F455490

General Info

Members Datasets Scaffolds Average Seq Length
500 209 1000 475

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100068395|Ga0070708_1000683952
Length 544
Sequence MNSLQDDVARVESLAGLSRFRREWRACLTARGDELFELTDAVLCADGPVATLAGLSLAPEHRRGHGALYDGLCCGRIGIGRLRWALACLPLPRWPGGRIILAADVSPWLRPDAATSPDRLFCHVHGRARGQAQMIPGWPYSVVAALEPGRTSWTAVLDAVRLGPADDETEVTAAQVRGVVDRLAAAGQWQPGDPDILIVFDAGYDVTRLAWLLTDLPVELAGRLRSDRVLYFPAPPRRSGRGRPVRHGAEFALADPATWPGPPVTTRTETSRYGTAIAAAWDRLHPRLTHRAAWLGHDGELPVIDGTLIRLQVDHLPGDRDPKPVWLWCSRTGATAADVDRCWQAFLRRFDLEHTFRLFKQVLGWTAPKIRSPAAADRWTWLIIAAHTQLRLARDLTADLRRPWERPAPPGRLTPARVRRGFRNLRAKTACPAGAPKPGSKNRRPAPCYDVGKTTRRELSLKARRDQTGLNDKLRACRLLTRGFGSRDERDTVCCGERGELGEGLDLCSGRLDDVPALVQERPDLALGLGDGADGDAEQLGGDA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
82 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
83 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
105 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
203 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
206 2773857924 Frankia sp. CgIS1 Isolate Nodule
207 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
208 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
209 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0.4
Rhizoplane 4.6
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100068395 3300005445 Bacteria 3192
2 JGI25406J46586_10028270 3300003203 Bacteria 2139
3 JGI25406J46586_10031427 3300003203 Bacteria 1985
4 Ga0068869_100045014 3300005334 Bacteria 3175
5 Ga0070680_100122925 3300005336 Bacteria 2167
6 Ga0070682_100084413 3300005337 Bacteria 2063
7 Ga0070682_100120475 3300005337 Bacteria 1761
8 Ga0070671_100212483 3300005355 Bacteria 1641
9 Ga0070703_10006530 3300005406 Bacteria 3270
10 Ga0070709_10123507 3300005434 Bacteria 1758
11 Ga0070714_100002232 3300005435 Bacteria 14257
12 Ga0070714_100048295 3300005435 Bacteria 3619
13 Ga0070714_100094359 3300005435 Bacteria 2626
14 Ga0070713_100094292 3300005436 Bacteria 2580
15 Ga0070713_100114392 3300005436 Bacteria 2357
16 Ga0070713_100150211 3300005436 Bacteria 2071
17 Ga0070713_100203861 3300005436 Bacteria 1787
18 Ga0070710_10000744 3300005437 Bacteria 15492
19 Ga0070710_10081065 3300005437 Bacteria 1894
20 Ga0070711_100031268 3300005439 Bacteria 3533
21 Ga0070711_100162854 3300005439 Bacteria 1692
22 Ga0070708_100030321 3300005445 Bacteria 4675
23 Ga0070708_100044317 3300005445 Bacteria 3911
24 Ga0070708_100190064 3300005445 Bacteria 1920
25 Ga0070708_100250931 3300005445 Bacteria 1662
26 Ga0070678_100217036 3300005456 Bacteria 1588
27 Ga0070706_100153394 3300005467 Bacteria 2150
28 Ga0070706_100191043 3300005467 Bacteria 1913
29 Ga0070706_100269109 3300005467 Bacteria 1590
30 Ga0070707_100031031 3300005468 Bacteria 5089
31 Ga0070707_100160101 3300005468 Bacteria 2193
32 Ga0070707_100257679 3300005468 Bacteria 1697
33 Ga0070698_100016322 3300005471 Bacteria 7840
34 Ga0070698_100075843 3300005471 Bacteria 3366
35 Ga0070698_100160652 3300005471 Bacteria 2191
36 Ga0070698_100283675 3300005471 Bacteria 1587
37 Ga0070699_100090826 3300005518 Bacteria 2670
38 Ga0070699_100248952 3300005518 Bacteria 1587
39 Ga0070697_100019060 3300005536 Bacteria 5415
40 Ga0070697_100053332 3300005536 Bacteria 3287
41 Ga0070697_100208616 3300005536 Bacteria 1662
42 Ga0070693_100052995 3300005547 Bacteria 2328
43 Ga0070665_100233225 3300005548 Bacteria 1841
44 Ga0068856_100253839 3300005614 Bacteria 1773
45 Ga0068856_100292443 3300005614 Bacteria 1646
46 Ga0068852_100283060 3300005616 Bacteria 1599
47 Ga0068863_100098088 3300005841 Bacteria 2783
48 Ga0081540_1012842 3300005983 Bacteria 5478
49 Ga0081540_1019584 3300005983 Bacteria 4105
50 Ga0081539_10004891 3300005985 Bacteria 14293
51 Ga0081539_10030693 3300005985 Bacteria 3330
52 Ga0081539_10038571 3300005985 Bacteria 2829
53 Ga0070717_10067546 3300006028 Bacteria 2974
54 Ga0070717_10074254 3300006028 Bacteria 2842
55 Ga0070717_10089138 3300006028 Bacteria 2601
56 Ga0070717_10154892 3300006028 Bacteria 1984
57 Ga0070717_10162038 3300006028 Bacteria 1941
58 Ga0070717_10172896 3300006028 Bacteria 1879
59 Ga0070717_10174770 3300006028 Bacteria 1869
60 Ga0070717_10223487 3300006028 Bacteria 1656
61 Ga0070715_10022578 3300006163 Bacteria 2455
62 Ga0070716_100000860 3300006173 Bacteria 13090
63 Ga0070716_100088430 3300006173 Bacteria 1869
64 Ga0070712_100074793 3300006175 Bacteria 2434
65 Ga0070712_100120203 3300006175 Bacteria 1975
66 Ga0070712_100127924 3300006175 Bacteria 1921
67 Ga0068871_100211509 3300006358 Bacteria 1677
68 Ga0075433_10152737 3300006852 Bacteria 2054
69 Ga0075433_10225094 3300006852 Bacteria 1666
70 Ga0075434_100251011 3300006871 Bacteria 1788
71 Ga0075434_100263955 3300006871 Bacteria 1741
72 Ga0075434_100270210 3300006871 Bacteria 1719
