Ga0070667_100027849
515 Ga0070709_10036171
516 Ga0070709_10056864
517 Ga0070709_10132452
518 Ga0070709_10133988
519 Ga0070714_100061477
520 Ga0070714_100341599
521 Ga0070714_100472600
522 Ga0070713_100111039
523 Ga0070713_100123987
524 Ga0070713_100193739
525 Ga0070710_10000280
526 Ga0070710_10007351
527 Ga0070710_10028643
528 Ga0070710_10183558
529 Ga0070711_100020949
530 Ga0070711_100021086
531 Ga0070708_100002556
532 Ga0070708_100022993
533 Ga0070708_100087673
534 Ga0070708_100250843
535 Ga0070708_100343992
536 Ga0070662_100261513
537 Ga0070681_10000038
538 Ga0070681_10009110
539 Ga0070681_10020719
540 Ga0070681_10131058
541 Ga0070706_100002465
542 Ga0070706_100008418
543 Ga0070706_100036051
544 Ga0070706_100041250
545 Ga0070706_100064862
546 Ga0070706_100073168
547 Ga0070706_100171067
548 Ga0070706_100602675
549 Ga0070707_100005590
550 Ga0070707_100008378
551 Ga0070707_100069315
552 Ga0070707_100186986
553 Ga0070707_100248630
554 Ga0070707_100283875
555 Ga0070698_100000045
556 Ga0070698_100003802
557 Ga0070698_100005001
558 Ga0070698_100032639
559 Ga0070698_100041673
560 Ga0070698_100049166
561 Ga0070698_100212136
562 Ga0070699_100001685
563 Ga0070699_100592422
564 Ga0070679_100000016
565 Ga0070679_100046139
566 Ga0070679_100106385
567 Ga0070679_100108940
568 Ga0070697_100014235
569 Ga0070697_100221955
570 Ga0068853_100100255
571 Ga0070686_100036637
572 Ga0070693_100192605
573 Ga0070665_100012780
574 Ga0070665_100338493
575 Ga0070665_100718090
576 Ga0070704_100186477
577 Ga0068855_100005376
578 Ga0068854_100001392
579 Ga0068856_100006922
580 Ga0068856_100074021
581 Ga0068858_100340787
582 Ga0081540_1003229
583 Ga0070717_10010396
584 Ga0070717_10034365
585 Ga0070717_10122438
586 Ga0070717_10143988
587 Ga0070717_10227742
588 Ga0070715_10068084
589 Ga0070716_100018849
590 Ga0070716_100029916
591 Ga0070712_100048993
592 Ga0070712_100405749
593 Ga0075433_10204255
594 Ga0075434_100263864
595 Ga0075434_100640140
596 Ga0075436_100005574
597 Ga0075436_100077738
598 Ga0075435_100197165
599 Ga0075435_100239362
600 Ga0099794_10104422
601 Ga0105240_10207684
602 Ga0105240_10318522
603 Ga0105245_10574919
604 Ga0114129_10055908
605 Ga0105241_10039898
606 Ga0105241_10492109
607 Ga0105237_10029363
608 Ga0105237_10099072
609 Ga0105238_10027434
610 Ga0105239_10038389
611 Ga0157369_10002668
612 Ga0157369_10003779
613 Ga0157369_10005662
614 Ga0157369_10010502
615 Ga0157369_10080206
616 Ga0157369_10118517
617 Ga0157374_10064370
618 Ga0157372_10711654
619 Ga0157375_10008436
620 Ga0157376_10146108
621 Ga0197907_10389062
622 Ga0197907_10426641
623 Ga0197907_11374872
624 Ga0206353_11556915
625 Ga0206353_11834524
626 Ga0206353_11928085
627 Ga0213876_10001852
628 Ga0224712_10204376
629 Ga0224572_1000446
630 Ga0207692_10001374
631 Ga0207692_10019391
632 Ga0207692_10020561
633 Ga0207692_10037410
634 Ga0207647_10005491
635 Ga0207699_10002646
636 Ga0207699_10003956
637 Ga0207705_10002348
638 Ga0207705_10174887
639 Ga0207705_10381738
640 Ga0207684_10002592
641 Ga0207684_10003713
642 Ga0207684_10018428
643 Ga0207684_10141379
644 Ga0207684_10440445
645 Ga0207654_10057129
646 Ga0207707_10000085
647 Ga0207707_10014939
648 Ga0207707_10052662
649 Ga0207695_10001544
