F455314

General Info

Members Datasets Scaffolds Average Seq Length
499 191 998 89

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10105586|Ga0070666_101055861
Length 98
Sequence MQFLKTVFWVLIAVIVALFSFRNWFDVTVNLWGDIQADIKLPALLLVVFLFGFLPTWLIMRARIWSHRRRIDAMERNRLSTLPSEAPGETAETAGTAA

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.81
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 4.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10105586 3300005335 Bacteria 1945
2 JGI24736J21556_1043550 3300001904 Bacteria 690
3 JGI24741J21665_1018617 3300001915 Bacteria 1108
4 JGI24752J21851_1013737 3300001976 Bacteria 1056
5 JGI24752J21851_1031632 3300001976 Bacteria 699
6 JGI24740J21852_10029382 3300001979 Bacteria 1805
7 JGI24740J21852_10030530 3300001979 Bacteria 1751
8 JGI24740J21852_10053474 3300001979 Bacteria 1145
9 JGI24740J21852_10066845 3300001979 Bacteria 974
10 JGI24740J21852_10079786 3300001979 Bacteria 860
11 JGI24740J21852_10086954 3300001979 Bacteria 811
12 JGI24739J22299_10263310 3300001989 Bacteria 505
13 JGI24735J21928_10013077 3300002067 Bacteria 2614
14 JGI24735J21928_10043534 3300002067 Bacteria 1305
15 Ga0065712_10484989 3300005290 Bacteria 660
16 Ga0065715_10906711 3300005293 Unclassified 573
17 Ga0070658_10024172 3300005327 Bacteria 4876
18 Ga0070658_10198384 3300005327 Bacteria 1693
19 Ga0070683_100028957 3300005329 Bacteria 5009
20 Ga0070683_100891990 3300005329 Bacteria 853
21 Ga0070690_100076102 3300005330 Bacteria 2189
22 Ga0070690_101078927 3300005330 Bacteria 636
23 Ga0070670_100008721 3300005331 Bacteria 8654
24 Ga0070670_100172841 3300005331 Bacteria 1874
25 Ga0070666_10029789 3300005335 Bacteria 3591
26 Ga0070680_100338495 3300005336 Bacteria 1278
27 Ga0070682_100309819 3300005337 Bacteria 1162
28 Ga0068868_100031844 3300005338 Bacteria 4054
29 Ga0070660_100024121 3300005339 Bacteria 4512
30 Ga0070660_101039761 3300005339 Unclassified 692
31 Ga0070691_10942357 3300005341 Bacteria 535
32 Ga0070661_100022050 3300005344 Bacteria 4556
33 Ga0070661_100049228 3300005344 Bacteria 3085
34 Ga0070661_100056692 3300005344 Bacteria 2871
35 Ga0070661_100220226 3300005344 Bacteria 1455
36 Ga0070661_100794663 3300005344 Bacteria 776
37 Ga0070692_10252811 3300005345 Bacteria 1056
38 Ga0070692_10631376 3300005345 Unclassified 713
39 Ga0070668_101998610 3300005347 Bacteria 535
40 Ga0070669_100454622 3300005353 Bacteria 1056
41 Ga0070675_100007402 3300005354 Bacteria 8479
42 Ga0070671_100006556 3300005355 Bacteria 9305
43 Ga0070671_100014082 3300005355 Bacteria 6457
44 Ga0070671_100031934 3300005355 Bacteria 4353
45 Ga0070671_100049124 3300005355 Bacteria 3510
46 Ga0070671_100358739 3300005355 Bacteria 1244
47 Ga0070674_100327641 3300005356 Bacteria 1230
48 Ga0070674_100373790 3300005356 Bacteria 1158
49 Ga0070673_100209589 3300005364 Bacteria 1682
50 Ga0070673_100820745 3300005364 Unclassified 859
51 Ga0070659_100005750 3300005366 Bacteria 8923
52 Ga0070659_100060947 3300005366 Bacteria 2981
53 Ga0070659_100090934 3300005366 Bacteria 2446
54 Ga0070659_100454866 3300005366 Bacteria 1086
55 Ga0070659_100975746 3300005366 Unclassified 743
56 Ga0070667_100011561 3300005367 Bacteria 7297
57 Ga0070667_100115483 3300005367 Bacteria 2331
58 Ga0070667_100307342 3300005367 Bacteria 1429
59 Ga0070714_100405039 3300005435 Bacteria 1290
60 Ga0070713_100364693 3300005436 Bacteria 1343
61 Ga0070663_100105936 3300005455 Bacteria 2105
62 Ga0070663_100122649 3300005455 Bacteria 1965
63 Ga0070663_100714434 3300005455 Bacteria 853
64 Ga0070678_100000987 3300005456 Bacteria 14698
65 Ga0070678_100044702 3300005456 Bacteria 3164
66 Ga0070678_100720624 3300005456 Bacteria 900
67 Ga0070678_101189261 3300005456 Bacteria 707
68 Ga0070662_100002201 3300005457 Bacteria 11962
69 Ga0070662_100021640 3300005457 Bacteria 4393
70 Ga0070662_100025833 3300005457 Bacteria 4060
71 Ga0070662_100028947 3300005457 Bacteria 3861
72 Ga0070662_100100428 3300005457 Bacteria 2189
73 Ga0070662_101609716 3300005457 Bacteria 560
74 Ga0070681_10127441 3300005458 Bacteria 2478
75 Ga0070681_10154548 3300005458 Bacteria 2220
76 Ga0070681_10282502 3300005458 Bacteria 1570
77 Ga0070681_10453435 3300005458 Bacteria 1195
78 Ga0070685_10165479 3300005466 Bacteria 1413
79 Ga0070679_100131134 3300005530 Bacteria 2488
80 Ga0070679_100163082 3300005530 Bacteria 2202
81 Ga0070679_100541612 3300005530 Unclassified 1108
82 Ga0070684_100012821 3300005535 Bacteria 6732
83 Ga0070684_100985037 3300005535 Bacteria 791
84 Ga0068853_100015045 3300005539 Bacteria 6358