73 Ga0075436_100050980 3300006914 Bacteria 2856
74 Ga0075436_100078067 3300006914 Bacteria 2293
75 Ga0075436_100078415 3300006914 Bacteria 2288
76 Ga0075435_100072836 3300007076 Bacteria 2807
77 Ga0075435_100127643 3300007076 Bacteria 2126
78 Ga0075435_100173589 3300007076 Bacteria 1819
79 Ga0075435_100175658 3300007076 Bacteria 1809
80 Ga0099794_10022303 3300007265 Bacteria 2886
81 Ga0099795_10002197 3300007788 Bacteria 4514
82 Ga0105251_10035259 3300009011 Bacteria 2469
83 Ga0111539_10254393 3300009094 Bacteria 2045
84 Ga0105247_10101017 3300009101 Bacteria 1844
85 Ga0114129_10231927 3300009147 Bacteria 2486
86 Ga0114129_10429167 3300009147 Bacteria 1737
87 Ga0105248_10003320 3300009177 Bacteria 17867
88 Ga0105248_10207340 3300009177 Bacteria 2209
89 Ga0105237_10271016 3300009545 Bacteria 1700
90 Ga0099796_10017976 3300010159 Bacteria 2115
91 Ga0157369_10290460 3300013105 Bacteria 1702
92 Ga0163162_10270347 3300013306 Bacteria 1831
93 Ga0157375_10400232 3300013308 Bacteria 1540
94 Ga0163163_10284143 3300014325 Bacteria 1706
95 Ga0157379_10179023 3300014968 Bacteria 1915
96 Ga0207713_1049229 3300025735 Bacteria 1691
97 Ga0207653_10011353 3300025885 Bacteria 2779
98 Ga0207692_10044052 3300025898 Bacteria 2224
99 Ga0207692_10100329 3300025898 Bacteria 1587
100 Ga0207710_10013083 3300025900 Bacteria 3495
101 Ga0207685_10047774 3300025905 Bacteria 1636
102 Ga0207699_10000647 3300025906 Bacteria 16876
103 Ga0207699_10125882 3300025906 Bacteria 1664
104 Ga0207699_10126700 3300025906 Bacteria 1659
105 Ga0207699_10129818 3300025906 Bacteria 1642
106 Ga0207684_10062780 3300025910 Bacteria 3154
107 Ga0207684_10077470 3300025910 Bacteria 2827
108 Ga0207684_10086483 3300025910 Bacteria 2670
109 Ga0207684_10098246 3300025910 Bacteria 2500
110 Ga0207684_10172463 3300025910 Bacteria 1864
111 Ga0207671_10015440 3300025914 Bacteria 5978
112 Ga0207693_10024784 3300025915 Bacteria 4757
113 Ga0207693_10092801 3300025915 Bacteria 2366
114 Ga0207693_10109651 3300025915 Bacteria 2165
115 Ga0207663_10067137 3300025916 Bacteria 2299
116 Ga0207663_10129858 3300025916 Bacteria 1739
117 Ga0207663_10135131 3300025916 Bacteria 1710
118 Ga0207657_10107297 3300025919 Bacteria 2310
119 Ga0207646_10013793 3300025922 Bacteria 7708
120 Ga0207646_10065331 3300025922 Bacteria 3248
121 Ga0207646_10074011 3300025922 Bacteria 3043
122 Ga0207646_10151802 3300025922 Bacteria 2089
123 Ga0207687_10095635 3300025927 Bacteria 2176
124 Ga0207700_10191834 3300025928 Bacteria 1717
125 Ga0207700_10210268 3300025928 Bacteria 1644
126 Ga0207664_10010620 3300025929 Bacteria 6509
127 Ga0207664_10052175 3300025929 Bacteria 3233
128 Ga0207664_10095135 3300025929 Bacteria 2450
129 Ga0207664_10108153 3300025929 Bacteria 2308
130 Ga0207664_10141265 3300025929 Bacteria 2037
131 Ga0207664_10190307 3300025929 Bacteria 1766
132 Ga0207664_10200473 3300025929 Bacteria 1722
133 Ga0207664_10208671 3300025929 Bacteria 1689
134 Ga0207664_10222289 3300025929 Bacteria 1638
135 Ga0207665_10020135 3300025939 Bacteria 4382
136 Ga0207665_10140870 3300025939 Bacteria 1719
137 Ga0207711_10002112 3300025941 Bacteria 17955
138 Ga0207708_10112112 3300026075 Bacteria 2118
139 Ga0207702_10208867 3300026078 Bacteria 1814
140 Ga0207702_10262198 3300026078 Bacteria 1627
141 Ga0207641_10225176 3300026088 Bacteria 1741
142 Ga0207683_10063804 3300026121 Bacteria 3246
143 Ga0209588_1022476 3300027671 Bacteria 1984
144 Ga0207428_10173394 3300027907 Bacteria 1632
145 Ga0268266_10253837 3300028379 Bacteria 1627
146 Ga0307515_10229704 3300028794 Bacteria 1651
147 Ga0307514_10029968 3300031649 Bacteria 4369
148 Ga0307410_10057799 3300031852 Bacteria 2642
149 Ga0307410_10085276 3300031852 Bacteria 2228
150 Ga0307409_100125734 3300031995 Bacteria 2180
151 Ga0307416_100174807 3300032002 Bacteria 2004
152 Ga0307415_100153891 3300032126 Bacteria 1773
153 Ga0307415_100183165 3300032126 Bacteria 1645
154 Ga0307507_10002376 3300033179 Bacteria 39795
155 Ga0373934_0026030 3300035086 Bacteria 2268
156 Ga0373940_0024076 3300035088 Bacteria 1576
157 Ga0373944_0000483 3300035089 Bacteria 9247
158 Ga0373944_0019503 3300035089 Bacteria 1946
159 Ga0373923_0023926 3300035111 Bacteria 2407
160 Ga0373923_0034925 3300035111 Bacteria 2043
161 Ga0373923_0047604 3300035111 Bacteria 1788
162 Ga0373923_0066760 3300035111 Bacteria 1537
163 Ga0373936_0002713 3300035113 Bacteria 6598
164 Ga0373936_0011353 3300035113 Bacteria 3371
165 Ga0373936_0049320 3300035113 Bacteria 1700
166 Ga0373939_0014376 3300035114 Bacteria 2053
167 Ga0373945_0000625 3300035116 Bacteria 10157
168 Ga0373945_0037717 3300035116 Bacteria 1735
169 Ga0373953_0048331 3300035117 Bacteria 1713
170 Ga0373953_0055294 3300035117 Bacteria 1611
