F455394

General Info

Members Datasets Scaffolds Average Seq Length
499 178 998 138

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0330932|Ga0395900_0330932_307_792
Length 161
Sequence LHAPFAGGMIVPLGKRTEVGVCPMRVAVLAAFLVLAVPAFAARQQLPTLAPAQAISQAAAASPKPVRALFEFKVANAAKSRGGYYLDSETNFRSPQNLGVVIRPSAMPGLTRKYGGDLKTALVGKTVKIIGQVRRVQVGKDGSATATQVEVTHAGQILSVS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.21
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0330932 3300037418 Bacteria 1501
2 JGI24736J21556_1000547 3300001904 Bacteria 6982
3 JGI24740J21852_10045784 3300001979 Bacteria 1289
4 JGI24740J21852_10063949 3300001979 Bacteria 1006
5 JGI24739J22299_10053657 3300001989 Bacteria 1294
6 JGI24737J22298_10017888 3300001990 Bacteria 2279
7 JGI24737J22298_10018614 3300001990 Bacteria 2227
8 JGI24735J21928_10051907 3300002067 Bacteria 1183
9 JGI24738J21930_10002973 3300002075 Bacteria 4330
10 rootH1_10124032 3300003316 Unclassified 1444
11 Ga0070658_10000269 3300005327 Bacteria 45712
12 Ga0070658_10006118 3300005327 Bacteria 9760
13 Ga0070658_10014712 3300005327 Bacteria 6276
14 Ga0070658_10039940 3300005327 Bacteria 3786
15 Ga0070658_10081231 3300005327 Bacteria 2662
16 Ga0070658_10167430 3300005327 Bacteria 1845
17 Ga0070658_10363190 3300005327 Bacteria 1240
18 Ga0070658_10655924 3300005327 Bacteria 910
19 Ga0070658_11023279 3300005327 Bacteria 718
20 Ga0070658_11316401 3300005327 Bacteria 627
21 Ga0070676_10083950 3300005328 Bacteria 1938
22 Ga0070676_11067865 3300005328 Bacteria 609
23 Ga0070683_100079206 3300005329 Bacteria 3075
24 Ga0070683_100123496 3300005329 Bacteria 2446
25 Ga0070683_100179416 3300005329 Bacteria 2010
26 Ga0070683_100440311 3300005329 Bacteria 1243
27 Ga0070690_100028118 3300005330 Bacteria 3481
28 Ga0070690_100044992 3300005330 Bacteria 2803
29 Ga0070690_100067074 3300005330 Bacteria 2324
30 Ga0070670_100014214 3300005331 Bacteria 6830
31 Ga0070670_100273260 3300005331 Bacteria 1475
32 Ga0068869_100489274 3300005334 Bacteria 1025
33 Ga0070666_10005642 3300005335 Bacteria 7677
34 Ga0070666_10007850 3300005335 Bacteria 6592
35 Ga0070666_10039922 3300005335 Bacteria 3130
36 Ga0070680_100000483 3300005336 Bacteria 27370
37 Ga0070680_100048918 3300005336 Bacteria 3446
38 Ga0070680_100151564 3300005336 Bacteria 1946
39 Ga0070682_100089085 3300005337 Bacteria 2015
40 Ga0070682_100724201 3300005337 Unclassified 800
41 Ga0068868_100043749 3300005338 Bacteria 3498
42 Ga0068868_100228746 3300005338 Bacteria 1559
43 Ga0068868_100357677 3300005338 Bacteria 1252
44 Ga0068868_100377875 3300005338 Bacteria 1218
45 Ga0070660_100000109 3300005339 Bacteria 50964
46 Ga0070660_100000490 3300005339 Bacteria 26435
47 Ga0070660_100061676 3300005339 Bacteria 2911
48 Ga0070660_100081184 3300005339 Bacteria 2545
49 Ga0070660_100166048 3300005339 Bacteria 1781
50 Ga0070660_100220508 3300005339 Bacteria 1541
51 Ga0070660_100271374 3300005339 Bacteria 1386
52 Ga0070660_101577207 3300005339 Bacteria 559
53 Ga0070687_100273281 3300005343 Bacteria 1060
54 Ga0070661_100000070 3300005344 Bacteria 82818
55 Ga0070661_100111827 3300005344 Bacteria 2040
56 Ga0070661_100128784 3300005344 Unclassified 1900
57 Ga0070661_100177463 3300005344 Bacteria 1620
58 Ga0070661_100481019 3300005344 Bacteria 992
59 Ga0070661_100676979 3300005344 Bacteria 839
60 Ga0070661_100872557 3300005344 Bacteria 741
61 Ga0070661_101271875 3300005344 Bacteria 617
62 Ga0070661_101297543 3300005344 Bacteria 611
63 Ga0070692_10121240 3300005345 Bacteria 1458
64 Ga0070692_10141280 3300005345 Bacteria 1363
65 Ga0070692_10240034 3300005345 Bacteria 1080
66 Ga0070669_100754280 3300005353 Bacteria 825
67 Ga0070675_100376177 3300005354 Bacteria 1263
68 Ga0070675_101552933 3300005354 Bacteria 611
69 Ga0070671_100013458 3300005355 Bacteria 6595
70 Ga0070671_100017250 3300005355 Bacteria 5845
71 Ga0070671_100019072 3300005355 Bacteria 5579
72 Ga0070671_100225409 3300005355 Bacteria 1590
73 Ga0070674_100017214 3300005356 Bacteria 4542
74 Ga0070673_100041240 3300005364 Bacteria 3548
75 Ga0070673_100073964 3300005364 Bacteria 2744
76 Ga0070673_100411815 3300005364 Bacteria 1210
77 Ga0070673_100501892 3300005364 Bacteria 1097
78 Ga0070673_100908449 3300005364 Bacteria 817
79 Ga0070659_100005208 3300005366 Bacteria 9333
80 Ga0070659_100079383 3300005366 Bacteria 2619
81 Ga0070659_100204118 3300005366 Bacteria 1628
82 Ga0070659_100665430 3300005366 Bacteria 898
83 Ga0070659_100697785 3300005366 Bacteria 877
84 Ga0070659_100794831 3300005366 Bacteria 822
85 Ga0070659_100931064 3300005366 Bacteria 760
86 Ga0070659_101330462 3300005366 Unclassified 637
87 Ga0070667_100001036 3300005367 Bacteria 25394
88 Ga0070667_100003446 3300005367 Bacteria 13476