85 Ga0068853_100044906 3300005539 Bacteria 3783
86 Ga0068853_100774198 3300005539 Bacteria 918
87 Ga0070672_100036014 3300005543 Bacteria 3766
88 Ga0070672_100751143 3300005543 Bacteria 856
89 Ga0070693_100363484 3300005547 Unclassified 994
90 Ga0070693_101167007 3300005547 Bacteria 590
91 Ga0070693_101449541 3300005547 Bacteria 535
92 Ga0070665_100040003 3300005548 Bacteria 4714
93 Ga0070665_100912726 3300005548 Bacteria 891
94 Ga0068855_100017589 3300005563 Bacteria 8596
95 Ga0068855_100062530 3300005563 Bacteria 4346
96 Ga0068855_100070358 3300005563 Bacteria 4070
97 Ga0068855_100473024 3300005563 Bacteria 1365
98 Ga0070664_100005904 3300005564 Bacteria 9890
99 Ga0070664_100108259 3300005564 Bacteria 2423
100 Ga0070664_100150353 3300005564 Bacteria 2055
101 Ga0070664_100210637 3300005564 Bacteria 1737
102 Ga0070664_100254909 3300005564 Bacteria 1578
103 Ga0068857_100012685 3300005577 Bacteria 7344
104 Ga0068857_100048552 3300005577 Bacteria 3768
105 Ga0068857_100177985 3300005577 Bacteria 1935
106 Ga0068857_100280569 3300005577 Bacteria 1532
107 Ga0068857_100344988 3300005577 Bacteria 1378
108 Ga0068854_100108131 3300005578 Bacteria 2094
109 Ga0068854_100131067 3300005578 Bacteria 1915
110 Ga0068854_100171759 3300005578 Bacteria 1687
111 Ga0068854_101565094 3300005578 Bacteria 600
112 Ga0068856_100029387 3300005614 Bacteria 5369
113 Ga0068856_100138586 3300005614 Bacteria 2439
114 Ga0068856_100195165 3300005614 Bacteria 2038
115 Ga0068856_100240977 3300005614 Bacteria 1824
116 Ga0068856_100905455 3300005614 Unclassified 901
117 Ga0070702_101459805 3300005615 Bacteria 561
118 Ga0068852_100106625 3300005616 Bacteria 2540
119 Ga0068852_100386202 3300005616 Bacteria 1374
120 Ga0068852_100458317 3300005616 Bacteria 1263
121 Ga0068852_100578085 3300005616 Bacteria 1126
122 Ga0068852_101383432 3300005616 Unclassified 726
123 Ga0068852_102412307 3300005616 Bacteria 546
124 Ga0068859_100039235 3300005617 Bacteria 4750
125 Ga0068859_100570305 3300005617 Bacteria 1226
126 Ga0068864_100027088 3300005618 Bacteria 4836
127 Ga0068864_100027563 3300005618 Bacteria 4799
128 Ga0068864_100241615 3300005618 Bacteria 1673
129 Ga0068866_10196535 3300005718 Bacteria 1202
130 Ga0068866_11324113 3300005718 Bacteria 524
131 Ga0068861_100819859 3300005719 Bacteria 875
132 Ga0068851_10011581 3300005834 Bacteria 4139
133 Ga0068851_10021307 3300005834 Bacteria 3147
134 Ga0068851_10099260 3300005834 Bacteria 1543
135 Ga0068851_10162734 3300005834 Bacteria 1227
136 Ga0068863_100005444 3300005841 Bacteria 12541
137 Ga0068863_100015715 3300005841 Bacteria 7268
138 Ga0068858_100014265 3300005842 Bacteria 7491
139 Ga0068858_100028846 3300005842 Bacteria 5153
140 Ga0068858_101249296 3300005842 Bacteria 730
141 Ga0081539_10034453 3300005985 Bacteria 3061
142 Ga0070716_100451426 3300006173 Bacteria 937
143 Ga0097621_100122269 3300006237 Bacteria 2209
144 Ga0097621_100233582 3300006237 Bacteria 1606
145 Ga0097621_100804565 3300006237 Bacteria 871
146 Ga0068871_100034831 3300006358 Bacteria 3997
147 Ga0068871_100157383 3300006358 Bacteria 1941
148 Ga0068871_100277443 3300006358 Bacteria 1465
149 Ga0068871_100451276 3300006358 Bacteria 1152
150 Ga0068865_100272408 3300006881 Bacteria 1344
151 Ga0097620_100039234 3300006931 Bacteria 4750
152 Ga0097620_100570314 3300006931 Bacteria 1226
153 Ga0105251_10145797 3300009011 Bacteria 1070
154 Ga0105240_10033036 3300009093 Bacteria 6689
155 Ga0105240_10190539 3300009093 Bacteria 2412
156 Ga0105245_10085478 3300009098 Bacteria 2892
157 Ga0105245_12646629 3300009098 Bacteria 555
158 Ga0105245_12719988 3300009098 Bacteria 548
159 Ga0105247_10486105 3300009101 Bacteria 897
160 Ga0105247_10888986 3300009101 Unclassified 687
161 Ga0105243_10854233 3300009148 Bacteria 901
162 Ga0105241_10159858 3300009174 Bacteria 1851
163 Ga0105241_10746676 3300009174 Unclassified 897
164 Ga0105248_10047951 3300009177 Bacteria 4791
165 Ga0105248_10099746 3300009177 Bacteria 3272
166 Ga0105248_10148887 3300009177 Bacteria 2641
167 Ga0105248_10310331 3300009177 Bacteria 1776
168 Ga0105248_10881948 3300009177 Bacteria 1010
169 Ga0105237_10033081 3300009545 Bacteria 5237
170 Ga0105238_10204458 3300009551 Bacteria 1951
171 Ga0105238_10398085 3300009551 Bacteria 1370
172 Ga0105238_11870957 3300009551 Bacteria 633
173 Ga0105239_10102628 3300010375 Bacteria 3165
174 Ga0105246_10025595 3300011119 Bacteria 3848
175 Ga0105246_10565265 3300011119 Bacteria 977
176 Ga0157373_10047662 3300013100 Bacteria 3055
177 Ga0157373_10109534 3300013100 Bacteria 1942