171 Ga0373954_0028564 3300035118 Bacteria 2564
172 Ga0373954_0040492 3300035118 Bacteria 2170
173 Ga0373956_0001016 3300035119 Bacteria 11580
174 Ga0373956_0020942 3300035119 Bacteria 2787
175 Ga0373957_0040415 3300035120 Bacteria 1753
176 Ga0373957_0054375 3300035120 Bacteria 1537
177 Ga0373943_0003453 3300035170 Bacteria 7189
178 Ga0373943_0044253 3300035170 Bacteria 2166
179 Ga0373943_0076784 3300035170 Bacteria 1704
180 Ga0373943_0078572 3300035170 Bacteria 1687
181 Ga0373946_0000332 3300035171 Bacteria 15317
182 Ga0373946_0013663 3300035171 Bacteria 3055
183 Ga0373946_0033380 3300035171 Bacteria 2071
184 Ga0373955_0077702 3300035172 Bacteria 1869
185 Ga0373924_0018806 3300035410 Bacteria 2669
186 Ga0373924_0064422 3300035410 Bacteria 1538
187 Ga0373924_0076304 3300035410 Bacteria 1420
188 Ga0373931_0068592 3300035691 Bacteria 1930
189 Ga0373931_0096984 3300035691 Bacteria 1652
190 Ga0373935_0018627 3300035692 Bacteria 4227
191 Ga0373935_0041439 3300035692 Bacteria 2892
192 Ga0373935_0125767 3300035692 Bacteria 1717
193 Ga0373927_0025357 3300035695 Bacteria 3875
194 Ga0373927_0111884 3300035695 Bacteria 1779
195 Ga0373933_0083007 3300035724 Bacteria 1967
196 Ga0373933_0096653 3300035724 Bacteria 1828
197 Ga0373933_0113503 3300035724 Bacteria 1692
198 Ga0373947_0049364 3300035725 Bacteria 2527
199 Ga0373947_0069841 3300035725 Bacteria 2151
200 Ga0373947_0092167 3300035725 Bacteria 1891
201 Ga0373947_0127611 3300035725 Bacteria 1621
202 Ga0373937_0134609 3300036401 Bacteria 2310
203 Ga0373937_0235964 3300036401 Bacteria 1722
204 Ga0373925_0000088 3300037068 Bacteria 98658
205 Ga0373925_0004476 3300037068 Bacteria 10561
206 Ga0373925_0015680 3300037068 Bacteria 5483
207 Ga0373925_0050038 3300037068 Bacteria 3116
208 Ga0373925_0113166 3300037068 Bacteria 2098
209 Ga0373925_0114567 3300037068 Bacteria 2087
210 Ga0373925_0128780 3300037068 Bacteria 1971
211 Ga0373925_0151472 3300037068 Bacteria 1821
212 Ga0373925_0191181 3300037068 Bacteria 1624
213 Ga0373925_0220292 3300037068 Bacteria 1514
214 Ga0436363_1654488 3300039450 Bacteria 3630
215 Ga0436362_0492861 3300039453 Bacteria 1774
216 Ga0439463_007670 3300042016 Bacteria 2665
217 Ga0450900_004875 3300042136 Bacteria 1562
218 Ga0439440_0012277 3300042993 Bacteria 1819
219 Ga0466970_0005957 3300044765 Bacteria 6076
220 Ga0466960_0037991 3300044901 Bacteria 2261
221 Ga0466967_0169809 3300045976 Bacteria 2051
222 Ga0466967_0185841 3300045976 Bacteria 1962
223 Ga0495592_0128542 3300046454 Bacteria 1774
224 Ga0495592_0139256 3300046454 Bacteria 1689
225 Ga0495592_0150382 3300046454 Bacteria 1610
226 Ga0495603_0071188 3300046455 Bacteria 2044
227 Ga0495603_0088185 3300046455 Bacteria 1815
228 Ga0495603_0092418 3300046455 Bacteria 1768
229 Ga0495590_0028394 3300046457 Bacteria 1962
230 Ga0495629_0081674 3300046459 Bacteria 2256
231 Ga0495629_0149869 3300046459 Bacteria 1621
232 Ga0495638_0102493 3300046460 Bacteria 1710
233 Ga0495641_0058419 3300046461 Bacteria 1745
234 Ga0495641_0060902 3300046461 Bacteria 1704
235 Ga0495651_0047035 3300046462 Bacteria 3338
236 Ga0495651_0104055 3300046462 Bacteria 2108
237 Ga0495651_0130933 3300046462 Bacteria 1831
238 Ga0495651_0140404 3300046462 Bacteria 1752
239 Ga0495651_0159031 3300046462 Bacteria 1620
240 Ga0495651_0166624 3300046462 Bacteria 1573
241 Ga0495651_0172722 3300046462 Bacteria 1537
242 Ga0495653_0001541 3300046463 Bacteria 17981
243 Ga0495653_0005879 3300046463 Bacteria 10041
244 Ga0495653_0032825 3300046463 Bacteria 4118
245 Ga0495653_0062637 3300046463 Bacteria 2809
246 Ga0495653_0065554 3300046463 Bacteria 2733
247 Ga0495653_0066495 3300046463 Bacteria 2711
248 Ga0495653_0124937 3300046463 Bacteria 1828
249 Ga0495653_0135195 3300046463 Bacteria 1740
250 Ga0495653_0141011 3300046463 Bacteria 1695
251 Ga0495653_0190351 3300046463 Bacteria 1400
252 Ga0495580_0139284 3300046472 Bacteria 1682
253 Ga0495582_0031191 3300046473 Bacteria 2929
254 Ga0495582_0101690 3300046473 Bacteria 1609
255 Ga0495662_0037434 3300046476 Bacteria 2343
256 Ga0495664_0074000 3300046477 Bacteria 2037
257 Ga0495664_0092042 3300046477 Bacteria 1823
258 Ga0495664_0102872 3300046477 Bacteria 1721
259 Ga0495664_0103455 3300046477 Bacteria 1716
260 Ga0495664_0107702 3300046477 Bacteria 1681
261 Ga0495585_0005736 3300046492 Bacteria 7792
262 Ga0495585_0027945 3300046492 Bacteria 3219
263 Ga0495585_0058189 3300046492 Bacteria 2132
264 Ga0495594_0061945 3300046499 Bacteria 2071
265 Ga0495594_0084922 3300046499 Bacteria 1771
266 Ga0495608_0036538 3300046511 Bacteria 3307
267 Ga0495608_0051463 3300046511 Bacteria 2730
268 Ga0495608_0055302 3300046511 Bacteria 2623
269 Ga0495608_0057101 3300046511 Bacteria 2576
270 Ga0495608_0101194 3300046511 Bacteria 1858
271 Ga0495608_0130189 3300046511 Bacteria 1610