89 Ga0070709_10418534 3300005434 Bacteria 1004
90 Ga0070714_100113189 3300005435 Bacteria 2406
91 Ga0070713_100035393 3300005436 Bacteria 4019
92 Ga0070663_100006690 3300005455 Bacteria 6952
93 Ga0070663_100025015 3300005455 Bacteria 4027
94 Ga0070663_100347236 3300005455 Bacteria 1200
95 Ga0070663_100791592 3300005455 Bacteria 812
96 Ga0070678_100022573 3300005456 Bacteria 4174
97 Ga0070678_100088021 3300005456 Bacteria 2373
98 Ga0070662_100000037 3300005457 Bacteria 76596
99 Ga0070662_100055200 3300005457 Bacteria 2881
100 Ga0070662_101085187 3300005457 Bacteria 687
101 Ga0070681_10057274 3300005458 Bacteria 3877
102 Ga0070681_10166681 3300005458 Bacteria 2126
103 Ga0070681_10919307 3300005458 Bacteria 794
104 Ga0070681_11785264 3300005458 Bacteria 542
105 Ga0068867_100439708 3300005459 Bacteria 1109
106 Ga0070685_10282030 3300005466 Bacteria 1113
107 Ga0070679_100012077 3300005530 Bacteria 8248
108 Ga0070679_100112395 3300005530 Bacteria 2710
109 Ga0070679_100658574 3300005530 Bacteria 990
110 Ga0070684_100001938 3300005535 Bacteria 15189
111 Ga0070684_100033129 3300005535 Bacteria 4409
112 Ga0070684_100123426 3300005535 Bacteria 2331
113 Ga0068853_100000213 3300005539 Bacteria 41255
114 Ga0068853_100246350 3300005539 Bacteria 1639
115 Ga0068853_100337606 3300005539 Bacteria 1399
116 Ga0068853_100465824 3300005539 Bacteria 1190
117 Ga0068853_102230915 3300005539 Bacteria 531
118 Ga0070672_100048466 3300005543 Bacteria 3301
119 Ga0070672_100165016 3300005543 Bacteria 1839
120 Ga0070672_100685475 3300005543 Bacteria 897
121 Ga0070672_100826806 3300005543 Bacteria 816
122 Ga0070686_100050243 3300005544 Bacteria 2649
123 Ga0070695_101133482 3300005545 Bacteria 641
124 Ga0070693_100004309 3300005547 Bacteria 6717
125 Ga0070693_100233256 3300005547 Bacteria 1212
126 Ga0070665_101387657 3300005548 Bacteria 712
127 Ga0068855_100000751 3300005563 Bacteria 39807
128 Ga0068855_100013324 3300005563 Bacteria 9919
129 Ga0068855_100185552 3300005563 Bacteria 2349
130 Ga0068855_100396788 3300005563 Bacteria 1512
131 Ga0068855_100527136 3300005563 Bacteria 1281
132 Ga0070664_100000077 3300005564 Bacteria 62053
133 Ga0070664_100223463 3300005564 Unclassified 1685
134 Ga0070664_100310833 3300005564 Bacteria 1426
135 Ga0070664_100393417 3300005564 Bacteria 1267
136 Ga0070664_100610575 3300005564 Bacteria 1012
137 Ga0068857_100100736 3300005577 Bacteria 2591
138 Ga0068857_100358705 3300005577 Bacteria 1351
139 Ga0068857_100499196 3300005577 Bacteria 1142
140 Ga0068854_100067457 3300005578 Bacteria 2606
141 Ga0068854_100170577 3300005578 Bacteria 1693
142 Ga0068854_100806225 3300005578 Bacteria 819
143 Ga0068854_101099695 3300005578 Bacteria 708
144 Ga0068856_100000444 3300005614 Bacteria 45674
145 Ga0068856_100018462 3300005614 Bacteria 6760
146 Ga0068856_100217128 3300005614 Bacteria 1927
147 Ga0068856_100264881 3300005614 Bacteria 1734
148 Ga0068856_100293273 3300005614 Bacteria 1643
149 Ga0068856_100504497 3300005614 Bacteria 1231
150 Ga0070702_100456862 3300005615 Bacteria 928
151 Ga0068852_100000996 3300005616 Bacteria 18697
152 Ga0068852_100010220 3300005616 Bacteria 6996
153 Ga0068852_100035966 3300005616 Bacteria 4139
154 Ga0068852_100072391 3300005616 Bacteria 3029
155 Ga0068852_100162505 3300005616 Bacteria 2086
156 Ga0068852_101401555 3300005616 Bacteria 721
157 Ga0068859_100205874 3300005617 Bacteria 2052
158 Ga0068864_100030978 3300005618 Bacteria 4536
159 Ga0068864_100137179 3300005618 Bacteria 2204
160 Ga0068851_10005214 3300005834 Bacteria 5897
161 Ga0068851_10191713 3300005834 Bacteria 1136
162 Ga0068851_10212701 3300005834 Bacteria 1083
163 Ga0068851_10884092 3300005834 Bacteria 559
164 Ga0068863_100034947 3300005841 Bacteria 4787
165 Ga0068863_100581921 3300005841 Bacteria 1107
166 Ga0068863_101830518 3300005841 Unclassified 617
167 Ga0068858_100062004 3300005842 Bacteria 3457
168 Ga0068858_100095754 3300005842 Bacteria 2766
169 Ga0068860_101552084 3300005843 Bacteria 684
170 Ga0070712_100756240 3300006175 Bacteria 832
171 Ga0097621_100006297 3300006237 Bacteria 8418
172 Ga0068865_100119654 3300006881 Bacteria 1956
173 Ga0097620_100205882 3300006931 Bacteria 2052
174 Ga0105240_10642284 3300009093 Bacteria 1164
175 Ga0105240_11974237 3300009093 Bacteria 606
176 Ga0105245_10013994 3300009098 Bacteria 6988
177 Ga0105245_12795536 3300009098 Bacteria 541
178 Ga0105241_10015523 3300009174 Bacteria 5582
179 Ga0105241_11662350 3300009174 Bacteria 619
180 Ga0105242_10027056 3300009176 Bacteria 4549
181 Ga0105248_10000235 3300009177 Bacteria 63777
182 Ga0105248_10004196 3300009177 Bacteria 15932
183 Ga0105248_10318915 3300009177 Bacteria 1750
184 Ga0105237_10251336 3300009545 Bacteria 1770