178 Ga0157373_10147011 3300013100 Bacteria 1658
179 Ga0157373_10484954 3300013100 Bacteria 892
180 Ga0157373_11197547 3300013100 Bacteria 572
181 Ga0157371_10053767 3300013102 Bacteria 2860
182 Ga0157371_10124087 3300013102 Bacteria 1837
183 Ga0157370_10001517 3300013104 Bacteria 28707
184 Ga0157370_10023834 3300013104 Bacteria 6071
185 Ga0157370_10087202 3300013104 Bacteria 2932
186 Ga0157370_10116621 3300013104 Bacteria 2494
187 Ga0157370_10712377 3300013104 Bacteria 916
188 Ga0157369_10098440 3300013105 Bacteria 3119
189 Ga0157369_10222295 3300013105 Bacteria 1976
190 Ga0157369_10541216 3300013105 Bacteria 1204
191 Ga0157369_10715774 3300013105 Bacteria 1031
192 Ga0157374_10021678 3300013296 Bacteria 5721
193 Ga0157374_10543124 3300013296 Bacteria 1169
194 Ga0157374_10647382 3300013296 Bacteria 1069
195 Ga0157374_11744243 3300013296 Bacteria 647
196 Ga0157378_10336663 3300013297 Bacteria 1470
197 Ga0157378_10539010 3300013297 Bacteria 1171
198 Ga0163162_11716881 3300013306 Bacteria 717
199 Ga0163162_12261683 3300013306 Bacteria 624
200 Ga0157372_10026078 3300013307 Bacteria 6358
201 Ga0157372_10312418 3300013307 Bacteria 1829
202 Ga0157372_10558193 3300013307 Bacteria 1335
203 Ga0157372_10566452 3300013307 Bacteria 1324
204 Ga0157375_10000628 3300013308 Bacteria 31364
205 Ga0157375_10282498 3300013308 Bacteria 1823
206 Ga0163163_10039381 3300014325 Bacteria 4612
207 Ga0163163_10103156 3300014325 Bacteria 2876
208 Ga0182008_10021234 3300014497 Bacteria 3336
209 Ga0157379_10006699 3300014968 Bacteria 9950
210 Ga0207656_10019810 3300025321 Bacteria 2664
211 Ga0207656_10168699 3300025321 Unclassified 1045
212 Ga0207656_10205441 3300025321 Bacteria 953
213 Ga0207656_10373187 3300025321 Bacteria 714
214 Ga0207656_10388508 3300025321 Bacteria 700
215 Ga0207713_1149285 3300025735 Bacteria 756
216 Ga0207682_10092565 3300025893 Bacteria 1312
217 Ga0207642_10349621 3300025899 Bacteria 872
218 Ga0207680_10301380 3300025903 Bacteria 1117
219 Ga0207680_10895639 3300025903 Bacteria 636
220 Ga0207647_10007595 3300025904 Bacteria 7814
221 Ga0207647_10011650 3300025904 Bacteria 6157
222 Ga0207647_10013310 3300025904 Bacteria 5709
223 Ga0207647_10049486 3300025904 Bacteria 2606
224 Ga0207705_10037024 3300025909 Bacteria 3491
225 Ga0207705_10052717 3300025909 Bacteria 2929
226 Ga0207705_10120794 3300025909 Bacteria 1944
227 Ga0207705_10260440 3300025909 Bacteria 1324
228 Ga0207705_10274235 3300025909 Bacteria 1290
229 Ga0207705_10341952 3300025909 Bacteria 1152
230 Ga0207705_10970533 3300025909 Bacteria 657
231 Ga0207654_10029848 3300025911 Bacteria 2989
232 Ga0207654_10433754 3300025911 Bacteria 919
233 Ga0207707_10095824 3300025912 Bacteria 2593
234 Ga0207707_10197936 3300025912 Bacteria 1752
235 Ga0207707_10530505 3300025912 Bacteria 1002
236 Ga0207695_10052740 3300025913 Bacteria 4258
237 Ga0207695_10828471 3300025913 Unclassified 805
238 Ga0207671_10095841 3300025914 Bacteria 2241
239 Ga0207660_10106855 3300025917 Bacteria 2099
240 Ga0207657_10001203 3300025919 Bacteria 27541
241 Ga0207657_10006831 3300025919 Bacteria 11775
242 Ga0207657_10111680 3300025919 Bacteria 2256
243 Ga0207657_10902087 3300025919 Bacteria 681
244 Ga0207649_10021472 3300025920 Bacteria 3717
245 Ga0207649_10025203 3300025920 Bacteria 3465
246 Ga0207649_10075022 3300025920 Bacteria 2172
247 Ga0207649_10120650 3300025920 Bacteria 1767
248 Ga0207649_10197663 3300025920 Bacteria 1418
249 Ga0207649_10247320 3300025920 Bacteria 1283
250 Ga0207649_10664693 3300025920 Bacteria 806
251 Ga0207649_10896942 3300025920 Bacteria 695
252 Ga0207652_10374844 3300025921 Bacteria 1284
253 Ga0207652_10406678 3300025921 Bacteria 1228
254 Ga0207652_11232406 3300025921 Unclassified 650
255 Ga0207694_10000827 3300025924 Bacteria 27549
256 Ga0207694_10135941 3300025924 Bacteria 1974
257 Ga0207650_10037115 3300025925 Bacteria 3549
258 Ga0207650_10039258 3300025925 Bacteria 3460
259 Ga0207659_10002145 3300025926 Bacteria 11711
260 Ga0207644_10000683 3300025931 Bacteria 21431
261 Ga0207644_10001600 3300025931 Bacteria 14621
262 Ga0207644_10001762 3300025931 Bacteria 14016
263 Ga0207644_10027350 3300025931 Bacteria 3939
264 Ga0207644_10363680 3300025931 Bacteria 1177
265 Ga0207690_10010569 3300025932 Bacteria 5492
266 Ga0207690_10023647 3300025932 Bacteria 3837
267 Ga0207690_10066828 3300025932 Bacteria 2464
268 Ga0207690_10181450 3300025932 Bacteria 1585
269 Ga0207690_10284237 3300025932 Bacteria 1289
270 Ga0207690_11866787 3300025932 Bacteria 501
271 Ga0207706_10002689 3300025933 Bacteria 17328