272 Ga0495618_0043538 3300046514 Bacteria 2832
273 Ga0495618_0079642 3300046514 Bacteria 2090
274 Ga0495618_0087851 3300046514 Bacteria 1988
275 Ga0495618_0106142 3300046514 Bacteria 1798
276 Ga0495618_0117042 3300046514 Bacteria 1706
277 Ga0495618_0120855 3300046514 Bacteria 1677
278 Ga0495620_0011361 3300046515 Bacteria 4645
279 Ga0495620_0026913 3300046515 Bacteria 2698
280 Ga0495628_0067303 3300046516 Bacteria 2797
281 Ga0495628_0133288 3300046516 Bacteria 1899
282 Ga0495628_0150148 3300046516 Bacteria 1775
283 Ga0495628_0155138 3300046516 Bacteria 1742
284 Ga0495628_0165105 3300046516 Bacteria 1681
285 Ga0495628_0192694 3300046516 Bacteria 1538
286 Ga0495630_0069135 3300046517 Bacteria 2656
287 Ga0495630_0151670 3300046517 Bacteria 1763
288 Ga0495630_0160376 3300046517 Bacteria 1712
289 Ga0495631_0048359 3300046518 Bacteria 1865
290 Ga0495644_0034394 3300046523 Bacteria 1913
291 Ga0495652_0008744 3300046529 Bacteria 9218
292 Ga0495652_0051714 3300046529 Bacteria 3506
293 Ga0495652_0063990 3300046529 Bacteria 3095
294 Ga0495652_0125423 3300046529 Bacteria 2040
295 Ga0495652_0139479 3300046529 Bacteria 1908
296 Ga0495652_0140674 3300046529 Bacteria 1898
297 Ga0495652_0150448 3300046529 Bacteria 1819
298 Ga0495652_0163509 3300046529 Bacteria 1725
299 Ga0495652_0182668 3300046529 Bacteria 1608
300 Ga0495652_0195746 3300046529 Bacteria 1538
301 Ga0495665_0060685 3300046531 Bacteria 1996
302 Ga0495665_0067112 3300046531 Bacteria 1892
303 Ga0495665_0087744 3300046531 Bacteria 1635
304 Ga0495640_0012977 3300046533 Bacteria 6349
305 Ga0495640_0038199 3300046533 Bacteria 3378
306 Ga0495640_0116456 3300046533 Bacteria 1740
307 Ga0495640_0131761 3300046533 Bacteria 1617
308 Ga0495586_0028187 3300046535 Bacteria 3006
309 Ga0495587_0079267 3300046536 Bacteria 1904
310 Ga0495587_0085073 3300046536 Bacteria 1831
311 Ga0495587_0090290 3300046536 Bacteria 1770
312 Ga0495587_0099728 3300046536 Bacteria 1674
313 Ga0495587_0118046 3300046536 Bacteria 1520
314 Ga0495597_0044987 3300046542 Bacteria 1961
315 Ga0495645_0065982 3300046543 Bacteria 2617
316 Ga0495645_0086124 3300046543 Bacteria 2248
317 Ga0495645_0119460 3300046543 Bacteria 1857
318 Ga0495645_0143281 3300046543 Bacteria 1665
319 Ga0495645_0147507 3300046543 Bacteria 1637
320 Ga0495645_0150759 3300046543 Bacteria 1615
321 Ga0495622_0059329 3300046557 Bacteria 1771
322 Ga0495633_0026889 3300046558 Bacteria 2817
323 Ga0495667_0076946 3300046559 Bacteria 2170
324 Ga0495667_0083272 3300046559 Bacteria 2077
325 Ga0495667_0107327 3300046559 Bacteria 1804
326 Ga0495667_0116133 3300046559 Bacteria 1729
327 Ga0495667_0143450 3300046559 Bacteria 1538
328 Ga0495656_0050221 3300046615 Bacteria 1780
329 Ga0495634_0040304 3300046642 Bacteria 3177
330 Ga0495634_0081235 3300046642 Bacteria 2120
331 Ga0495634_0115307 3300046642 Bacteria 1724
332 Ga0495634_0126952 3300046642 Bacteria 1629
333 Ga0495625_0017036 3300046660 Bacteria 5695
334 Ga0495635_0033236 3300046663 Bacteria 3577
335 Ga0495635_0045556 3300046663 Bacteria 3026
336 Ga0495635_0082901 3300046663 Bacteria 2194
337 Ga0495635_0096212 3300046663 Bacteria 2024
338 Ga0495635_0101295 3300046663 Bacteria 1968
339 Ga0495635_0106569 3300046663 Bacteria 1914
340 Ga0495635_0117556 3300046663 Bacteria 1814
341 Ga0495635_0123900 3300046663 Bacteria 1762
342 Ga0495635_0134023 3300046663 Bacteria 1688
343 Ga0495661_0076650 3300046665 Bacteria 1939
344 Ga0495657_0029901 3300046675 Bacteria 3818
345 Ga0495657_0061318 3300046675 Bacteria 2488
346 Ga0495657_0067988 3300046675 Bacteria 2336
347 Ga0495657_0092445 3300046675 Bacteria 1938
348 Ga0495657_0114189 3300046675 Bacteria 1707
349 Ga0495599_0032702 3300046678 Bacteria 3265
350 Ga0495599_0037441 3300046678 Bacteria 3047
351 Ga0495599_0075655 3300046678 Bacteria 2102
352 Ga0495599_0081075 3300046678 Bacteria 2026
353 Ga0495599_0103462 3300046678 Bacteria 1774
354 Ga0495599_0116889 3300046678 Bacteria 1659
355 Ga0495599_0123315 3300046678 Bacteria 1610
356 Ga0495623_0059430 3300046679 Bacteria 2400
357 Ga0495623_0102418 3300046679 Bacteria 1743
358 Ga0495623_0105051 3300046679 Bacteria 1717
359 Ga0495623_0125885 3300046679 Bacteria 1538
360 Ga0495646_0062973 3300046680 Bacteria 2204
361 Ga0495646_0093024 3300046680 Bacteria 1738
362 Ga0495646_0093158 3300046680 Bacteria 1736
363 Ga0495646_0093613 3300046680 Bacteria 1731
364 Ga0495646_0105438 3300046680 Bacteria 1610
365 Ga0495613_0006683 3300046689 Bacteria 8612
366 Ga0495613_0093598 3300046689 Bacteria 2175
367 Ga0495624_0046683 3300046690 Bacteria 2754
368 Ga0495624_0079954 3300046690 Bacteria 2026
369 Ga0495624_0113644 3300046690 Bacteria 1664
370 Ga0495670_0010562 3300046691 Bacteria 4538
371 Ga0495671_0065426 3300046692 Bacteria 1789