185 Ga0105238_10032028 3300009551 Bacteria 5351
186 Ga0105238_10088497 3300009551 Bacteria 3083
187 Ga0105238_10545515 3300009551 Bacteria 1163
188 Ga0105239_10140571 3300010375 Bacteria 2690
189 Ga0105239_11673523 3300010375 Bacteria 736
190 Ga0157373_10020570 3300013100 Bacteria 4794
191 Ga0157373_10052471 3300013100 Bacteria 2902
192 Ga0157373_10066504 3300013100 Bacteria 2550
193 Ga0157373_10112105 3300013100 Bacteria 1917
194 Ga0157373_10118969 3300013100 Bacteria 1857
195 Ga0157373_10725073 3300013100 Bacteria 730
196 Ga0157373_11205429 3300013100 Bacteria 571
197 Ga0157371_10002570 3300013102 Bacteria 17217
198 Ga0157371_10012865 3300013102 Bacteria 6372
199 Ga0157371_10040068 3300013102 Bacteria 3348
200 Ga0157371_10040150 3300013102 Bacteria 3345
201 Ga0157371_10066223 3300013102 Bacteria 2558
202 Ga0157371_10083439 3300013102 Bacteria 2263
203 Ga0157371_10411101 3300013102 Bacteria 991
204 Ga0157370_10006430 3300013104 Bacteria 12963
205 Ga0157370_10060808 3300013104 Bacteria 3585
206 Ga0157370_10078872 3300013104 Bacteria 3101
207 Ga0157370_10281709 3300013104 Bacteria 1536
208 Ga0157370_10595002 3300013104 Bacteria 1013
209 Ga0157369_10000106 3300013105 Bacteria 117964
210 Ga0157369_10012748 3300013105 Bacteria 9531
211 Ga0157369_10057028 3300013105 Bacteria 4215
212 Ga0157369_10079387 3300013105 Bacteria 3515
213 Ga0157369_10161019 3300013105 Bacteria 2369
214 Ga0157369_10165249 3300013105 Bacteria 2334
215 Ga0157374_10002969 3300013296 Bacteria 14202
216 Ga0157374_10112266 3300013296 Bacteria 2622
217 Ga0157374_10556066 3300013296 Unclassified 1155
218 Ga0157378_10020678 3300013297 Bacteria 5789
219 Ga0157378_10362957 3300013297 Bacteria 1418
220 Ga0157378_12314748 3300013297 Bacteria 589
221 Ga0163162_10032482 3300013306 Bacteria 5185
222 Ga0163162_11501969 3300013306 Bacteria 767
223 Ga0163162_12431432 3300013306 Bacteria 602
224 Ga0157372_10274451 3300013307 Bacteria 1959
225 Ga0157372_10471963 3300013307 Bacteria 1463
226 Ga0157372_10476813 3300013307 Bacteria 1454
227 Ga0157372_10507646 3300013307 Bacteria 1406
228 Ga0157372_10730167 3300013307 Bacteria 1152
229 Ga0157372_10769214 3300013307 Bacteria 1119
230 Ga0157375_10735298 3300013308 Bacteria 1139
231 Ga0163163_10000123 3300014325 Bacteria 82366
232 Ga0163163_10171375 3300014325 Bacteria 2217
233 Ga0157380_10885986 3300014326 Bacteria 917
234 Ga0157377_10443875 3300014745 Bacteria 894
235 Ga0157379_10029120 3300014968 Bacteria 4911
236 Ga0157379_10147160 3300014968 Bacteria 2124
237 Ga0157379_10150623 3300014968 Bacteria 2098
238 Ga0157376_10061567 3300014969 Bacteria 3155
239 Ga0157376_11143167 3300014969 Bacteria 805
240 Ga0197907_10951803 3300020069 Bacteria 534
241 Ga0206353_10073405 3300020082 Bacteria 1905
242 Ga0206353_11280308 3300020082 Bacteria 2885
243 Ga0207697_10035680 3300025315 Bacteria 2036
244 Ga0207697_10053070 3300025315 Bacteria 1678
245 Ga0207656_10198241 3300025321 Bacteria 969
246 Ga0207656_10213913 3300025321 Bacteria 935
247 Ga0207688_10085208 3300025901 Bacteria 1809
248 Ga0207688_10128398 3300025901 Bacteria 1484
249 Ga0207680_10003644 3300025903 Bacteria 7242
250 Ga0207680_10007188 3300025903 Bacteria 5413
251 Ga0207647_10015278 3300025904 Bacteria 5269
252 Ga0207647_10023966 3300025904 Bacteria 4030
253 Ga0207647_10091302 3300025904 Bacteria 1816
254 Ga0207647_10399999 3300025904 Bacteria 774
255 Ga0207699_10410749 3300025906 Bacteria 965
256 Ga0207645_10036749 3300025907 Bacteria 3145
257 Ga0207645_10434557 3300025907 Bacteria 885
258 Ga0207705_10000086 3300025909 Bacteria 116132
259 Ga0207705_10000151 3300025909 Bacteria 74614
260 Ga0207705_10001200 3300025909 Bacteria 21009
261 Ga0207705_10012354 3300025909 Bacteria 6171
262 Ga0207705_10061213 3300025909 Bacteria 2719
263 Ga0207705_10076887 3300025909 Bacteria 2427
264 Ga0207705_10110410 3300025909 Bacteria 2031
265 Ga0207705_10139245 3300025909 Bacteria 1811
266 Ga0207705_10212019 3300025909 Bacteria 1469
267 Ga0207705_10583388 3300025909 Unclassified 869
268 Ga0207654_10027398 3300025911 Bacteria 3096
269 Ga0207654_11237551 3300025911 Unclassified 544
270 Ga0207707_10071717 3300025912 Bacteria 3019
271 Ga0207707_10742745 3300025912 Bacteria 821
272 Ga0207707_11008707 3300025912 Bacteria 683
273 Ga0207671_10190298 3300025914 Bacteria 1600
274 Ga0207693_10331598 3300025915 Bacteria 1191
275 Ga0207660_10000415 3300025917 Bacteria 28231
276 Ga0207660_10025154 3300025917 Bacteria 4039
277 Ga0207660_10141541 3300025917 Bacteria 1839
278 Ga0207660_10422968 3300025917 Bacteria 1075
279 Ga0207662_10404414 3300025918 Bacteria 926
280 Ga0207657_10000985 3300025919 Bacteria 30205
281 Ga0207657_10001223 3300025919 Bacteria 27391
282 Ga0207657_10012237 3300025919 Bacteria 8476