272 Ga0207706_10012861 3300025933 Bacteria 7617
273 Ga0207706_10034094 3300025933 Bacteria 4530
274 Ga0207706_10057618 3300025933 Bacteria 3422
275 Ga0207706_10068843 3300025933 Bacteria 3113
276 Ga0207706_10084608 3300025933 Bacteria 2789
277 Ga0207706_10158130 3300025933 Bacteria 1992
278 Ga0207706_10324586 3300025933 Bacteria 1339
279 Ga0207706_10400653 3300025933 Bacteria 1190
280 Ga0207709_10998008 3300025935 Bacteria 684
281 Ga0207669_10195384 3300025937 Bacteria 1463
282 Ga0207669_10432125 3300025937 Bacteria 1039
283 Ga0207669_10984164 3300025937 Bacteria 708
284 Ga0207691_10001025 3300025940 Bacteria 27647
285 Ga0207691_10293598 3300025940 Bacteria 1397
286 Ga0207691_10359238 3300025940 Bacteria 1245
287 Ga0207711_10001768 3300025941 Bacteria 19796
288 Ga0207711_10046723 3300025941 Bacteria 3699
289 Ga0207711_10245342 3300025941 Bacteria 1643
290 Ga0207711_10504883 3300025941 Bacteria 1127
291 Ga0207711_10555313 3300025941 Bacteria 1071
292 Ga0207661_10002430 3300025944 Bacteria 12831
293 Ga0207661_10317018 3300025944 Bacteria 1401
294 Ga0207679_10012647 3300025945 Bacteria 5509
295 Ga0207679_10046229 3300025945 Bacteria 3154
296 Ga0207679_10157273 3300025945 Bacteria 1857
297 Ga0207679_10207143 3300025945 Bacteria 1642
298 Ga0207679_10281680 3300025945 Bacteria 1426
299 Ga0207679_10393761 3300025945 Bacteria 1217
300 Ga0207667_10029704 3300025949 Bacteria 5922
301 Ga0207667_10168610 3300025949 Bacteria 2250
302 Ga0207667_10314076 3300025949 Bacteria 1601
303 Ga0207667_10555113 3300025949 Bacteria 1161
304 Ga0207667_10821495 3300025949 Bacteria 925
305 Ga0207651_10209036 3300025960 Bacteria 1569
306 Ga0207640_10040998 3300025981 Bacteria 2942
307 Ga0207640_10144487 3300025981 Bacteria 1739
308 Ga0207640_10710663 3300025981 Bacteria 863
309 Ga0207640_10914031 3300025981 Bacteria 767
310 Ga0207658_10014864 3300025986 Bacteria 5333
311 Ga0207658_10054241 3300025986 Bacteria 2965
312 Ga0207677_10099806 3300026023 Bacteria 2133
313 Ga0207703_10057934 3300026035 Bacteria 3160
314 Ga0207639_10011714 3300026041 Bacteria 6098
315 Ga0207639_10045878 3300026041 Bacteria 3294
316 Ga0207639_10131703 3300026041 Bacteria 2071
317 Ga0207639_10258386 3300026041 Bacteria 1522
318 Ga0207678_10016240 3300026067 Bacteria 6534
319 Ga0207678_10071252 3300026067 Bacteria 2980
320 Ga0207678_10165142 3300026067 Bacteria 1890
321 Ga0207678_11894429 3300026067 Bacteria 520
322 Ga0207702_10013224 3300026078 Bacteria 6863
323 Ga0207702_10029637 3300026078 Bacteria 4555
324 Ga0207702_10230382 3300026078 Bacteria 1731
325 Ga0207702_10390617 3300026078 Bacteria 1340
326 Ga0207702_10539095 3300026078 Bacteria 1140
327 Ga0207641_10081534 3300026088 Bacteria 2809
328 Ga0207641_12357704 3300026088 Bacteria 531
329 Ga0207648_10917635 3300026089 Bacteria 818
330 Ga0207676_10007411 3300026095 Bacteria 7781
331 Ga0207676_10132939 3300026095 Bacteria 2118
332 Ga0207676_10196906 3300026095 Bacteria 1777
333 Ga0207674_10000151 3300026116 Bacteria 81529
334 Ga0207674_10016662 3300026116 Bacteria 8032
335 Ga0207674_10052295 3300026116 Bacteria 4166
336 Ga0207674_10054652 3300026116 Bacteria 4064
337 Ga0207674_10068213 3300026116 Bacteria 3579
338 Ga0207674_10275373 3300026116 Bacteria 1631
339 Ga0207675_101908572 3300026118 Unclassified 612
340 Ga0207683_10000320 3300026121 Bacteria 43863
341 Ga0207683_10004595 3300026121 Bacteria 11896
342 Ga0207683_10337095 3300026121 Bacteria 1383
343 Ga0207683_10508004 3300026121 Bacteria 1113
344 Ga0207698_10024305 3300026142 Bacteria 4250
345 Ga0207698_10161277 3300026142 Bacteria 1961
346 Ga0207698_10859548 3300026142 Bacteria 912
347 Ga0207698_11548532 3300026142 Bacteria 678
348 Ga0207698_12605271 3300026142 Unclassified 515
349 Ga0268266_10146564 3300028379 Bacteria 2123
350 Ga0268266_10826473 3300028379 Bacteria 895
351 Ga0268264_11431931 3300028381 Unclassified 702
352 Ga0307408_100499691 3300031548 Bacteria 1064
353 Ga0307405_10054676 3300031731 Bacteria 2494
354 Ga0307405_10161501 3300031731 Bacteria 1588
355 Ga0307413_10040078 3300031824 Bacteria 2730
356 Ga0307413_10563491 3300031824 Bacteria 926
357 Ga0307410_10007520 3300031852 Bacteria 5970
358 Ga0307410_10562444 3300031852 Bacteria 946
359 Ga0307410_10987600 3300031852 Bacteria 725
360 Ga0307412_10041862 3300031911 Bacteria 2972
361 Ga0307412_10123096 3300031911 Bacteria 1871
362 Ga0307409_100928874 3300031995 Bacteria 885
363 Ga0307409_101375898 3300031995 Bacteria 732
364 Ga0307416_100010313 3300032002 Bacteria 6166