372 Ga0495589_0003776 3300046794 Bacteria 8151
373 Ga0495589_0073197 3300046794 Bacteria 1672
374 Ga0495600_0007398 3300046809 Bacteria 6716
375 Ga0495600_0048047 3300046809 Bacteria 2784
376 Ga0495600_0132455 3300046809 Bacteria 1620
377 Ga0495581_0079994 3300047315 Bacteria 1891
378 Ga0495581_0082056 3300047315 Bacteria 1867
379 Ga0495581_0097154 3300047315 Bacteria 1710
380 Ga0495604_0081100 3300047317 Bacteria 2429
381 Ga0495604_0104203 3300047317 Bacteria 2079
382 Ga0495604_0109617 3300047317 Bacteria 2015
383 Ga0495604_0134985 3300047317 Bacteria 1769
384 Ga0495604_0169318 3300047317 Bacteria 1537
385 Ga0495636_0005220 3300047318 Bacteria 5094
386 Ga0495674_0002752 3300047319 Bacteria 17058
387 Ga0495674_0002962 3300047319 Bacteria 16518
388 Ga0495674_0007586 3300047319 Bacteria 10365
389 Ga0495674_0069742 3300047319 Bacteria 3039
390 Ga0495674_0097209 3300047319 Bacteria 2508
391 Ga0495674_0102474 3300047319 Bacteria 2434
392 Ga0495674_0180240 3300047319 Bacteria 1759
393 Ga0495674_0189588 3300047319 Bacteria 1709
394 Ga0495674_0199907 3300047319 Bacteria 1658
395 Ga0495676_0028352 3300047321 Bacteria 4781
396 Ga0495676_0055824 3300047321 Bacteria 3129
397 Ga0495676_0086249 3300047321 Bacteria 2363
398 Ga0495676_0133142 3300047321 Bacteria 1791
399 Ga0495680_0059722 3300047322 Bacteria 2942
400 Ga0495680_0078180 3300047322 Bacteria 2504
401 Ga0495680_0099407 3300047322 Bacteria 2169
402 Ga0495680_0112950 3300047322 Bacteria 2011
403 Ga0495680_0130094 3300047322 Bacteria 1851
404 Ga0495680_0140787 3300047322 Bacteria 1765
405 Ga0495680_0155884 3300047322 Bacteria 1661
406 Ga0495683_0021164 3300047323 Bacteria 3352
407 Ga0495675_0026486 3300047444 Bacteria 3697
408 Ga0495675_0123247 3300047444 Bacteria 1613
409 Ga0495677_0047226 3300047445 Bacteria 1580
410 Ga0495685_016211 3300047447 Bacteria 2544
411 Ga0495685_024365 3300047447 Bacteria 2082
412 Ga0495681_0047223 3300047470 Bacteria 2049
413 Ga0495684_0002962 3300047471 Bacteria 13365
414 Ga0495684_0016294 3300047471 Bacteria 5722
415 Ga0495684_0038479 3300047471 Bacteria 3668
416 Ga0495684_0061441 3300047471 Bacteria 2858
417 Ga0495684_0064630 3300047471 Bacteria 2781
418 Ga0495684_0121768 3300047471 Bacteria 1964
419 Ga0495684_0146339 3300047471 Bacteria 1769
420 Ga0495686_0096077 3300047472 Bacteria 1794
421 Ga0495686_0116545 3300047472 Bacteria 1596
422 Ga0495593_0050151 3300047673 Bacteria 2212
423 Ga0495602_0051628 3300048088 Bacteria 3661
424 Ga0495602_0065288 3300048088 Bacteria 3142
425 Ga0495602_0082470 3300048088 Bacteria 2698
426 Ga0495602_0157273 3300048088 Bacteria 1778
427 Ga0495602_0197480 3300048088 Bacteria 1537
428 Ga0496100_0163680 3300048903 Bacteria 1596
429 Ga0496101_0170219 3300048904 Bacteria 1674
430 Ga0496101_0180486 3300048904 Bacteria 1625
431 Ga0496102_0095500 3300048905 Bacteria 2755
432 Ga0496102_0191693 3300048905 Bacteria 1926
433 Ga0496103_0117735 3300048906 Bacteria 1691
434 Ga0496104_0105851 3300048907 Bacteria 2695
435 Ga0496104_0203545 3300048907 Bacteria 1891
436 Ga0496104_0253221 3300048907 Bacteria 1673
437 Ga0496105_0033551 3300048908 Bacteria 4216
438 Ga0496105_0051666 3300048908 Bacteria 3395
439 Ga0496106_0078215 3300048909 Bacteria 2537
440 Ga0496106_0159670 3300048909 Bacteria 1782
441 Ga0496107_0149943 3300048910 Bacteria 1724
442 Ga0496107_0168744 3300048910 Bacteria 1623
443 Ga0496108_0152498 3300048911 Bacteria 1994
444 Ga0496108_0192504 3300048911 Bacteria 1768
445 Ga0496109_0329459 3300048912 Bacteria 1441
446 Ga0496112_0074487 3300048915 Bacteria 3356
447 Ga0496112_0285924 3300048915 Bacteria 1595
448 Ga0496113_0025950 3300048916 Bacteria 4185
449 Ga0496114_0221625 3300048917 Bacteria 1660
450 Ga0496115_0157446 3300048918 Bacteria 1876
451 Ga0496119_0009177 3300048922 Bacteria 8542
452 Ga0496119_0100911 3300048922 Bacteria 1620
453 Ga0496120_0040483 3300048923 Bacteria 2738
454 Ga0496120_0048348 3300048923 Bacteria 2448
455 Ga0496121_0014597 3300048924 Bacteria 8318
456 Ga0496126_0092787 3300048929 Bacteria 2652
457 nmdc:mga05p37_98894_c1 3300050507 Bacteria 3594
458 nmdc:mga06r32_135943_c1 3300050510 Bacteria 2433
459 nmdc:mga08y16_293773_c1 3300050511 Bacteria 1675
460 nmdc:mga08y16_300792_c1 3300050511 Bacteria 1654
461 nmdc:mga0n895_211065_c1 3300050512 Bacteria 1972
462 nmdc:mga0n895_217920_c1 3300050512 Bacteria 1938
463 nmdc:mga0n895_264101_c1 3300050512 Bacteria 1747
464 nmdc:mga0n895_55088_c1 3300050512 Bacteria 3913
465 nmdc:mga0n895_95638_c1 3300050512 Bacteria 2975
466 nmdc:mga0rr50_134564_c1 3300050513 Bacteria 1983
467 nmdc:mga0rr50_183031_c1 3300050513 Bacteria 1714
468 nmdc:mga0rr50_193590_c1 3300050513 Bacteria 1668
469 nmdc:mga0rr50_965_c1 3300050513 Bacteria 15592
470 nmdc:mga08x19_125620_c1 3300050514 Bacteria 1723