283 Ga0207657_10030346 3300025919 Bacteria 4908
284 Ga0207657_10043730 3300025919 Bacteria 3943
285 Ga0207657_10105585 3300025919 Bacteria 2331
286 Ga0207657_10263206 3300025919 Bacteria 1372
287 Ga0207657_10658743 3300025919 Bacteria 815
288 Ga0207657_11147617 3300025919 Bacteria 592
289 Ga0207649_10000689 3300025920 Bacteria 22311
290 Ga0207649_10015823 3300025920 Bacteria 4240
291 Ga0207649_10021423 3300025920 Bacteria 3721
292 Ga0207649_10046489 3300025920 Bacteria 2667
293 Ga0207649_10661444 3300025920 Bacteria 808
294 Ga0207652_10000594 3300025921 Bacteria 36239
295 Ga0207652_10136284 3300025921 Bacteria 2192
296 Ga0207652_10676270 3300025921 Bacteria 922
297 Ga0207694_10047916 3300025924 Bacteria 3305
298 Ga0207694_10294829 3300025924 Bacteria 1334
299 Ga0207650_10027504 3300025925 Bacteria 4072
300 Ga0207650_10294970 3300025925 Bacteria 1323
301 Ga0207659_10651002 3300025926 Bacteria 900
302 Ga0207659_11607325 3300025926 Bacteria 555
303 Ga0207687_11080748 3300025927 Bacteria 689
304 Ga0207700_10039048 3300025928 Bacteria 3451
305 Ga0207700_10086160 3300025928 Bacteria 2468
306 Ga0207664_10053107 3300025929 Bacteria 3206
307 Ga0207664_10265013 3300025929 Bacteria 1503
308 Ga0207644_10000230 3300025931 Bacteria 38307
309 Ga0207644_10037750 3300025931 Bacteria 3400
310 Ga0207644_10660595 3300025931 Bacteria 870
311 Ga0207690_10000265 3300025932 Bacteria 37601
312 Ga0207690_10011100 3300025932 Bacteria 5373
313 Ga0207690_10164871 3300025932 Bacteria 1655
314 Ga0207690_11208661 3300025932 Bacteria 631
315 Ga0207706_10000192 3300025933 Bacteria 68319
316 Ga0207706_10002854 3300025933 Bacteria 16774
317 Ga0207709_10175269 3300025935 Bacteria 1509
318 Ga0207704_10103465 3300025938 Bacteria 1905
319 Ga0207691_10073318 3300025940 Bacteria 3087
320 Ga0207711_10000107 3300025941 Bacteria 87146
321 Ga0207711_10001667 3300025941 Bacteria 20478
322 Ga0207711_10001704 3300025941 Bacteria 20237
323 Ga0207711_10033348 3300025941 Bacteria 4356
324 Ga0207689_10032872 3300025942 Bacteria 4312
325 Ga0207661_10001195 3300025944 Bacteria 17376
326 Ga0207661_10119091 3300025944 Bacteria 2245
327 Ga0207661_10229912 3300025944 Bacteria 1642
328 Ga0207661_10386659 3300025944 Bacteria 1267
329 Ga0207661_10950018 3300025944 Bacteria 792
330 Ga0207661_11097207 3300025944 Bacteria 733
331 Ga0207679_10009069 3300025945 Bacteria 6356
332 Ga0207679_10252547 3300025945 Bacteria 1500
333 Ga0207679_11218743 3300025945 Bacteria 691
334 Ga0207667_10030393 3300025949 Bacteria 5845
335 Ga0207667_10064591 3300025949 Bacteria 3820
336 Ga0207667_10072597 3300025949 Bacteria 3576
337 Ga0207667_10074194 3300025949 Bacteria 3534
338 Ga0207667_10370901 3300025949 Bacteria 1459
339 Ga0207667_10556064 3300025949 Bacteria 1160
340 Ga0207651_10001783 3300025960 Bacteria 9995
341 Ga0207651_10062514 3300025960 Bacteria 2595
342 Ga0207651_10743329 3300025960 Bacteria 867
343 Ga0207651_10946432 3300025960 Bacteria 768
344 Ga0207651_11498523 3300025960 Unclassified 607
345 Ga0207668_10373930 3300025972 Bacteria 1198
346 Ga0207640_10072143 3300025981 Bacteria 2328
347 Ga0207640_10087619 3300025981 Bacteria 2146
348 Ga0207640_10538808 3300025981 Bacteria 979
349 Ga0207640_10902176 3300025981 Bacteria 772
350 Ga0207640_11060002 3300025981 Bacteria 716
351 Ga0207640_11387245 3300025981 Bacteria 629
352 Ga0207658_10024878 3300025986 Bacteria 4188
353 Ga0207658_10140660 3300025986 Bacteria 1952
354 Ga0207677_10002440 3300026023 Bacteria 9762
355 Ga0207703_10000959 3300026035 Bacteria 27891
356 Ga0207703_10087403 3300026035 Bacteria 2613
357 Ga0207639_10012258 3300026041 Bacteria 5969
358 Ga0207639_10138488 3300026041 Bacteria 2025
359 Ga0207639_10206554 3300026041 Bacteria 1688
360 Ga0207639_10661678 3300026041 Bacteria 967
361 Ga0207639_11310520 3300026041 Bacteria 680
362 Ga0207678_10001866 3300026067 Bacteria 19225
363 Ga0207678_10039705 3300026067 Bacteria 4083
364 Ga0207678_10042045 3300026067 Bacteria 3961
365 Ga0207678_10099449 3300026067 Bacteria 2484
366 Ga0207678_10870256 3300026067 Bacteria 796
367 Ga0207702_10001452 3300026078 Bacteria 23558
368 Ga0207702_10005493 3300026078 Bacteria 11085
369 Ga0207702_10029721 3300026078 Bacteria 4548
370 Ga0207702_10373968 3300026078 Bacteria 1369
371 Ga0207702_10662902 3300026078 Bacteria 1027
372 Ga0207702_10907265 3300026078 Bacteria 873
373 Ga0207641_10036215 3300026088 Bacteria 4118
374 Ga0207641_10488383 3300026088 Bacteria 1194
375 Ga0207648_10003577 3300026089 Bacteria 16261
376 Ga0207676_10042803 3300026095 Bacteria 3483
377 Ga0207674_10033637 3300026116 Bacteria 5366
378 Ga0207674_10083567 3300026116 Bacteria 3192
379 Ga0207674_10173838 3300026116 Bacteria 2107