365 Ga0307416_101285968 3300032002 Unclassified 837
366 Ga0307416_101577335 3300032002 Unclassified 762
367 Ga0307416_102485801 3300032002 Bacteria 617
368 Ga0307411_10006327 3300032005 Bacteria 5919
369 Ga0307411_10029296 3300032005 Bacteria 3359
370 Ga0307415_100003799 3300032126 Bacteria 7739
371 Ga0307415_100073475 3300032126 Bacteria 2413
372 Ga0307415_100935236 3300032126 Bacteria 801
373 Ga0307415_101264410 3300032126 Bacteria 698
374 Ga0307415_101918678 3300032126 Bacteria 575
375 Ga0373953_0361275 3300035117 Bacteria 637
376 Ga0373943_0009058 3300035170 Bacteria 4463
377 Ga0373935_0021393 3300035692 Bacteria 3960
378 Ga0373927_0120021 3300035695 Bacteria 1716
379 Ga0373947_0099074 3300035725 Bacteria 1829
380 Ga0373937_1328989 3300036401 Bacteria 667
381 Ga0373925_0010491 3300037068 Bacteria 6720
382 Ga0395899_0003473 3300037312 Bacteria 12489
383 Ga0395899_0020205 3300037312 Bacteria 5054
384 Ga0395899_0031060 3300037312 Bacteria 4016
385 Ga0395899_0049312 3300037312 Bacteria 3130
386 Ga0395899_0082429 3300037312 Bacteria 2339
387 Ga0395899_0622817 3300037312 Bacteria 685
388 Ga0395899_0745712 3300037312 Bacteria 610
389 Ga0395900_0002862 3300037418 Bacteria 18816
390 Ga0395900_0037607 3300037418 Bacteria 4989
391 Ga0395900_0078308 3300037418 Bacteria 3396
392 Ga0395900_0089076 3300037418 Bacteria 3172
393 Ga0395900_0101140 3300037418 Bacteria 2960
394 Ga0395900_0157202 3300037418 Bacteria 2321
395 Ga0395900_0212247 3300037418 Bacteria 1954
396 Ga0395900_0407056 3300037418 Bacteria 1323
397 Ga0395900_0491106 3300037418 Unclassified 1179
398 Ga0395900_0644995 3300037418 Bacteria 996
399 Ga0395900_0852572 3300037418 Unclassified 836
400 Ga0395898_0004873 3300037466 Bacteria 14574
401 Ga0395898_0013098 3300037466 Bacteria 8551
402 Ga0395898_0013433 3300037466 Bacteria 8433
403 Ga0395898_0074094 3300037466 Bacteria 3289
404 Ga0395898_0136629 3300037466 Bacteria 2347
405 Ga0395898_0224976 3300037466 Bacteria 1789
406 Ga0395898_0394174 3300037466 Bacteria 1320
407 Ga0395898_0636152 3300037466 Bacteria 1009
408 Ga0395905_0000298 3300037471 Bacteria 72500
409 Ga0395905_0005814 3300037471 Bacteria 12532
410 Ga0395905_0010033 3300037471 Bacteria 9233
411 Ga0395905_0012838 3300037471 Bacteria 8053
412 Ga0395905_0013098 3300037471 Bacteria 7961
413 Ga0395905_0016570 3300037471 Bacteria 7005
414 Ga0395905_0017200 3300037471 Bacteria 6868
415 Ga0395905_0037694 3300037471 Bacteria 4537
416 Ga0395905_0075405 3300037471 Bacteria 3161
417 Ga0395905_0078905 3300037471 Bacteria 3085
418 Ga0395905_0100666 3300037471 Bacteria 2713
419 Ga0395905_0157828 3300037471 Bacteria 2133
420 Ga0395905_0791026 3300037471 Bacteria 851
421 Ga0395905_1351251 3300037471 Bacteria 616
422 Ga0395905_1603286 3300037471 Bacteria 556
423 Ga0395901_0014555 3300038443 Bacteria 7998
424 Ga0395901_0034237 3300038443 Bacteria 5245
425 Ga0395901_0041244 3300038443 Bacteria 4782
426 Ga0395901_0046424 3300038443 Bacteria 4512
427 Ga0395901_0054246 3300038443 Bacteria 4165
428 Ga0395901_0054897 3300038443 Bacteria 4141
429 Ga0395901_0282131 3300038443 Bacteria 1725
430 Ga0395901_0610753 3300038443 Bacteria 1098
431 Ga0395901_0809188 3300038443 Bacteria 925
432 Ga0395901_0928561 3300038443 Bacteria 850
433 Ga0439448_0005770 3300042005 Bacteria 3536
434 Ga0439455_0137257 3300042012 Bacteria 692
435 Ga0439458_0000044 3300042157 Bacteria 20076
436 Ga0439458_0001063 3300042157 Bacteria 6996
437 Ga0466969_0004255 3300044656 Bacteria 7609
438 Ga0466966_0038521 3300044684 Bacteria 3081
439 Ga0466961_0099433 3300044693 Bacteria 1833
440 Ga0466963_0631606 3300044694 Bacteria 756
441 Ga0466963_0668150 3300044694 Bacteria 733
442 Ga0466964_0163939 3300044706 Bacteria 1041
443 Ga0466971_0068162 3300044719 Bacteria 1613
444 Ga0466970_0058550 3300044765 Bacteria 2062
445 Ga0466957_0195729 3300044842 Bacteria 1326
446 Ga0466957_0325833 3300044842 Bacteria 1037
447 Ga0466957_0639163 3300044842 Bacteria 747
448 Ga0466957_0931364 3300044842 Bacteria 622
449 Ga0466959_0067989 3300045049 Bacteria 2582
450 Ga0466959_0130239 3300045049 Bacteria 1783
451 Ga0466958_0041192 3300045836 Bacteria 2778
452 Ga0466958_0086151 3300045836 Bacteria 1938
453 Ga0466967_0441728 3300045976 Bacteria 1270
454 Ga0466967_0705019 3300045976 Bacteria 1000
455 Ga0495580_0644770 3300046472 Bacteria 697
456 Ga0495643_0380438 3300046522 Bacteria 626
457 Ga0495663_0063870 3300046525 Bacteria 1161
458 Ga0495642_0023569 3300046528 Bacteria 2430
459 Ga0495621_0001286 3300046539 Bacteria 6473
460 Ga0495668_0543614 3300046616 Unclassified 641