471 nmdc:mga08x19_126458_c1 3300050514 Bacteria 1717
472 nmdc:mga08x19_146805_c1 3300050514 Bacteria 1595
473 nmdc:mga08x19_81663_c1 3300050514 Bacteria 2123
474 nmdc:mga0a205_171620_c1 3300050515 Bacteria 2065
475 nmdc:mga0a205_254857_c1 3300050515 Bacteria 1634
476 Ga0495601_0069242 3300053077 Bacteria 2250
477 Ga0495601_0082484 3300053077 Bacteria 2064
478 Ga0495601_0110250 3300053077 Bacteria 1782
479 Ga0495601_0126959 3300053077 Bacteria 1659
480 Ga0495601_0131924 3300053077 Bacteria 1627
481 Ga0495612_0013404 3300053078 Bacteria 3302
482 Ga0495612_0019217 3300053078 Bacteria 2737
483 Ga0495655_0003055 3300053083 Bacteria 2720
484 Ga0495655_0013864 3300053083 Bacteria 1677
485 Ga0495595_0022134 3300053084 Bacteria 2786
486 Ga0495619_0063104 3300053085 Bacteria 2467
487 Ga0495619_0078193 3300053085 Bacteria 2224
488 Ga0495619_0168225 3300053085 Bacteria 1515
489 Ga0500566_0099535 3300053094 Bacteria 1596
490 Ga0500560_025309 3300053107 Bacteria 1741
491 Ga0500577_0003047 3300053142 Bacteria 4324
492 Ga0501084_0184016 3300054114 Bacteria 1763
493 2515858025 2515154155 Bacteria 7985436
494 2774867358 2773857924 Bacteria 5256821
495 2863068758 2863067949 Bacteria 8541735
496 2863069333 2863067949 Bacteria 8541735
497 2863073642 2863067949 Bacteria 8541735
498 2863074839 2863067949 Bacteria 8541735
499 8054476268 8054472261 Bacteria 7464355
500 8055415657 8055412473 Bacteria 6257500
501 Ga0070708_100068395
502 JGI25406J46586_10028270
503 JGI25406J46586_10031427
504 Ga0068869_100045014
505 Ga0070680_100122925
506 Ga0070682_100084413
507 Ga0070682_100120475
508 Ga0070671_100212483
509 Ga0070703_10006530
510 Ga0070709_10123507
511 Ga0070714_100002232
512 Ga0070714_100048295
513 Ga0070714_100094359
514 Ga0070713_100094292
515 Ga0070713_100114392
516 Ga0070713_100150211
517 Ga0070713_100203861
518 Ga0070710_10000744
519 Ga0070710_10081065
520 Ga0070711_100031268
521 Ga0070711_100162854
522 Ga0070708_100030321
523 Ga0070708_100044317
524 Ga0070708_100190064
525 Ga0070708_100250931
526 Ga0070678_100217036
527 Ga0070706_100153394
528 Ga0070706_100191043
529 Ga0070706_100269109
530 Ga0070707_100031031
531 Ga0070707_100160101
532 Ga0070707_100257679
533 Ga0070698_100016322
534 Ga0070698_100075843
535 Ga0070698_100160652
536 Ga0070698_100283675
537 Ga0070699_100090826
538 Ga0070699_100248952
539 Ga0070697_100019060
540 Ga0070697_100053332
541 Ga0070697_100208616
542 Ga0070693_100052995
543 Ga0070665_100233225
544 Ga0068856_100253839
545 Ga0068856_100292443
546 Ga0068852_100283060
547 Ga0068863_100098088
548 Ga0081540_1012842
549 Ga0081540_1019584
550 Ga0081539_10004891
551 Ga0081539_10030693
552 Ga0081539_10038571
553 Ga0070717_10067546
554 Ga0070717_10074254
555 Ga0070717_10089138
556 Ga0070717_10154892
557 Ga0070717_10162038
558 Ga0070717_10172896
559 Ga0070717_10174770
560 Ga0070717_10223487
561 Ga0070715_10022578
562 Ga0070716_100000860
563 Ga0070716_100088430
564 Ga0070712_100074793
565 Ga0070712_100120203
566 Ga0070712_100127924
567 Ga0068871_100211509
568 Ga0075433_10152737
569 Ga0075433_10225094
570 Ga0075434_100251011
571 Ga0075434_100263955
572 Ga0075434_100270210
573 Ga0075436_100050980
574 Ga0075436_100078067
575 Ga0075436_100078415
576 Ga0075435_100072836
577 Ga0075435_100127643
578 Ga0075435_100173589
579 Ga0075435_100175658
580 Ga0099794_10022303
581 Ga0099795_10002197
582 Ga0105251_10035259
583 Ga0111539_10254393
584 Ga0105247_10101017
585 Ga0114129_10231927
586 Ga0114129_10429167
587 Ga0105248_10003320
588 Ga0105248_10207340
589 Ga0105237_10271016
590 Ga0099796_10017976
591 Ga0157369_10290460
592 Ga0163162_10270347
593 Ga0157375_10400232
594 Ga0163163_10284143
595 Ga0157379_10179023
596 Ga0207713_1049229
597 Ga0207653_10011353
598 Ga0207692_10044052
599 Ga0207692_10100329
600 Ga0207710_10013083
601 Ga0207685_10047774
602 Ga0207699_10000647
603 Ga0207699_10125882
604 Ga0207699_10126700
605 Ga0207699_10129818
606 Ga0207684_10062780
607 Ga0207684_10077470
608 Ga0207684_10086483
609 Ga0207684_10098246
610 Ga0207684_10172463
611 Ga0207671_10015440
612 Ga0207693_10024784
613 Ga0207693_10092801
614 Ga0207693_10109651
615 Ga0207663_10067137
616 Ga0207663_10129858
617 Ga0207663_10135131
618 Ga0207657_10107297
619 Ga0207646_10013793
620 Ga0207646_10065331
621 Ga0207646_10074011
622 Ga0207646_10151802
623 Ga0207687_10095635
624 Ga0207700_10191834
625 Ga0207700_10210268
626 Ga0207664_10010620
627 Ga0207664_10052175
628 Ga0207664_10095135
629 Ga0207664_10108153
630 Ga0207664_10141265
631 Ga0207664_10190307
632 Ga0207664_10200473
633 Ga0207664_10208671
634 Ga0207664_10222289
635 Ga0207665_10020135
636 Ga0207665_10140870
637 Ga0207711_10002112
638 Ga0207708_10112112
639 Ga0207702_10208867
640 Ga0207702_10262198
641 Ga0207641_10225176