380 Ga0207683_10031600 3300026121 Bacteria 4594
381 Ga0207683_10578652 3300026121 Bacteria 1039
382 Ga0207698_10000901 3300026142 Bacteria 17299
383 Ga0207698_10079100 3300026142 Bacteria 2643
384 Ga0207698_10539588 3300026142 Bacteria 1141
385 Ga0207698_10586014 3300026142 Bacteria 1098
386 Ga0207698_11130862 3300026142 Bacteria 796
387 Ga0268266_10008036 3300028379 Bacteria 9426
388 Ga0373959_0022247 3300034820 Bacteria 1224
389 Ga0373938_0027937 3300034957 Bacteria 1190
390 Ga0373939_0364736 3300035114 Bacteria 591
391 Ga0373942_0017383 3300035207 Bacteria 1773
392 Ga0373961_0052687 3300035241 Bacteria 1212
393 Ga0373931_0144266 3300035691 Bacteria 1382
394 Ga0373935_0099539 3300035692 Bacteria 1914
395 Ga0373937_0550528 3300036401 Bacteria 1096
396 Ga0395899_0025932 3300037312 Bacteria 4424
397 Ga0395899_0046689 3300037312 Bacteria 3225
398 Ga0395899_0055806 3300037312 Bacteria 2921
399 Ga0395899_0094061 3300037312 Bacteria 2169
400 Ga0395899_0184539 3300037312 Bacteria 1462
401 Ga0395899_0256467 3300037312 Bacteria 1198
402 Ga0395899_0503318 3300037312 Unclassified 785
403 Ga0395899_0607735 3300037312 Bacteria 696
404 Ga0395900_0049269 3300037418 Bacteria 4339
405 Ga0395900_0068239 3300037418 Bacteria 3653
406 Ga0395900_0071382 3300037418 Bacteria 3569
407 Ga0395900_0071386 3300037418 Bacteria 3569
408 Ga0395900_0136256 3300037418 Bacteria 2515
409 Ga0395900_0447461 3300037418 Bacteria 1248
410 Ga0395900_0767643 3300037418 Bacteria 893
411 Ga0395900_0849450 3300037418 Bacteria 838
412 Ga0395900_1176589 3300037418 Unclassified 682
413 Ga0395900_1384065 3300037418 Bacteria 617
414 Ga0395898_0009942 3300037466 Bacteria 9964
415 Ga0395898_0019435 3300037466 Bacteria 6913
416 Ga0395898_0097685 3300037466 Bacteria 2820
417 Ga0395898_0137636 3300037466 Bacteria 2338
418 Ga0395898_0142170 3300037466 Bacteria 2297
419 Ga0395898_1541513 3300037466 Bacteria 590
420 Ga0395898_1571535 3300037466 Unclassified 582
421 Ga0395905_0016361 3300037471 Bacteria 7046
422 Ga0395905_0062605 3300037471 Bacteria 3480
423 Ga0395905_0235726 3300037471 Bacteria 1710
424 Ga0395905_0513579 3300037471 Bacteria 1098
425 Ga0395905_0556236 3300037471 Bacteria 1048
426 Ga0395905_1693468 3300037471 Unclassified 537
427 Ga0395901_0017722 3300038443 Bacteria 7270
428 Ga0395901_0066043 3300038443 Bacteria 3768
429 Ga0395901_0253218 3300038443 Bacteria 1834
430 Ga0395901_0314569 3300038443 Bacteria 1621
431 Ga0395901_0386416 3300038443 Bacteria 1440
432 Ga0395901_0897326 3300038443 Bacteria 868
433 Ga0395901_0907398 3300038443 Bacteria 862
434 Ga0395901_0999685 3300038443 Bacteria 812
435 Ga0439458_0001020 3300042157 Bacteria 7140
436 Ga0466969_0001693 3300044656 Bacteria 11783
437 Ga0466969_0057595 3300044656 Bacteria 1894
438 Ga0466969_0345178 3300044656 Bacteria 674
439 Ga0466972_0070047 3300044658 Bacteria 1674
440 Ga0466966_0000003 3300044684 Bacteria 233677
441 Ga0466966_0113418 3300044684 Bacteria 1669
442 Ga0466961_0471914 3300044693 Unclassified 759
443 Ga0466963_0057627 3300044694 Bacteria 2587
444 Ga0466963_0091732 3300044694 Bacteria 2069
445 Ga0466963_0663236 3300044694 Bacteria 736
446 Ga0466963_0717412 3300044694 Bacteria 705
447 Ga0466963_0787712 3300044694 Bacteria 670
448 Ga0466964_0142086 3300044706 Bacteria 1104
449 Ga0466970_0396823 3300044765 Bacteria 787
450 Ga0466970_0613169 3300044765 Bacteria 632
451 Ga0466957_0000560 3300044842 Bacteria 18785
452 Ga0466957_0031342 3300044842 Bacteria 3177
453 Ga0466957_0164657 3300044842 Bacteria 1442
454 Ga0466957_0359365 3300044842 Bacteria 989
455 Ga0466957_0449143 3300044842 Bacteria 888
456 Ga0466957_0716080 3300044842 Bacteria 707
457 Ga0466957_0965024 3300044842 Bacteria 611
458 Ga0466960_0097085 3300044901 Bacteria 1511
459 Ga0466959_0647345 3300045049 Bacteria 709
460 Ga0466959_0868628 3300045049 Unclassified 602
461 Ga0466958_0001653 3300045836 Bacteria 10750
462 Ga0466958_0070759 3300045836 Bacteria 2135
463 Ga0466958_0143554 3300045836 Bacteria 1504
464 Ga0466958_0272530 3300045836 Bacteria 1084
465 Ga0466958_0500805 3300045836 Bacteria 788
466 Ga0466967_0003617 3300045976 Bacteria 10151
467 Ga0466967_0132365 3300045976 Bacteria 2316
468 Ga0466967_0233119 3300045976 Bacteria 1753
469 Ga0466967_0489886 3300045976 Bacteria 1205
470 Ga0466967_0490628 3300045976 Bacteria 1204
471 Ga0466967_0992292 3300045976 Bacteria 836
472 Ga0466967_1026898 3300045976 Bacteria 821
473 Ga0466967_1909977 3300045976 Unclassified 590
474 Ga0495669_0232750 3300046684 Bacteria 884
475 Ga0496100_0120978 3300048903 Bacteria 1831
476 Ga0496101_0189309 3300048904 Bacteria 1587
477 Ga0496102_0129581 3300048905 Bacteria 2360
478 Ga0496104_0334728 3300048907 Bacteria 1427