461 Ga0495659_0085914 3300046664 Bacteria 1201
462 Ga0495669_0035435 3300046684 Bacteria 2203
463 Ga0495670_0010365 3300046691 Bacteria 4579
464 Ga0495600_0960169 3300046809 Bacteria 502
465 Ga0496100_0029442 3300048903 Bacteria 3396
466 Ga0496100_0416644 3300048903 Bacteria 1025
467 Ga0496100_0428405 3300048903 Bacteria 1011
468 Ga0496101_0018417 3300048904 Bacteria 4748
469 Ga0496101_0040191 3300048904 Bacteria 3331
470 Ga0496101_0309401 3300048904 Bacteria 1238
471 Ga0496101_0984937 3300048904 Bacteria 663
472 Ga0496102_0032743 3300048905 Bacteria 4671
473 Ga0496102_0089808 3300048905 Bacteria 2843
474 Ga0496102_1129776 3300048905 Bacteria 703
475 Ga0496103_0053671 3300048906 Bacteria 2498
476 Ga0496103_0225908 3300048906 Bacteria 1204
477 Ga0496103_0423482 3300048906 Bacteria 855
478 Ga0496104_0228759 3300048907 Bacteria 1772
479 Ga0496105_0163192 3300048908 Bacteria 1829
480 Ga0496106_0431757 3300048909 Bacteria 1058
481 Ga0496106_0971460 3300048909 Bacteria 669
482 Ga0496107_0009496 3300048910 Bacteria 6748
483 Ga0496107_0023801 3300048910 Bacteria 4329
484 Ga0496108_0006067 3300048911 Bacteria 9772
485 Ga0496108_0172893 3300048911 Bacteria 1869
486 Ga0496109_0030175 3300048912 Bacteria 4860
487 Ga0496109_0400519 3300048912 Bacteria 1297
488 Ga0496110_0051335 3300048913 Bacteria 3623
489 Ga0496110_0056647 3300048913 Bacteria 3449
490 Ga0496111_0023502 3300048914 Bacteria 4328
491 Ga0496111_0028546 3300048914 Bacteria 3954
492 Ga0496112_0021106 3300048915 Bacteria 6187
493 Ga0496112_0035609 3300048915 Bacteria 4851
494 Ga0496112_0570541 3300048915 Bacteria 1064
495 Ga0496113_0000705 3300048916 Bacteria 17089
496 Ga0496113_0065990 3300048916 Bacteria 2740
497 Ga0496114_0037701 3300048917 Bacteria 3999
498 Ga0496115_0165939 3300048918 Bacteria 1826
499 Ga0466962_0200042 3300061719 Bacteria 976
500 Ga0070666_10105586
501 JGI24736J21556_1043550
502 JGI24741J21665_1018617
503 JGI24752J21851_1013737
504 JGI24752J21851_1031632
505 JGI24740J21852_10029382
506 JGI24740J21852_10030530
507 JGI24740J21852_10053474
508 JGI24740J21852_10066845
509 JGI24740J21852_10079786
510 JGI24740J21852_10086954
511 JGI24739J22299_10263310
512 JGI24735J21928_10013077
513 JGI24735J21928_10043534
514 Ga0065712_10484989
515 Ga0065715_10906711
516 Ga0070658_10024172
517 Ga0070658_10198384
518 Ga0070683_100028957
519 Ga0070683_100891990
520 Ga0070690_100076102
521 Ga0070690_101078927
522 Ga0070670_100008721
523 Ga0070670_100172841
524 Ga0070666_10029789
525 Ga0070680_100338495
526 Ga0070682_100309819
527 Ga0068868_100031844
528 Ga0070660_100024121
529 Ga0070660_101039761
530 Ga0070691_10942357
531 Ga0070661_100022050
532 Ga0070661_100049228
533 Ga0070661_100056692
534 Ga0070661_100220226
535 Ga0070661_100794663
536 Ga0070692_10252811
537 Ga0070692_10631376
538 Ga0070668_101998610
539 Ga0070669_100454622
540 Ga0070675_100007402
541 Ga0070671_100006556
542 Ga0070671_100014082
543 Ga0070671_100031934
544 Ga0070671_100049124
545 Ga0070671_100358739
546 Ga0070674_100327641
547 Ga0070674_100373790
548 Ga0070673_100209589
549 Ga0070673_100820745
550 Ga0070659_100005750
551 Ga0070659_100060947
552 Ga0070659_100090934
553 Ga0070659_100454866
554 Ga0070659_100975746
555 Ga0070667_100011561
556 Ga0070667_100115483
557 Ga0070667_100307342
558 Ga0070714_100405039
559 Ga0070713_100364693
560 Ga0070663_100105936
561 Ga0070663_100122649
562 Ga0070663_100714434
563 Ga0070678_100000987
564 Ga0070678_100044702
565 Ga0070678_100720624
566 Ga0070678_101189261
567 Ga0070662_100002201
568 Ga0070662_100021640
569 Ga0070662_100025833
570 Ga0070662_100028947
571 Ga0070662_100100428
572 Ga0070662_101609716
573 Ga0070681_10127441
574 Ga0070681_10154548
575 Ga0070681_10282502
576 Ga0070681_10453435
577 Ga0070685_10165479
578 Ga0070679_100131134
579 Ga0070679_100163082
580 Ga0070679_100541612
581 Ga0070684_100012821
582 Ga0070684_100985037
583 Ga0068853_100015045
584 Ga0068853_100044906
585 Ga0068853_100774198
586 Ga0070672_100036014
587 Ga0070672_100751143
588 Ga0070693_100363484
589 Ga0070693_101167007
590 Ga0070693_101449541
591 Ga0070665_100040003
592 Ga0070665_100912726
593 Ga0068855_100017589
594 Ga0068855_100062530
595 Ga0068855_100070358
596 Ga0068855_100473024
597 Ga0070664_100005904
598 Ga0070664_100108259
599 Ga0070664_100150353
600 Ga0070664_100210637
601 Ga0070664_100254909
602 Ga0068857_100012685
603 Ga0068857_100048552
604 Ga0068857_100177985
605 Ga0068857_100280569
606 Ga0068857_100344988
607 Ga0068854_100108131
608 Ga0068854_100131067
609 Ga0068854_100171759