642 Ga0207683_10063804
643 Ga0209588_1022476
644 Ga0207428_10173394
645 Ga0268266_10253837
646 Ga0307515_10229704
647 Ga0307514_10029968
648 Ga0307410_10057799
649 Ga0307410_10085276
650 Ga0307409_100125734
651 Ga0307416_100174807
652 Ga0307415_100153891
653 Ga0307415_100183165
654 Ga0307507_10002376
655 Ga0373934_0026030
656 Ga0373940_0024076
657 Ga0373944_0000483
658 Ga0373944_0019503
659 Ga0373923_0023926
660 Ga0373923_0034925
661 Ga0373923_0047604
662 Ga0373923_0066760
663 Ga0373936_0002713
664 Ga0373936_0011353
665 Ga0373936_0049320
666 Ga0373939_0014376
667 Ga0373945_0000625
668 Ga0373945_0037717
669 Ga0373953_0048331
670 Ga0373953_0055294
671 Ga0373954_0028564
672 Ga0373954_0040492
673 Ga0373956_0001016
674 Ga0373956_0020942
675 Ga0373957_0040415
676 Ga0373957_0054375
677 Ga0373943_0003453
678 Ga0373943_0044253
679 Ga0373943_0076784
680 Ga0373943_0078572
681 Ga0373946_0000332
682 Ga0373946_0013663
683 Ga0373946_0033380
684 Ga0373955_0077702
685 Ga0373924_0018806
686 Ga0373924_0064422
687 Ga0373924_0076304
688 Ga0373931_0068592
689 Ga0373931_0096984
690 Ga0373935_0018627
691 Ga0373935_0041439
692 Ga0373935_0125767
693 Ga0373927_0025357
694 Ga0373927_0111884
695 Ga0373933_0083007
696 Ga0373933_0096653
697 Ga0373933_0113503
698 Ga0373947_0049364
699 Ga0373947_0069841
700 Ga0373947_0092167
701 Ga0373947_0127611
702 Ga0373937_0134609
703 Ga0373937_0235964
704 Ga0373925_0000088
705 Ga0373925_0004476
706 Ga0373925_0015680
707 Ga0373925_0050038
708 Ga0373925_0113166
709 Ga0373925_0114567
710 Ga0373925_0128780
711 Ga0373925_0151472
712 Ga0373925_0191181
713 Ga0373925_0220292
714 Ga0436363_1654488
715 Ga0436362_0492861
716 Ga0439463_007670
717 Ga0450900_004875
718 Ga0439440_0012277
719 Ga0466970_0005957
720 Ga0466960_0037991
721 Ga0466967_0169809
722 Ga0466967_0185841
723 Ga0495592_0128542
724 Ga0495592_0139256
725 Ga0495592_0150382
726 Ga0495603_0071188
727 Ga0495603_0088185
728 Ga0495603_0092418
729 Ga0495590_0028394
730 Ga0495629_0081674
731 Ga0495629_0149869
732 Ga0495638_0102493
733 Ga0495641_0058419
734 Ga0495641_0060902
735 Ga0495651_0047035
736 Ga0495651_0104055
737 Ga0495651_0130933
738 Ga0495651_0140404
739 Ga0495651_0159031
740 Ga0495651_0166624
741 Ga0495651_0172722
742 Ga0495653_0001541
743 Ga0495653_0005879
744 Ga0495653_0032825
745 Ga0495653_0062637
746 Ga0495653_0065554
747 Ga0495653_0066495
748 Ga0495653_0124937
749 Ga0495653_0135195
750 Ga0495653_0141011
751 Ga0495653_0190351
752 Ga0495580_0139284
753 Ga0495582_0031191
754 Ga0495582_0101690
755 Ga0495662_0037434
756 Ga0495664_0074000
757 Ga0495664_0092042
758 Ga0495664_0102872
759 Ga0495664_0103455
760 Ga0495664_0107702
761 Ga0495585_0005736
762 Ga0495585_0027945
763 Ga0495585_0058189
764 Ga0495594_0061945
765 Ga0495594_0084922
766 Ga0495608_0036538
767 Ga0495608_0051463
768 Ga0495608_0055302
769 Ga0495608_0057101
770 Ga0495608_0101194
771 Ga0495608_0130189
772 Ga0495618_0043538
773 Ga0495618_0079642
774 Ga0495618_0087851
775 Ga0495618_0106142
776 Ga0495618_0117042
777 Ga0495618_0120855
778 Ga0495620_0011361
779 Ga0495620_0026913
780 Ga0495628_0067303
781 Ga0495628_0133288
782 Ga0495628_0150148
783 Ga0495628_0155138
784 Ga0495628_0165105
785 Ga0495628_0192694
786 Ga0495630_0069135
787 Ga0495630_0151670
788 Ga0495630_0160376
789 Ga0495631_0048359
790 Ga0495644_0034394
791 Ga0495652_0008744
792 Ga0495652_0051714
793 Ga0495652_0063990
794 Ga0495652_0125423
795 Ga0495652_0139479
796 Ga0495652_0140674
797 Ga0495652_0150448
798 Ga0495652_0163509
799 Ga0495652_0182668
800 Ga0495652_0195746
801 Ga0495665_0060685
802 Ga0495665_0067112
803 Ga0495665_0087744
804 Ga0495640_0012977
805 Ga0495640_0038199
806 Ga0495640_0116456
807 Ga0495640_0131761
808 Ga0495586_0028187
809 Ga0495587_0079267
810 Ga0495587_0085073
811 Ga0495587_0090290
812 Ga0495587_0099728
813 Ga0495587_0118046
814 Ga0495597_0044987
815 Ga0495645_0065982
816 Ga0495645_0086124
817 Ga0495645_0119460
818 Ga0495645_0143281
819 Ga0495645_0147507
820 Ga0495645_0150759
821 Ga0495622_0059329
822 Ga0495633_0026889
823 Ga0495667_0076946
824 Ga0495667_0083272
825 Ga0495667_0107327
826 Ga0495667_0116133
827 Ga0495667_0143450
828 Ga0495656_0050221
829 Ga0495634_0040304
830 Ga0495634_0081235
831 Ga0495634_0115307
832 Ga0495634_0126952
833 Ga0495625_0017036
834 Ga0495635_0033236
835 Ga0495635_0045556
836 Ga0495635_0082901
837 Ga0495635_0096212
838 Ga0495635_0101295
839 Ga0495635_0106569
840 Ga0495635_0117556
841 Ga0495635_0123900
842 Ga0495635_0134023
843 Ga0495661_0076650
844 Ga0495657_0029901
845 Ga0495657_0061318
846 Ga0495657_0067988
847 Ga0495657_0092445
848 Ga0495657_0114189
849 Ga0495599_0032702
850 Ga0495599_0037441
851 Ga0495599_0075655
852 Ga0495599_0081075
853 Ga0495599_0103462
854 Ga0495599_0116889
855 Ga0495599_0123315