650 Ga0207671_10000328
651 Ga0207671_10021725
652 Ga0207693_10019948
653 Ga0207693_10020898
654 Ga0207693_10022122
655 Ga0207693_10113700
656 Ga0207693_10163396
657 Ga0207663_10049533
658 Ga0207663_10301031
659 Ga0207660_10000359
660 Ga0207660_10017533
661 Ga0207660_10130384
662 Ga0207660_10234642
663 Ga0207657_10061444
664 Ga0207657_10116082
665 Ga0207652_10000015
666 Ga0207652_10073068
667 Ga0207646_10000788
668 Ga0207646_10003008
669 Ga0207646_10018938
670 Ga0207646_10032754
671 Ga0207646_10087148
672 Ga0207646_10175706
673 Ga0207646_10279700
674 Ga0207694_10003715
675 Ga0207700_10004374
676 Ga0207700_10038625
677 Ga0207700_10068582
678 Ga0207700_10098835
679 Ga0207700_10501327
680 Ga0207664_10015272
681 Ga0207664_10067035
682 Ga0207664_10246565
683 Ga0207664_10375020
684 Ga0207690_10000636
685 Ga0207690_10002637
686 Ga0207706_10350256
687 Ga0207665_10006975
688 Ga0207665_10017526
689 Ga0207665_10023373
690 Ga0207665_10121195
691 Ga0207667_10236422
692 Ga0207640_10006800
693 Ga0207639_10079286
694 Ga0207678_10139066
695 Ga0207702_10067892
696 Ga0207702_10197309
697 Ga0207702_10203327
698 Ga0207702_10390289
699 Ga0268266_10012426
700 Ga0268266_10401004
701 Ga0265336_10016723
702 Ga0265338_10020836
703 Ga0373926_0002022
704 Ga0373928_0003912
705 Ga0373934_0000042
706 Ga0373934_0021923
707 Ga0373923_0011037
708 Ga0373923_0014747
709 Ga0373923_0033332
710 Ga0373923_0039807
711 Ga0373936_0002453
712 Ga0373936_0006923
713 Ga0373936_0008102
714 Ga0373936_0042554
715 Ga0373936_0068147
716 Ga0373939_0006046
717 Ga0373941_0017308
718 Ga0373953_0000135
719 Ga0373953_0028755
720 Ga0373953_0053241
721 Ga0373953_0071645
722 Ga0373954_0056898
723 Ga0373954_0057408
724 Ga0373954_0149893
725 Ga0373956_0000834
726 Ga0373956_0016207
727 Ga0373956_0023525
728 Ga0373956_0028942
729 Ga0373957_0000085
730 Ga0373957_0010321
731 Ga0373957_0075238
732 Ga0373957_0150717
733 Ga0373960_0008001
734 Ga0373943_0068285
735 Ga0373943_0144835
736 Ga0373946_0000568
737 Ga0373955_0001095
738 Ga0373955_0005226
739 Ga0373955_0026659
740 Ga0373955_0028663
741 Ga0373955_0035650
742 Ga0373942_0084247
743 Ga0373924_0000482
744 Ga0373924_0005164
745 Ga0373924_0020950
746 Ga0373924_0037181
747 Ga0373924_0057500
748 Ga0373935_0002179
749 Ga0373935_0013520
750 Ga0373935_0046995
751 Ga0373935_0485047
752 Ga0373927_0002116
753 Ga0373933_0000931
754 Ga0373933_0000986
755 Ga0373933_0013459
756 Ga0373933_0022326
757 Ga0373933_0036567
758 Ga0373933_0052370
759 Ga0373947_0001471
760 Ga0373947_0061791
761 Ga0373937_0001918
762 Ga0373937_0014129
763 Ga0373937_0034169
764 Ga0373937_0043923
765 Ga0373937_0123951
766 Ga0373925_0003609
767 Ga0373925_0062015
768 Ga0373925_0111189
769 Ga0373925_0154590
770 Ga0395900_0226074
771 Ga0436364_0375473
772 Ga0436364_0932226
773 Ga0395901_0145518
774 Ga0436365_1121404
775 Ga0436363_0539752
776 Ga0436363_1605063
777 Ga0436362_0030334
778 Ga0436362_0761962
779 Ga0466969_0008726
780 Ga0466969_0087582
781 Ga0466966_0072607
782 Ga0466966_0084218
783 Ga0466961_0006780
784 Ga0466961_0008716
785 Ga0466961_0013736
786 Ga0466961_0115038
787 Ga0466961_0157873
788 Ga0466961_0166447
789 Ga0466970_0044861
790 Ga0466970_0214245
791 Ga0466957_0046519