610 Ga0068854_101565094
611 Ga0068856_100029387
612 Ga0068856_100138586
613 Ga0068856_100195165
614 Ga0068856_100240977
615 Ga0068856_100905455
616 Ga0070702_101459805
617 Ga0068852_100106625
618 Ga0068852_100386202
619 Ga0068852_100458317
620 Ga0068852_100578085
621 Ga0068852_101383432
622 Ga0068852_102412307
623 Ga0068859_100039235
624 Ga0068859_100570305
625 Ga0068864_100027088
626 Ga0068864_100027563
627 Ga0068864_100241615
628 Ga0068866_10196535
629 Ga0068866_11324113
630 Ga0068861_100819859
631 Ga0068851_10011581
632 Ga0068851_10021307
633 Ga0068851_10099260
634 Ga0068851_10162734
635 Ga0068863_100005444
636 Ga0068863_100015715
637 Ga0068858_100014265
638 Ga0068858_100028846
639 Ga0068858_101249296
640 Ga0081539_10034453
641 Ga0070716_100451426
642 Ga0097621_100122269
643 Ga0097621_100233582
644 Ga0097621_100804565
645 Ga0068871_100034831
646 Ga0068871_100157383
647 Ga0068871_100277443
648 Ga0068871_100451276
649 Ga0068865_100272408
650 Ga0097620_100039234
651 Ga0097620_100570314
652 Ga0105251_10145797
653 Ga0105240_10033036
654 Ga0105240_10190539
655 Ga0105245_10085478
656 Ga0105245_12646629
657 Ga0105245_12719988
658 Ga0105247_10486105
659 Ga0105247_10888986
660 Ga0105243_10854233
661 Ga0105241_10159858
662 Ga0105241_10746676
663 Ga0105248_10047951
664 Ga0105248_10099746
665 Ga0105248_10148887
666 Ga0105248_10310331
667 Ga0105248_10881948
668 Ga0105237_10033081
669 Ga0105238_10204458
670 Ga0105238_10398085
671 Ga0105238_11870957
672 Ga0105239_10102628
673 Ga0105246_10025595
674 Ga0105246_10565265
675 Ga0157373_10047662
676 Ga0157373_10109534
677 Ga0157373_10147011
678 Ga0157373_10484954
679 Ga0157373_11197547
680 Ga0157371_10053767
681 Ga0157371_10124087
682 Ga0157370_10001517
683 Ga0157370_10023834
684 Ga0157370_10087202
685 Ga0157370_10116621
686 Ga0157370_10712377
687 Ga0157369_10098440
688 Ga0157369_10222295
689 Ga0157369_10541216
690 Ga0157369_10715774
691 Ga0157374_10021678
692 Ga0157374_10543124
693 Ga0157374_10647382
694 Ga0157374_11744243
695 Ga0157378_10336663
696 Ga0157378_10539010
697 Ga0163162_11716881
698 Ga0163162_12261683
699 Ga0157372_10026078
700 Ga0157372_10312418
701 Ga0157372_10558193
702 Ga0157372_10566452
703 Ga0157375_10000628
704 Ga0157375_10282498
705 Ga0163163_10039381
706 Ga0163163_10103156
707 Ga0182008_10021234
708 Ga0157379_10006699
709 Ga0207656_10019810
710 Ga0207656_10168699
711 Ga0207656_10205441
712 Ga0207656_10373187
713 Ga0207656_10388508
714 Ga0207713_1149285
715 Ga0207682_10092565
716 Ga0207642_10349621
717 Ga0207680_10301380
718 Ga0207680_10895639
719 Ga0207647_10007595
720 Ga0207647_10011650
721 Ga0207647_10013310
722 Ga0207647_10049486
723 Ga0207705_10037024
724 Ga0207705_10052717
725 Ga0207705_10120794
726 Ga0207705_10260440
727 Ga0207705_10274235
728 Ga0207705_10341952
729 Ga0207705_10970533
730 Ga0207654_10029848
731 Ga0207654_10433754
732 Ga0207707_10095824
733 Ga0207707_10197936
734 Ga0207707_10530505
735 Ga0207695_10052740
736 Ga0207695_10828471
737 Ga0207671_10095841
738 Ga0207660_10106855
739 Ga0207657_10001203
740 Ga0207657_10006831
741 Ga0207657_10111680
742 Ga0207657_10902087
743 Ga0207649_10021472
744 Ga0207649_10025203
745 Ga0207649_10075022
746 Ga0207649_10120650
747 Ga0207649_10197663
748 Ga0207649_10247320
749 Ga0207649_10664693
750 Ga0207649_10896942
751 Ga0207652_10374844
752 Ga0207652_10406678
753 Ga0207652_11232406
754 Ga0207694_10000827
755 Ga0207694_10135941
756 Ga0207650_10037115
757 Ga0207650_10039258
758 Ga0207659_10002145
759 Ga0207644_10000683
760 Ga0207644_10001600
761 Ga0207644_10001762
762 Ga0207644_10027350
763 Ga0207644_10363680
764 Ga0207690_10010569
765 Ga0207690_10023647
766 Ga0207690_10066828
767 Ga0207690_10181450
768 Ga0207690_10284237
769 Ga0207690_11866787
770 Ga0207706_10002689
771 Ga0207706_10012861
772 Ga0207706_10034094
773 Ga0207706_10057618
774 Ga0207706_10068843
775 Ga0207706_10084608
776 Ga0207706_10158130
777 Ga0207706_10324586
778 Ga0207706_10400653
779 Ga0207709_10998008
780 Ga0207669_10195384
781 Ga0207669_10432125
782 Ga0207669_10984164
783 Ga0207691_10001025
784 Ga0207691_10293598
785 Ga0207691_10359238
786 Ga0207711_10001768
787 Ga0207711_10046723
788 Ga0207711_10245342
789 Ga0207711_10504883
790 Ga0207711_10555313
791 Ga0207661_10002430
792 Ga0207661_10317018
793 Ga0207679_10012647
794 Ga0207679_10046229
795 Ga0207679_10157273
796 Ga0207679_10207143
797 Ga0207679_10281680
798 Ga0207679_10393761
799 Ga0207667_10029704
800 Ga0207667_10168610
801 Ga0207667_10314076
802 Ga0207667_10555113
803 Ga0207667_10821495