856 Ga0495623_0059430
857 Ga0495623_0102418
858 Ga0495623_0105051
859 Ga0495623_0125885
860 Ga0495646_0062973
861 Ga0495646_0093024
862 Ga0495646_0093158
863 Ga0495646_0093613
864 Ga0495646_0105438
865 Ga0495613_0006683
866 Ga0495613_0093598
867 Ga0495624_0046683
868 Ga0495624_0079954
869 Ga0495624_0113644
870 Ga0495670_0010562
871 Ga0495671_0065426
872 Ga0495589_0003776
873 Ga0495589_0073197
874 Ga0495600_0007398
875 Ga0495600_0048047
876 Ga0495600_0132455
877 Ga0495581_0079994
878 Ga0495581_0082056
879 Ga0495581_0097154
880 Ga0495604_0081100
881 Ga0495604_0104203
882 Ga0495604_0109617
883 Ga0495604_0134985
884 Ga0495604_0169318
885 Ga0495636_0005220
886 Ga0495674_0002752
887 Ga0495674_0002962
888 Ga0495674_0007586
889 Ga0495674_0069742
890 Ga0495674_0097209
891 Ga0495674_0102474
892 Ga0495674_0180240
893 Ga0495674_0189588
894 Ga0495674_0199907
895 Ga0495676_0028352
896 Ga0495676_0055824
897 Ga0495676_0086249
898 Ga0495676_0133142
899 Ga0495680_0059722
900 Ga0495680_0078180
901 Ga0495680_0099407
902 Ga0495680_0112950
903 Ga0495680_0130094
904 Ga0495680_0140787
905 Ga0495680_0155884
906 Ga0495683_0021164
907 Ga0495675_0026486
908 Ga0495675_0123247
909 Ga0495677_0047226
910 Ga0495685_016211
911 Ga0495685_024365
912 Ga0495681_0047223
913 Ga0495684_0002962
914 Ga0495684_0016294
915 Ga0495684_0038479
916 Ga0495684_0061441
917 Ga0495684_0064630
918 Ga0495684_0121768
919 Ga0495684_0146339
920 Ga0495686_0096077
921 Ga0495686_0116545
922 Ga0495593_0050151
923 Ga0495602_0051628
924 Ga0495602_0065288
925 Ga0495602_0082470
926 Ga0495602_0157273
927 Ga0495602_0197480
928 Ga0496100_0163680
929 Ga0496101_0170219
930 Ga0496101_0180486
931 Ga0496102_0095500
932 Ga0496102_0191693
933 Ga0496103_0117735
934 Ga0496104_0105851
935 Ga0496104_0203545
936 Ga0496104_0253221
937 Ga0496105_0033551
938 Ga0496105_0051666
939 Ga0496106_0078215
940 Ga0496106_0159670
941 Ga0496107_0149943
942 Ga0496107_0168744
943 Ga0496108_0152498
944 Ga0496108_0192504
945 Ga0496109_0329459
946 Ga0496112_0074487
947 Ga0496112_0285924
948 Ga0496113_0025950
949 Ga0496114_0221625
950 Ga0496115_0157446
951 Ga0496119_0009177
952 Ga0496119_0100911
953 Ga0496120_0040483
954 Ga0496120_0048348
955 Ga0496121_0014597
956 Ga0496126_0092787
957 nmdc:mga05p37_98894_c1
958 nmdc:mga06r32_135943_c1
959 nmdc:mga08y16_293773_c1
960 nmdc:mga08y16_300792_c1
961 nmdc:mga0n895_211065_c1
962 nmdc:mga0n895_217920_c1
963 nmdc:mga0n895_264101_c1
964 nmdc:mga0n895_55088_c1
965 nmdc:mga0n895_95638_c1
966 nmdc:mga0rr50_134564_c1
967 nmdc:mga0rr50_183031_c1
968 nmdc:mga0rr50_193590_c1
969 nmdc:mga0rr50_965_c1
970 nmdc:mga08x19_125620_c1
971 nmdc:mga08x19_126458_c1
972 nmdc:mga08x19_146805_c1
973 nmdc:mga08x19_81663_c1
974 nmdc:mga0a205_171620_c1
975 nmdc:mga0a205_254857_c1
976 Ga0495601_0069242
977 Ga0495601_0082484
978 Ga0495601_0110250
979 Ga0495601_0126959
980 Ga0495601_0131924
981 Ga0495612_0013404
982 Ga0495612_0019217
983 Ga0495655_0003055
984 Ga0495655_0013864
985 Ga0495595_0022134
986 Ga0495619_0063104
987 Ga0495619_0078193
988 Ga0495619_0168225
989 Ga0500566_0099535
990 Ga0500560_025309
991 Ga0500577_0003047
992 Ga0501084_0184016
993 2515858025
994 2774867358
995 2863068758
996 2863069333
997 2863073642
998 2863074839
999 8054476268
1000 8055415657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13546

DDE_5

DDE superfamily endonuclease

23

287

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k9j-assembly2.cif.gz_A transposase domain of metnase 0.6285 99 219
3k9k-assembly2.cif.gz_A transposase domain of metnase 0.6193 99 219
3ecp-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with 5' phosphorylated transposon end dna 0.6102 14 431
4dm0-assembly1.cif.gz_A-2 tn5 transposase: 20mer outside end 2 mn complex 0.6087 14 431
1mm8-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6031 14 431
ID Description Score Start End Superfamily
af_Q4DUI7_642_785_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7258 264 315 2.40.128.20
af_A0A0P0XL75_175_317_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6792 94 214 3.30.420.10
af_K7MRK9_81_276_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.6642 96 221 3.90.1720.10
af_A0A0P0XUB7_219_455_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6527 94 212 3.30.420.10
af_G5EDW3_186_320_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6379 98 219 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4U0R7D1-F1-model_v4 Transposase 0.946 17 443
AF-A0A177HH85-F1-model_v4 Transposase IS701-like DDE domain-containing protein 0.946 3 378
AF-A0A4R1CKE3-F1-model_v4 deleted 0.9456 42 441
AF-A0A4D4N805-F1-model_v4 Transposase IS701-like DDE domain-containing protein 0.9455 147 308
AF-A0A101UCA5-F1-model_v4 Transposase 0.9438 17 370

Map