F455202

General Info

Members Datasets Scaffolds Average Seq Length
498 302 996 254

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10428439|Ga0207660_104284391
Length 285
Sequence MKVRAANGLADIRCWIVCVSTVGALVAPAHPSWSQRRETVAIRGHNGDVGEAYYARPVGPGPFPGVVLIHHLPGWDEWCKEQTRKLAHHGFAAIDPHLYFREGPGSPDDVGARVRAAGGVADAQVMGDVAGAAAFLRAQPYSNGKVAVMGFCSGGRHAYLAACTVPGFDAVVDCWGGNVIVDDPNALNDKRPVAPIDLTDKLKIPVLGLFGNDDGNPTADQVNRTEAVLKKLGKSYEFYRYDGVGHAFFNYERPGFKPEPMLEGWKRVFTFLNKHLATPLATAAE

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
297 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 0
Rhizoplane 7.63
Rhizosphere 85.34
Stem 0
Stem Tuber 0
Unclassified 6.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_10428439 3300025917 Unclassified 1068
2 JGI24750J21931_1001322 3300002070 Bacteria 3121
3 JGI24748J21848_1006041 3300002074 Bacteria 1409
4 JGI24744J21845_10000476 3300002077 Bacteria 7120
5 JGI24742J22300_10002181 3300002244 Bacteria 3121
6 Ga0070658_10095043 3300005327 Bacteria 2460
7 Ga0070690_100041020 3300005330 Bacteria 2929
8 Ga0070690_100082250 3300005330 Bacteria 2108
9 Ga0070690_100117372 3300005330 Bacteria 1782
10 Ga0070670_100057253 3300005331 Bacteria 3347
11 Ga0068869_100063329 3300005334 Bacteria 2716
12 Ga0070666_10066992 3300005335 Bacteria 2438
13 Ga0070680_100018259 3300005336 Bacteria 5539
14 Ga0070680_100253143 3300005336 Unclassified 1489
15 Ga0068868_100034119 3300005338 Bacteria 3927
16 Ga0070660_100085773 3300005339 Bacteria 2477
17 Ga0070689_100011034 3300005340 Bacteria 6460
18 Ga0070689_100079514 3300005340 Bacteria 2572
19 Ga0070689_100344502 3300005340 Bacteria 1249
20 Ga0070687_100067385 3300005343 Bacteria 1911
21 Ga0070687_100289493 3300005343 Unclassified 1034
22 Ga0070661_100319936 3300005344 Bacteria 1212
23 Ga0070692_10039673 3300005345 Bacteria 2405
24 Ga0070669_100034721 3300005353 Bacteria 3651
25 Ga0070675_100027493 3300005354 Bacteria 4570
26 Ga0070671_100042716 3300005355 Bacteria 3768
27 Ga0070671_100267866 3300005355 Bacteria 1452
28 Ga0070671_100346061 3300005355 Bacteria 1268
29 Ga0070674_100071780 3300005356 Bacteria 2450
30 Ga0070674_100089715 3300005356 Bacteria 2215
31 Ga0070674_100163258 3300005356 Bacteria 1692
32 Ga0070673_100002526 3300005364 Bacteria 11177
33 Ga0070688_100018147 3300005365 Bacteria 4054
34 Ga0070659_100087275 3300005366 Bacteria 2497
35 Ga0070667_100113407 3300005367 Bacteria 2353
36 Ga0070714_100091977 3300005435 Bacteria 2658
37 Ga0070713_100047429 3300005436 Bacteria 3531
38 Ga0070713_100647650 3300005436 Bacteria 1006
39 Ga0070713_100809275 3300005436 Bacteria 898
40 Ga0070710_10164476 3300005437 Bacteria 1378
41 Ga0070711_100079928 3300005439 Bacteria 2327
42 Ga0070711_100103403 3300005439 Bacteria 2076
43 Ga0070705_100174443 3300005440 Bacteria 1450
44 Ga0070705_100403424 3300005440 Bacteria 1013
45 Ga0070700_100084574 3300005441 Bacteria 2056
46 Ga0070708_100022020 3300005445 Bacteria 5402
47 Ga0070663_100160812 3300005455 Bacteria 1728