479 Ga0496104_0541997 3300048907 Bacteria 1074
480 Ga0496105_0079331 3300048908 Bacteria 2711
481 Ga0496106_0319914 3300048909 Bacteria 1245
482 Ga0496107_0024497 3300048910 Bacteria 4269
483 Ga0496107_0165941 3300048910 Bacteria 1637
484 Ga0496108_0001094 3300048911 Bacteria 21158
485 Ga0496108_0221319 3300048911 Bacteria 1645
486 Ga0496108_0398245 3300048911 Bacteria 1202
487 Ga0496109_0054641 3300048912 Bacteria 3642
488 Ga0496109_0416114 3300048912 Bacteria 1270
489 Ga0496109_0704984 3300048912 Bacteria 947
490 Ga0496110_0000347 3300048913 Bacteria 30884
491 Ga0496111_0002388 3300048914 Bacteria 11319
492 Ga0496111_0058446 3300048914 Bacteria 2792
493 Ga0496112_0001900 3300048915 Bacteria 16480
494 Ga0496112_0004060 3300048915 Bacteria 12286
495 Ga0496113_0001402 3300048916 Bacteria 13411
496 Ga0587106_015896 3300059605 Bacteria 1057
497 Ga0466962_0008320 3300061719 Bacteria 4969
498 Ga0466962_0125757 3300061719 Bacteria 1238
499 Ga0466962_0213268 3300061719 Bacteria 945
500 Ga0395900_0330932
501 JGI24736J21556_1000547
502 JGI24740J21852_10045784
503 JGI24740J21852_10063949
504 JGI24739J22299_10053657
505 JGI24737J22298_10017888
506 JGI24737J22298_10018614
507 JGI24735J21928_10051907
508 JGI24738J21930_10002973
509 rootH1_10124032
510 Ga0070658_10000269
511 Ga0070658_10006118
512 Ga0070658_10014712
513 Ga0070658_10039940
514 Ga0070658_10081231
515 Ga0070658_10167430
516 Ga0070658_10363190
517 Ga0070658_10655924
518 Ga0070658_11023279
519 Ga0070658_11316401
520 Ga0070676_10083950
521 Ga0070676_11067865
522 Ga0070683_100079206
523 Ga0070683_100123496
524 Ga0070683_100179416
525 Ga0070683_100440311
526 Ga0070690_100028118
527 Ga0070690_100044992
528 Ga0070690_100067074
529 Ga0070670_100014214
530 Ga0070670_100273260
531 Ga0068869_100489274
532 Ga0070666_10005642
533 Ga0070666_10007850
534 Ga0070666_10039922
535 Ga0070680_100000483
536 Ga0070680_100048918
537 Ga0070680_100151564
538 Ga0070682_100089085
539 Ga0070682_100724201
540 Ga0068868_100043749
541 Ga0068868_100228746
542 Ga0068868_100357677
543 Ga0068868_100377875
544 Ga0070660_100000109
545 Ga0070660_100000490
546 Ga0070660_100061676
547 Ga0070660_100081184
548 Ga0070660_100166048
549 Ga0070660_100220508
550 Ga0070660_100271374
551 Ga0070660_101577207
552 Ga0070687_100273281
553 Ga0070661_100000070
554 Ga0070661_100111827
555 Ga0070661_100128784
556 Ga0070661_100177463
557 Ga0070661_100481019
558 Ga0070661_100676979
559 Ga0070661_100872557
560 Ga0070661_101271875
561 Ga0070661_101297543
562 Ga0070692_10121240
563 Ga0070692_10141280
564 Ga0070692_10240034
565 Ga0070669_100754280
566 Ga0070675_100376177
567 Ga0070675_101552933
568 Ga0070671_100013458
569 Ga0070671_100017250
570 Ga0070671_100019072
571 Ga0070671_100225409
572 Ga0070674_100017214
573 Ga0070673_100041240
574 Ga0070673_100073964
575 Ga0070673_100411815
576 Ga0070673_100501892
577 Ga0070673_100908449
578 Ga0070659_100005208
579 Ga0070659_100079383
580 Ga0070659_100204118
581 Ga0070659_100665430
582 Ga0070659_100697785
583 Ga0070659_100794831
584 Ga0070659_100931064
585 Ga0070659_101330462
586 Ga0070667_100001036
587 Ga0070667_100003446
588 Ga0070709_10418534
589 Ga0070714_100113189
590 Ga0070713_100035393
591 Ga0070663_100006690
592 Ga0070663_100025015
593 Ga0070663_100347236
594 Ga0070663_100791592
595 Ga0070678_100022573
596 Ga0070678_100088021
597 Ga0070662_100000037
598 Ga0070662_100055200
599 Ga0070662_101085187
600 Ga0070681_10057274
601 Ga0070681_10166681
602 Ga0070681_10919307
603 Ga0070681_11785264
604 Ga0068867_100439708
605 Ga0070685_10282030
606 Ga0070679_100012077
607 Ga0070679_100112395
608 Ga0070679_100658574
609 Ga0070684_100001938
610 Ga0070684_100033129
611 Ga0070684_100123426
612 Ga0068853_100000213
613 Ga0068853_100246350
614 Ga0068853_100337606
615 Ga0068853_100465824
616 Ga0068853_102230915
617 Ga0070672_100048466
618 Ga0070672_100165016
619 Ga0070672_100685475
620 Ga0070672_100826806
621 Ga0070686_100050243
622 Ga0070695_101133482
623 Ga0070693_100004309
624 Ga0070693_100233256
625 Ga0070665_101387657
626 Ga0068855_100000751
627 Ga0068855_100013324
628 Ga0068855_100185552
629 Ga0068855_100396788
630 Ga0068855_100527136
631 Ga0070664_100000077
632 Ga0070664_100223463
633 Ga0070664_100310833
634 Ga0070664_100393417
635 Ga0070664_100610575
636 Ga0068857_100100736
637 Ga0068857_100358705
638 Ga0068857_100499196
639 Ga0068854_100067457
640 Ga0068854_100170577
641 Ga0068854_100806225
642 Ga0068854_101099695
643 Ga0068856_100000444
644 Ga0068856_100018462
645 Ga0068856_100217128
646 Ga0068856_100264881
647 Ga0068856_100293273
648 Ga0068856_100504497
649 Ga0070702_100456862
650 Ga0068852_100000996
651 Ga0068852_100010220
652 Ga0068852_100035966
653 Ga0068852_100072391