792 Ga0466959_0163900
793 Ga0466958_0026814
794 Ga0466967_0000799
795 Ga0466967_0017359
796 Ga0466967_0019250
797 Ga0466967_0484285
798 Ga0466967_0730915
799 Ga0495592_0001289
800 Ga0495592_0011963
801 Ga0495592_0061403
802 Ga0495592_0145581
803 Ga0495592_0153503
804 Ga0495629_0021515
805 Ga0495629_0072903
806 Ga0495641_0013901
807 Ga0495651_0000402
808 Ga0495651_0001630
809 Ga0495651_0008112
810 Ga0495651_0024913
811 Ga0495651_0048999
812 Ga0495651_0053534
813 Ga0495651_0086375
814 Ga0495651_0150738
815 Ga0495653_0008379
816 Ga0495653_0010052
817 Ga0495653_0178875
818 Ga0495582_0013571
819 Ga0495639_0024166
820 Ga0495639_0029142
821 Ga0495662_0001925
822 Ga0495662_0040208
823 Ga0495662_0117610
824 Ga0495664_0004783
825 Ga0495664_0013913
826 Ga0495664_0052991
827 Ga0495664_0104825
828 Ga0495608_0001399
829 Ga0495608_0006210
830 Ga0495608_0012084
831 Ga0495608_0013682
832 Ga0495608_0154071
833 Ga0495618_0004955
834 Ga0495618_0066629
835 Ga0495618_0105471
836 Ga0495628_0001970
837 Ga0495628_0022534
838 Ga0495628_0048216
839 Ga0495628_0054205
840 Ga0495628_0064661
841 Ga0495628_0104281
842 Ga0495628_0177734
843 Ga0495628_0276482
844 Ga0495630_0011468
845 Ga0495630_0064405
846 Ga0495652_0000199
847 Ga0495652_0001351
848 Ga0495652_0012573
849 Ga0495652_0028886
850 Ga0495652_0034373
851 Ga0495652_0066261
852 Ga0495652_0072927
853 Ga0495665_0002432
854 Ga0495665_0063492
855 Ga0495665_0066374
856 Ga0495640_0023238
857 Ga0495640_0024117
858 Ga0495640_0128663
859 Ga0495587_0001154
860 Ga0495587_0029687
861 Ga0495587_0080407
862 Ga0495587_0120016
863 Ga0495645_0006660
864 Ga0495645_0017410
865 Ga0495645_0019677
866 Ga0495645_0031476
867 Ga0495645_0118315
868 Ga0495645_0223686
869 Ga0495622_0045367
870 Ga0495667_0000847
871 Ga0495667_0001053
872 Ga0495667_0018883
873 Ga0495667_0033848
874 Ga0495667_0053655
875 Ga0495634_0011249
876 Ga0495634_0013139
877 Ga0495634_0035492
878 Ga0495634_0046509
879 Ga0495635_0004508
880 Ga0495635_0012528
881 Ga0495635_0035748
882 Ga0495635_0079281
883 Ga0495635_0255848
884 Ga0495657_0000305
885 Ga0495657_0002955
886 Ga0495657_0020471
887 Ga0495657_0039670
888 Ga0495657_0054785
889 Ga0495657_0054895
890 Ga0495599_0000311
891 Ga0495599_0034354
892 Ga0495599_0036881
893 Ga0495599_0057293
894 Ga0495599_0135094
895 Ga0495599_0146355
896 Ga0495623_0001258
897 Ga0495623_0025003
898 Ga0495623_0041568
899 Ga0495623_0045175
900 Ga0495623_0054946
901 Ga0495623_0140040
902 Ga0495646_0002608
903 Ga0495646_0011612
904 Ga0495646_0021825
905 Ga0495646_0049582
906 Ga0495658_0011661
907 Ga0495658_0082199
908 Ga0495658_0153637
909 Ga0495658_0171650
910 Ga0495613_0027423
911 Ga0495624_0012638
912 Ga0495624_0091047
913 Ga0495624_0097680
914 Ga0495600_0002422
915 Ga0495600_0007150
916 Ga0495600_0008346
917 Ga0495600_0018887
918 Ga0495600_0083901
919 Ga0495600_0252544
920 Ga0495581_0009715
921 Ga0495581_0014989
922 Ga0495604_0001815
923 Ga0495604_0012580
924 Ga0495604_0036652
925 Ga0495604_0040477
926 Ga0495604_0050469
927 Ga0495604_0053099
928 Ga0495604_0070274
929 Ga0495674_0035083
930 Ga0495674_0046950
931 Ga0495674_0068976
932 Ga0495674_0078482
933 Ga0495676_0002142
934 Ga0495680_0002941
935 Ga0495680_0003515
936 Ga0495680_0012480