48 Ga0070678_100057593 3300005456 Bacteria 2848
49 Ga0070678_100078313 3300005456 Bacteria 2497
50 Ga0070662_100061316 3300005457 Bacteria 2745
51 Ga0070662_100835356 3300005457 Bacteria 784
52 Ga0070681_10035474 3300005458 Bacteria 5010
53 Ga0070681_10344377 3300005458 Bacteria 1401
54 Ga0068867_100013474 3300005459 Bacteria 5793
55 Ga0070685_10044174 3300005466 Bacteria 2550
56 Ga0070707_100041972 3300005468 Unclassified 4379
57 Ga0070699_100282653 3300005518 Bacteria 1486
58 Ga0070679_100024950 3300005530 Bacteria 5862
59 Ga0070679_100069129 3300005530 Bacteria 3523
60 Ga0070697_100005061 3300005536 Unclassified 10128
61 Ga0068853_100348746 3300005539 Bacteria 1377
62 Ga0070672_100056653 3300005543 Bacteria 3075
63 Ga0070686_100066325 3300005544 Bacteria 2347
64 Ga0070686_100168924 3300005544 Bacteria 1546
65 Ga0070696_100102091 3300005546 Bacteria 2056
66 Ga0070696_100110737 3300005546 Bacteria 1977
67 Ga0070693_100010398 3300005547 Bacteria 4663
68 Ga0070665_100071652 3300005548 Bacteria 3472
69 Ga0070665_100316454 3300005548 Bacteria 1565
70 Ga0070704_100232851 3300005549 Bacteria 1504
71 Ga0070664_100134528 3300005564 Bacteria 2173
72 Ga0068857_100110632 3300005577 Bacteria 2469
73 Ga0068854_100013365 3300005578 Bacteria 5385
74 Ga0068856_100211682 3300005614 Bacteria 1954
75 Ga0070702_100026893 3300005615 Bacteria 3097
76 Ga0070702_100104613 3300005615 Bacteria 1743
77 Ga0070702_100280424 3300005615 Bacteria 1144
78 Ga0068852_100045704 3300005616 Bacteria 3726
79 Ga0068859_100077773 3300005617 Bacteria 3358
80 Ga0068864_100090129 3300005618 Bacteria 2703
81 Ga0068866_10063795 3300005718 Bacteria 1921
82 Ga0068861_100242907 3300005719 Bacteria 1532
83 Ga0068861_100330874 3300005719 Bacteria 1330
84 Ga0068870_10010066 3300005840 Bacteria 4325
85 Ga0068858_100489462 3300005842 Bacteria 1188
86 Ga0068862_100020669 3300005844 Bacteria 5500
87 Ga0081455_10005147 3300005937 Bacteria 14405
88 Ga0081455_10015547 3300005937 Bacteria 7389
89 Ga0081455_10021090 3300005937 Bacteria 6117
90 Ga0081455_10072363 3300005937 Bacteria 2854
91 Ga0081455_10138625 3300005937 Bacteria 1892
92 Ga0081538_10059249 3300005981 Bacteria 2213
93 Ga0081540_1000192 3300005983 Bacteria 63477
94 Ga0081540_1006458 3300005983 Bacteria 8535
95 Ga0081540_1040161 3300005983 Bacteria 2442
96 Ga0070717_10022173 3300006028 Bacteria 5016
97 Ga0070717_10145388 3300006028 Bacteria 2048
98 Ga0070717_10209035 3300006028 Bacteria 1712
99 Ga0075365_10006486 3300006038 Bacteria 6442
100 Ga0075365_10060105 3300006038 Bacteria 2535
101 Ga0075365_10113700 3300006038 Bacteria 1862
102 Ga0075365_10141157 3300006038 Bacteria 1672
103 Ga0075365_10235337 3300006038 Bacteria 1286
104 Ga0075363_100071432 3300006048 Bacteria 1886
105 Ga0075364_10071178 3300006051 Bacteria 2290
106 Ga0075364_10079244 3300006051 Bacteria 2170
107 Ga0070715_10002531 3300006163 Bacteria 5632
108 Ga0070712_100001451 3300006175 Bacteria 14455