804 Ga0207651_10209036
805 Ga0207640_10040998
806 Ga0207640_10144487
807 Ga0207640_10710663
808 Ga0207640_10914031
809 Ga0207658_10014864
810 Ga0207658_10054241
811 Ga0207677_10099806
812 Ga0207703_10057934
813 Ga0207639_10011714
814 Ga0207639_10045878
815 Ga0207639_10131703
816 Ga0207639_10258386
817 Ga0207678_10016240
818 Ga0207678_10071252
819 Ga0207678_10165142
820 Ga0207678_11894429
821 Ga0207702_10013224
822 Ga0207702_10029637
823 Ga0207702_10230382
824 Ga0207702_10390617
825 Ga0207702_10539095
826 Ga0207641_10081534
827 Ga0207641_12357704
828 Ga0207648_10917635
829 Ga0207676_10007411
830 Ga0207676_10132939
831 Ga0207676_10196906
832 Ga0207674_10000151
833 Ga0207674_10016662
834 Ga0207674_10052295
835 Ga0207674_10054652
836 Ga0207674_10068213
837 Ga0207674_10275373
838 Ga0207675_101908572
839 Ga0207683_10000320
840 Ga0207683_10004595
841 Ga0207683_10337095
842 Ga0207683_10508004
843 Ga0207698_10024305
844 Ga0207698_10161277
845 Ga0207698_10859548
846 Ga0207698_11548532
847 Ga0207698_12605271
848 Ga0268266_10146564
849 Ga0268266_10826473
850 Ga0268264_11431931
851 Ga0307408_100499691
852 Ga0307405_10054676
853 Ga0307405_10161501
854 Ga0307413_10040078
855 Ga0307413_10563491
856 Ga0307410_10007520
857 Ga0307410_10562444
858 Ga0307410_10987600
859 Ga0307412_10041862
860 Ga0307412_10123096
861 Ga0307409_100928874
862 Ga0307409_101375898
863 Ga0307416_100010313
864 Ga0307416_101285968
865 Ga0307416_101577335
866 Ga0307416_102485801
867 Ga0307411_10006327
868 Ga0307411_10029296
869 Ga0307415_100003799
870 Ga0307415_100073475
871 Ga0307415_100935236
872 Ga0307415_101264410
873 Ga0307415_101918678
874 Ga0373953_0361275
875 Ga0373943_0009058
876 Ga0373935_0021393
877 Ga0373927_0120021
878 Ga0373947_0099074
879 Ga0373937_1328989
880 Ga0373925_0010491
881 Ga0395899_0003473
882 Ga0395899_0020205
883 Ga0395899_0031060
884 Ga0395899_0049312
885 Ga0395899_0082429
886 Ga0395899_0622817
887 Ga0395899_0745712
888 Ga0395900_0002862
889 Ga0395900_0037607
890 Ga0395900_0078308
891 Ga0395900_0089076
892 Ga0395900_0101140
893 Ga0395900_0157202
894 Ga0395900_0212247
895 Ga0395900_0407056
896 Ga0395900_0491106
897 Ga0395900_0644995
898 Ga0395900_0852572
899 Ga0395898_0004873
900 Ga0395898_0013098
901 Ga0395898_0013433
902 Ga0395898_0074094
903 Ga0395898_0136629
904 Ga0395898_0224976
905 Ga0395898_0394174
906 Ga0395898_0636152
907 Ga0395905_0000298
908 Ga0395905_0005814
909 Ga0395905_0010033
910 Ga0395905_0012838
911 Ga0395905_0013098
912 Ga0395905_0016570
913 Ga0395905_0017200
914 Ga0395905_0037694
915 Ga0395905_0075405
916 Ga0395905_0078905
917 Ga0395905_0100666
918 Ga0395905_0157828
919 Ga0395905_0791026
920 Ga0395905_1351251
921 Ga0395905_1603286
922 Ga0395901_0014555
923 Ga0395901_0034237
924 Ga0395901_0041244
925 Ga0395901_0046424
926 Ga0395901_0054246
927 Ga0395901_0054897
928 Ga0395901_0282131
929 Ga0395901_0610753
930 Ga0395901_0809188
931 Ga0395901_0928561
932 Ga0439448_0005770
933 Ga0439455_0137257
934 Ga0439458_0000044
935 Ga0439458_0001063
936 Ga0466969_0004255
937 Ga0466966_0038521
938 Ga0466961_0099433
939 Ga0466963_0631606
940 Ga0466963_0668150
941 Ga0466964_0163939
942 Ga0466971_0068162
943 Ga0466970_0058550
944 Ga0466957_0195729
945 Ga0466957_0325833
946 Ga0466957_0639163
947 Ga0466957_0931364
948 Ga0466959_0067989
949 Ga0466959_0130239
950 Ga0466958_0041192
951 Ga0466958_0086151
952 Ga0466967_0441728
953 Ga0466967_0705019
954 Ga0495580_0644770
955 Ga0495643_0380438
956 Ga0495663_0063870
957 Ga0495642_0023569
958 Ga0495621_0001286
959 Ga0495668_0543614
960 Ga0495659_0085914
961 Ga0495669_0035435
962 Ga0495670_0010365
963 Ga0495600_0960169
964 Ga0496100_0029442
965 Ga0496100_0416644
966 Ga0496100_0428405
967 Ga0496101_0018417
968 Ga0496101_0040191
969 Ga0496101_0309401
970 Ga0496101_0984937
971 Ga0496102_0032743
972 Ga0496102_0089808
973 Ga0496102_1129776
974 Ga0496103_0053671
975 Ga0496103_0225908
976 Ga0496103_0423482
977 Ga0496104_0228759
978 Ga0496105_0163192
979 Ga0496106_0431757
980 Ga0496106_0971460
981 Ga0496107_0009496
982 Ga0496107_0023801
983 Ga0496108_0006067
984 Ga0496108_0172893
985 Ga0496109_0030175
986 Ga0496109_0400519
987 Ga0496110_0051335
988 Ga0496110_0056647
989 Ga0496111_0023502
990 Ga0496111_0028546
991 Ga0496112_0021106
992 Ga0496112_0035609
993 Ga0496112_0570541
994 Ga0496113_0000705
995 Ga0496113_0065990
996 Ga0496114_0037701
997 Ga0496115_0165939
998 Ga0466962_0200042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06305

LapA_dom

Lipopolysaccharide assembly protein A domain

22

85

0.93

Map