654 Ga0068852_100162505
655 Ga0068852_101401555
656 Ga0068859_100205874
657 Ga0068864_100030978
658 Ga0068864_100137179
659 Ga0068851_10005214
660 Ga0068851_10191713
661 Ga0068851_10212701
662 Ga0068851_10884092
663 Ga0068863_100034947
664 Ga0068863_100581921
665 Ga0068863_101830518
666 Ga0068858_100062004
667 Ga0068858_100095754
668 Ga0068860_101552084
669 Ga0070712_100756240
670 Ga0097621_100006297
671 Ga0068865_100119654
672 Ga0097620_100205882
673 Ga0105240_10642284
674 Ga0105240_11974237
675 Ga0105245_10013994
676 Ga0105245_12795536
677 Ga0105241_10015523
678 Ga0105241_11662350
679 Ga0105242_10027056
680 Ga0105248_10000235
681 Ga0105248_10004196
682 Ga0105248_10318915
683 Ga0105237_10251336
684 Ga0105238_10032028
685 Ga0105238_10088497
686 Ga0105238_10545515
687 Ga0105239_10140571
688 Ga0105239_11673523
689 Ga0157373_10020570
690 Ga0157373_10052471
691 Ga0157373_10066504
692 Ga0157373_10112105
693 Ga0157373_10118969
694 Ga0157373_10725073
695 Ga0157373_11205429
696 Ga0157371_10002570
697 Ga0157371_10012865
698 Ga0157371_10040068
699 Ga0157371_10040150
700 Ga0157371_10066223
701 Ga0157371_10083439
702 Ga0157371_10411101
703 Ga0157370_10006430
704 Ga0157370_10060808
705 Ga0157370_10078872
706 Ga0157370_10281709
707 Ga0157370_10595002
708 Ga0157369_10000106
709 Ga0157369_10012748
710 Ga0157369_10057028
711 Ga0157369_10079387
712 Ga0157369_10161019
713 Ga0157369_10165249
714 Ga0157374_10002969
715 Ga0157374_10112266
716 Ga0157374_10556066
717 Ga0157378_10020678
718 Ga0157378_10362957
719 Ga0157378_12314748
720 Ga0163162_10032482
721 Ga0163162_11501969
722 Ga0163162_12431432
723 Ga0157372_10274451
724 Ga0157372_10471963
725 Ga0157372_10476813
726 Ga0157372_10507646
727 Ga0157372_10730167
728 Ga0157372_10769214
729 Ga0157375_10735298
730 Ga0163163_10000123
731 Ga0163163_10171375
732 Ga0157380_10885986
733 Ga0157377_10443875
734 Ga0157379_10029120
735 Ga0157379_10147160
736 Ga0157379_10150623
737 Ga0157376_10061567
738 Ga0157376_11143167
739 Ga0197907_10951803
740 Ga0206353_10073405
741 Ga0206353_11280308
742 Ga0207697_10035680
743 Ga0207697_10053070
744 Ga0207656_10198241
745 Ga0207656_10213913
746 Ga0207688_10085208
747 Ga0207688_10128398
748 Ga0207680_10003644
749 Ga0207680_10007188
750 Ga0207647_10015278
751 Ga0207647_10023966
752 Ga0207647_10091302
753 Ga0207647_10399999
754 Ga0207699_10410749
755 Ga0207645_10036749
756 Ga0207645_10434557
757 Ga0207705_10000086
758 Ga0207705_10000151
759 Ga0207705_10001200
760 Ga0207705_10012354
761 Ga0207705_10061213
762 Ga0207705_10076887
763 Ga0207705_10110410
764 Ga0207705_10139245
765 Ga0207705_10212019
766 Ga0207705_10583388
767 Ga0207654_10027398
768 Ga0207654_11237551
769 Ga0207707_10071717
770 Ga0207707_10742745
771 Ga0207707_11008707
772 Ga0207671_10190298
773 Ga0207693_10331598
774 Ga0207660_10000415
775 Ga0207660_10025154
776 Ga0207660_10141541
777 Ga0207660_10422968
778 Ga0207662_10404414
779 Ga0207657_10000985
780 Ga0207657_10001223
781 Ga0207657_10012237
782 Ga0207657_10030346
783 Ga0207657_10043730
784 Ga0207657_10105585
785 Ga0207657_10263206
786 Ga0207657_10658743
787 Ga0207657_11147617
788 Ga0207649_10000689
789 Ga0207649_10015823
790 Ga0207649_10021423
791 Ga0207649_10046489
792 Ga0207649_10661444
793 Ga0207652_10000594
794 Ga0207652_10136284
795 Ga0207652_10676270
796 Ga0207694_10047916
797 Ga0207694_10294829
798 Ga0207650_10027504
799 Ga0207650_10294970
800 Ga0207659_10651002
801 Ga0207659_11607325
802 Ga0207687_11080748
803 Ga0207700_10039048
804 Ga0207700_10086160
805 Ga0207664_10053107
806 Ga0207664_10265013
807 Ga0207644_10000230
808 Ga0207644_10037750
809 Ga0207644_10660595
810 Ga0207690_10000265
811 Ga0207690_10011100
812 Ga0207690_10164871
813 Ga0207690_11208661
814 Ga0207706_10000192
815 Ga0207706_10002854
816 Ga0207709_10175269
817 Ga0207704_10103465
818 Ga0207691_10073318
819 Ga0207711_10000107
820 Ga0207711_10001667
821 Ga0207711_10001704
822 Ga0207711_10033348
823 Ga0207689_10032872
824 Ga0207661_10001195
825 Ga0207661_10119091
826 Ga0207661_10229912
827 Ga0207661_10386659
828 Ga0207661_10950018
829 Ga0207661_11097207
830 Ga0207679_10009069
831 Ga0207679_10252547
832 Ga0207679_11218743
833 Ga0207667_10030393
834 Ga0207667_10064591
835 Ga0207667_10072597
836 Ga0207667_10074194
837 Ga0207667_10370901
838 Ga0207667_10556064
839 Ga0207651_10001783
840 Ga0207651_10062514
841 Ga0207651_10743329
842 Ga0207651_10946432
843 Ga0207651_11498523
844 Ga0207668_10373930
845 Ga0207640_10072143
846 Ga0207640_10087619
847 Ga0207640_10538808
848 Ga0207640_10902176
849 Ga0207640_11060002
850 Ga0207640_11387245
851 Ga0207658_10024878
852 Ga0207658_10140660
853 Ga0207677_10002440
854 Ga0207703_10000959
855 Ga0207703_10087403
856 Ga0207639_10012258