109 Ga0070712_100016897 3300006175 Bacteria 4719
110 Ga0070712_100069192 3300006175 Bacteria 2518
111 Ga0070712_100110960 3300006175 Bacteria 2047
112 Ga0070712_100388891 3300006175 Unclassified 1150
113 Ga0070712_100467749 3300006175 Bacteria 1052
114 Ga0075362_10104769 3300006177 Bacteria 1326
115 Ga0075362_10113518 3300006177 Bacteria 1277
116 Ga0075367_10022407 3300006178 Bacteria 3543
117 Ga0075367_10131941 3300006178 Bacteria 1544
118 Ga0075367_10200768 3300006178 Bacteria 1246
119 Ga0075366_10012203 3300006195 Bacteria 4870
120 Ga0075370_10083274 3300006353 Bacteria 1840
121 Ga0068871_100045011 3300006358 Bacteria 3550
122 Ga0068871_100591319 3300006358 Bacteria 1008
123 Ga0075428_100186800 3300006844 Bacteria 2242
124 Ga0075430_100017996 3300006846 Bacteria 6016
125 Ga0075431_100079433 3300006847 Bacteria 3386
126 Ga0075431_100164560 3300006847 Bacteria 2280
127 Ga0075431_100222512 3300006847 Bacteria 1925
128 Ga0075434_100027344 3300006871 Bacteria 5600
129 Ga0075434_100033205 3300006871 Bacteria 5092
130 Ga0075434_100051342 3300006871 Bacteria 4098
131 Ga0075434_100231180 3300006871 Bacteria 1868
132 Ga0075434_100682754 3300006871 Bacteria 1045
133 Ga0075429_100031205 3300006880 Bacteria 4631
134 Ga0068865_100048973 3300006881 Bacteria 2910
135 Ga0068865_100393658 3300006881 Bacteria 1133
136 Ga0068865_100463783 3300006881 Bacteria 1050
137 Ga0075436_100006369 3300006914 Bacteria 8090
138 Ga0075436_100265942 3300006914 Bacteria 1224
139 Ga0097620_100077776 3300006931 Bacteria 3358
140 Ga0075435_100136427 3300007076 Bacteria 2056
141 Ga0075435_100232688 3300007076 Bacteria 1566
142 Ga0099794_10038112 3300007265 Archaea 2277
143 Ga0105240_10212514 3300009093 Bacteria 2259
144 Ga0111539_10024422 3300009094 Bacteria 7417
145 Ga0111539_10079745 3300009094 Bacteria 3851
146 Ga0105247_10049816 3300009101 Bacteria 2576
147 Ga0105247_10147417 3300009101 Bacteria 1548
148 Ga0114129_10009821 3300009147 Bacteria 13648
149 Ga0114129_10132099 3300009147 Bacteria 3427
150 Ga0114129_10134756 3300009147 Bacteria 3389
151 Ga0114129_11297836 3300009147 Bacteria 902
152 Ga0105241_10097281 3300009174 Bacteria 2333
153 Ga0105242_10223307 3300009176 Bacteria 1685
154 Ga0105242_10307574 3300009176 Bacteria 1449
155 Ga0105248_10019505 3300009177 Bacteria 7504
156 Ga0105248_10022044 3300009177 Bacteria 7058
157 Ga0105248_10036069 3300009177 Bacteria 5531
158 Ga0105248_10485299 3300009177 Bacteria 1393
159 Ga0105248_10521910 3300009177 Bacteria 1339
160 Ga0105237_10134858 3300009545 Bacteria 2463
161 Ga0105238_10160565 3300009551 Bacteria 2223
162 Ga0105238_10341484 3300009551 Bacteria 1486
163 Ga0105249_10052440 3300009553 Bacteria 3725
164 Ga0105239_10035302 3300010375 Bacteria 5491
165 Ga0105239_10664834 3300010375 Bacteria 1190
166 Ga0105246_10131526 3300011119 Bacteria 1870
167 Ga0157370_10166920 3300013104 Bacteria 2047
168 Ga0157374_10064592 3300013296 Bacteria 3435
169 Ga0157378_10057519 3300013297 Bacteria 3466