937 Ga0495680_0028637
938 Ga0495680_0029662
939 Ga0495680_0045144
940 Ga0495680_0076452
941 Ga0495675_0000544
942 Ga0495675_0011673
943 Ga0495675_0012427
944 Ga0495675_0019063
945 Ga0495684_0004014
946 Ga0495684_0066563
947 Ga0495593_0024433
948 Ga0495593_0082419
949 Ga0495593_0167965
950 Ga0495602_0003050
951 Ga0495602_0012551
952 Ga0495602_0098514
953 Ga0495602_0124055
954 Ga0495602_0209770
955 Ga0495602_0309798
956 Ga0495602_0316946
957 Ga0495614_0212381
958 Ga0496100_0150257
959 Ga0496102_0107650
960 Ga0496102_0258975
961 Ga0496104_0050257
962 Ga0496104_0114192
963 Ga0496105_0014732
964 Ga0496105_0039437
965 Ga0496107_0016935
966 Ga0496108_0099245
967 Ga0496108_0117874
968 Ga0496108_0204364
969 Ga0496109_0026647
970 Ga0496109_0033500
971 Ga0496109_0204504
972 Ga0496110_0114477
973 Ga0496110_0136307
974 Ga0496112_0020575
975 Ga0496112_0046118
976 Ga0496113_0264107
977 Ga0496114_0069431
978 Ga0501042_0008155
979 nmdc:mga05p37_469795_c1
980 nmdc:mga0n895_168076_c1
981 nmdc:mga0n895_425236_c1
982 nmdc:mga0n895_87409_c1
983 nmdc:mga0n895_94686_c1
984 nmdc:mga0rr50_7685_c1
985 nmdc:mga08x19_30700_c1
986 nmdc:mga08x19_71911_c1
987 Ga0495601_0031889
988 Ga0495601_0071550
989 Ga0495601_0079183
990 Ga0495601_0179810
991 Ga0495601_0202598
992 Ga0495612_0019615
993 Ga0495595_0001519
994 Ga0495595_0030093
995 Ga0495619_0008852
996 Ga0495619_0009623
997 Ga0495619_0137143
998 Ga0500573_0029761
999 2837271589
1000 2868094153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04468

PSP1

PSP1 C-terminal conserved region

58

149

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnw-assembly7.cif.gz_U crystal structure of the tudor domain of human tdrd3 in complex with an anti-tdrd3 fab 0.8234 207 245
6kco-assembly3.cif.gz_E shuguo pwwp in complex with ssdna 0.8107 206 244
8fak-assembly1.cif.gz_H dna replication fork binding triggers structural changes in the pria dna helicase that regulate the pria-prib replication restart pathway in e. coli 0.801 1 62
5ohq-assembly1.cif.gz_A crystal structure of the kow6-kow7 domain of human dsif 0.799 206 245
2do3-assembly1.cif.gz_A solution structure of the third kow motif of transcription elongation factor spt5 0.7891 208 245
ID Description Score Start End Superfamily
af_Q2G2W9_61_146_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.9003 62 144 3.30.70.790
af_Q9C0V4_646_729_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.8905 63 144 3.30.70.790
af_Q4DEV0_471_557_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8888 65 144 3.30.300.20
af_Q4E3G5_145_231_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.8807 63 144 3.30.70.790
af_A0A1D8PF34_469_554_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.8643 62 141 3.30.70.790
ID Description Score Start End GO Terms
AF-A0A661KJK3-F1-model_v4 PSP1 C-terminal domain-containing protein 0.8988 2 147 GO:0005737
AF-A0A7V0TTD4-F1-model_v4 Stage 0 sporulation protein 0.868 2 142 GO:0005737
AF-A0A7V0TTD4-F1-model_v4 Stage 0 sporulation protein 0.846 2 142 GO:0005737
AF-A0A838SIY0-F1-model_v4 Stage 0 sporulation family protein 0.8254 2 172 GO:0005737
AF-A0A3C0VUD2-F1-model_v4 Stage 0 sporulation protein 0.825 2 130 GO:0005737

Map