857 Ga0207639_10138488
858 Ga0207639_10206554
859 Ga0207639_10661678
860 Ga0207639_11310520
861 Ga0207678_10001866
862 Ga0207678_10039705
863 Ga0207678_10042045
864 Ga0207678_10099449
865 Ga0207678_10870256
866 Ga0207702_10001452
867 Ga0207702_10005493
868 Ga0207702_10029721
869 Ga0207702_10373968
870 Ga0207702_10662902
871 Ga0207702_10907265
872 Ga0207641_10036215
873 Ga0207641_10488383
874 Ga0207648_10003577
875 Ga0207676_10042803
876 Ga0207674_10033637
877 Ga0207674_10083567
878 Ga0207674_10173838
879 Ga0207683_10031600
880 Ga0207683_10578652
881 Ga0207698_10000901
882 Ga0207698_10079100
883 Ga0207698_10539588
884 Ga0207698_10586014
885 Ga0207698_11130862
886 Ga0268266_10008036
887 Ga0373959_0022247
888 Ga0373938_0027937
889 Ga0373939_0364736
890 Ga0373942_0017383
891 Ga0373961_0052687
892 Ga0373931_0144266
893 Ga0373935_0099539
894 Ga0373937_0550528
895 Ga0395899_0025932
896 Ga0395899_0046689
897 Ga0395899_0055806
898 Ga0395899_0094061
899 Ga0395899_0184539
900 Ga0395899_0256467
901 Ga0395899_0503318
902 Ga0395899_0607735
903 Ga0395900_0049269
904 Ga0395900_0068239
905 Ga0395900_0071382
906 Ga0395900_0071386
907 Ga0395900_0136256
908 Ga0395900_0447461
909 Ga0395900_0767643
910 Ga0395900_0849450
911 Ga0395900_1176589
912 Ga0395900_1384065
913 Ga0395898_0009942
914 Ga0395898_0019435
915 Ga0395898_0097685
916 Ga0395898_0137636
917 Ga0395898_0142170
918 Ga0395898_1541513
919 Ga0395898_1571535
920 Ga0395905_0016361
921 Ga0395905_0062605
922 Ga0395905_0235726
923 Ga0395905_0513579
924 Ga0395905_0556236
925 Ga0395905_1693468
926 Ga0395901_0017722
927 Ga0395901_0066043
928 Ga0395901_0253218
929 Ga0395901_0314569
930 Ga0395901_0386416
931 Ga0395901_0897326
932 Ga0395901_0907398
933 Ga0395901_0999685
934 Ga0439458_0001020
935 Ga0466969_0001693
936 Ga0466969_0057595
937 Ga0466969_0345178
938 Ga0466972_0070047
939 Ga0466966_0000003
940 Ga0466966_0113418
941 Ga0466961_0471914
942 Ga0466963_0057627
943 Ga0466963_0091732
944 Ga0466963_0663236
945 Ga0466963_0717412
946 Ga0466963_0787712
947 Ga0466964_0142086
948 Ga0466970_0396823
949 Ga0466970_0613169
950 Ga0466957_0000560
951 Ga0466957_0031342
952 Ga0466957_0164657
953 Ga0466957_0359365
954 Ga0466957_0449143
955 Ga0466957_0716080
956 Ga0466957_0965024
957 Ga0466960_0097085
958 Ga0466959_0647345
959 Ga0466959_0868628
960 Ga0466958_0001653
961 Ga0466958_0070759
962 Ga0466958_0143554
963 Ga0466958_0272530
964 Ga0466958_0500805
965 Ga0466967_0003617
966 Ga0466967_0132365
967 Ga0466967_0233119
968 Ga0466967_0489886
969 Ga0466967_0490628
970 Ga0466967_0992292
971 Ga0466967_1026898
972 Ga0466967_1909977
973 Ga0495669_0232750
974 Ga0496100_0120978
975 Ga0496101_0189309
976 Ga0496102_0129581
977 Ga0496104_0334728
978 Ga0496104_0541997
979 Ga0496105_0079331
980 Ga0496106_0319914
981 Ga0496107_0024497
982 Ga0496107_0165941
983 Ga0496108_0001094
984 Ga0496108_0221319
985 Ga0496108_0398245
986 Ga0496109_0054641
987 Ga0496109_0416114
988 Ga0496109_0704984
989 Ga0496110_0000347
990 Ga0496111_0002388
991 Ga0496111_0058446
992 Ga0496112_0001900
993 Ga0496112_0004060
994 Ga0496113_0001402
995 Ga0587106_015896
996 Ga0466962_0008320
997 Ga0466962_0125757
998 Ga0466962_0213268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ihe-assembly2.cif.gz_B d-family dna polymerase - dp1 subunit (3'-5' proof-reading exonuclease) 0.7414 43 111
6hmf-assembly2.cif.gz_B d-family dna polymerase - dp1 subunit (3'-5' proof-reading exonuclease) h451 proof-reading deficient variant 0.7322 43 109
4ywk-assembly3.cif.gz_A pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.7214 46 130
2xgt-assembly1.cif.gz_B asparaginyl-trna synthetase from brugia malayi complexed with the sulphamoyl analogue of asparaginyl-adenylate 0.7173 41 128
4gop-assembly2.cif.gz_Y structure and conformational change of a replication protein a heterotrimer bound to ssdna 0.7146 44 128
ID Description Score Start End Superfamily
af_A0A1D6IBP5_78_179_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7217 42 130 2.40.50.140
2xgtB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7179 41 128 2.40.50.140
4gopY00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7146 44 128 2.40.50.140
af_Q6IGM3_136_223_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.707 43 109 2.40.50.140
4glaD00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6975 43 130 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A651G1F8-F1-model_v4 Thermonuclease family protein 0.882 44 134
AF-A0A0H1RHB0-F1-model_v4 DNA-binding protein 0.8576 42 134
AF-A0A160N240-F1-model_v4 Uncharacterized protein 0.8532 49 138
AF-A0A811BBN5-F1-model_v4 deleted 0.8496 43 135
AF-A0A5A7NAM9-F1-model_v4 TNase-like domain-containing protein 0.8484 39 134

Map