170 Ga0163162_10255130 3300013306 Bacteria 1885
171 Ga0157375_10777003 3300013308 Bacteria 1108
172 Ga0163163_10007455 3300014325 Bacteria 9654
173 Ga0163163_10048998 3300014325 Bacteria 4156
174 Ga0157380_10157738 3300014326 Bacteria 1968
175 Ga0157380_10459981 3300014326 Bacteria 1225
176 Ga0157377_10009671 3300014745 Bacteria 4742
177 Ga0157377_10136038 3300014745 Bacteria 1506
178 Ga0157376_10089678 3300014969 Bacteria 2659
179 Ga0157376_10134822 3300014969 Bacteria 2208
180 Ga0163161_10053983 3300017792 Bacteria 2916
181 Ga0163161_10188263 3300017792 Bacteria 1585
182 Ga0228598_1008495 3300024227 Unclassified 2072
183 Ga0209758_1000188 3300025297 Bacteria 138749
184 Ga0209758_1022197 3300025297 Bacteria 2923
185 Ga0207697_10077075 3300025315 Bacteria 1402
186 Ga0207642_10120533 3300025899 Bacteria 1352
187 Ga0207642_10163043 3300025899 Bacteria 1199
188 Ga0207710_10024335 3300025900 Bacteria 2607
189 Ga0207710_10084826 3300025900 Bacteria 1474
190 Ga0207688_10006981 3300025901 Bacteria 6145
191 Ga0207688_10085923 3300025901 Bacteria 1802
192 Ga0207680_10021992 3300025903 Bacteria 3461
193 Ga0207647_10009985 3300025904 Bacteria 6723
194 Ga0207645_10014468 3300025907 Bacteria 5279
195 Ga0207643_10009065 3300025908 Bacteria 5344
196 Ga0207705_10151613 3300025909 Bacteria 1737
197 Ga0207684_10010342 3300025910 Bacteria 8213
198 Ga0207654_10176587 3300025911 Bacteria 1391
199 Ga0207693_10001371 3300025915 Bacteria 21581
200 Ga0207693_10007136 3300025915 Bacteria 9216
201 Ga0207693_10044173 3300025915 Bacteria 3502
202 Ga0207693_10121299 3300025915 Bacteria 2053
203 Ga0207693_10430205 3300025915 Bacteria 1032
204 Ga0207663_10075120 3300025916 Bacteria 2192
205 Ga0207663_10198714 3300025916 Unclassified 1445
206 Ga0207663_10424231 3300025916 Bacteria 1021
207 Ga0207660_10306745 3300025917 Bacteria 1265
208 Ga0207662_10000693 3300025918 Bacteria 15368
209 Ga0207662_10026365 3300025918 Bacteria 3352
210 Ga0207662_10138049 3300025918 Bacteria 1542
211 Ga0207657_10021390 3300025919 Bacteria 6089
212 Ga0207657_10032100 3300025919 Bacteria 4748
213 Ga0207652_10196015 3300025921 Unclassified 1817
214 Ga0207646_10367811 3300025922 Bacteria 1299
215 Ga0207694_10294274 3300025924 Bacteria 1335
216 Ga0207650_10272275 3300025925 Bacteria 1376
217 Ga0207687_10373937 3300025927 Bacteria 1166
218 Ga0207700_10011223 3300025928 Bacteria 5704
219 Ga0207700_10309023 3300025928 Bacteria 1367
220 Ga0207700_10434466 3300025928 Bacteria 1155
221 Ga0207664_10670937 3300025929 Bacteria 932
222 Ga0207644_10033727 3300025931 Bacteria 3580
223 Ga0207644_10229666 3300025931 Bacteria 1474
224 Ga0207690_10126297 3300025932 Bacteria 1866
225 Ga0207706_10035712 3300025933 Bacteria 4418
226 Ga0207709_10022970 3300025935 Bacteria 3545
227 Ga0207670_10035572 3300025936 Bacteria 3231
228 Ga0207669_10174994 3300025937 Bacteria 1532
229 Ga0207704_10028581 3300025938 Bacteria 3096
230 Ga0207665_10116506 3300025939 Bacteria 1883
231 Ga0207691_10033411 3300025940 Bacteria 4789
232 Ga0207689_10005881 3300025942 Bacteria 10868
233 Ga0207661_10138837 3300025944 Bacteria 2090
234 Ga0207667_10386377 3300025949 Unclassified 1426
235 Ga0207712_10032092 3300025961 Bacteria 3543
236 Ga0207640_10048453 3300025981 Bacteria 2747
237 Ga0207658_10082004 3300025986 Bacteria 2475
238 Ga0207658_10093854 3300025986 Bacteria 2334
239 Ga0207658_10128848 3300025986 Bacteria 2030
240 Ga0207703_10348723 3300026035 Bacteria 1362
241 Ga0207639_10262796 3300026041 Bacteria 1510
242 Ga0207639_10640959 3300026041 Bacteria 982
243 Ga0207678_10037059 3300026067 Bacteria 4244
244 Ga0207708_10002044 3300026075 Bacteria 14870
245 Ga0207708_10164699 3300026075 Bacteria 1752
246 Ga0207702_10171376 3300026078 Bacteria 1991
247 Ga0207641_10189725 3300026088 Bacteria 1888
248 Ga0207648_10021363 3300026089 Bacteria 5818
249 Ga0207676_10042923 3300026095 Bacteria 3478
250 Ga0207676_10323007 3300026095 Bacteria 1418
251 Ga0207674_10102783 3300026116 Bacteria 2837
252 Ga0207675_100032924 3300026118 Bacteria 4829
253 Ga0207683_10013849 3300026121 Bacteria 6878
254 Ga0207683_10014335 3300026121 Bacteria 6753
255 Ga0207683_10089723 3300026121 Bacteria 2736
256 Ga0207428_10068046 3300027907 Bacteria 2802
257 Ga0207428_10264223 3300027907 Bacteria 1281
258 Ga0268265_10034095 3300028380 Bacteria 3708
259 Ga0265338_10005024 3300028800 Bacteria 17471
260 Ga0265324_10092762 3300029957 Unclassified 1027
261 Ga0265760_10031483 3300031090 Bacteria 1564
262 Ga0265325_10012733 3300031241 Bacteria 4801
263 Ga0265325_10094589 3300031241 Bacteria 1469
264 Ga0265325_10115029 3300031241 Bacteria 1303
265 Ga0265325_10122520 3300031241 Bacteria 1252
266 Ga0265340_10008280 3300031247 Bacteria 5618
267 Ga0265339_10000066 3300031249 Bacteria 91908
268 Ga0265331_10181691 3300031250 Bacteria 950
269 Ga0265313_10000685 3300031595 Bacteria 34921
270 Ga0316575_10006907 3300031665 Bacteria 4107
271 Ga0265342_10145606 3300031712 Unclassified 1319
272 Ga0316576_10047566 3300031727 Unclassified 3109
273 Ga0373930_0005749 3300034816 Bacteria 2072
274 Ga0373952_0006434 3300035092 Bacteria 2168
275 Ga0373932_0025149 3300035112 Bacteria 1609
276 Ga0373936_0015656 3300035113 Bacteria 2907
277 Ga0373936_0074227 3300035113 Bacteria 1407
278 Ga0373945_0034533 3300035116 Bacteria 1802
279 Ga0373953_0040605 3300035117 Bacteria 1848
280 Ga0373956_0071306 3300035119 Unclassified 1585
281 Ga0373943_0000075 3300035170 Bacteria 34975
282 Ga0373943_0075728 3300035170 Bacteria 1715
283 Ga0373946_0015916 3300035171 Unclassified 2859
284 Ga0373946_0080748 3300035171 Unclassified 1423
285 Ga0373955_0033826 3300035172 Bacteria 2694
286 Ga0373955_0224481 3300035172 Bacteria 1123
287 Ga0373961_0005038 3300035241 Bacteria 3176
288 Ga0373962_0049987 3300035242 Bacteria 1203
289 Ga0316574_0006767 3300035398 Bacteria 6227
290 Ga0373931_0017249 3300035691 Bacteria 3567
291 Ga0373931_0023592 3300035691 Bacteria 3108
292 Ga0373931_0041805 3300035691 Bacteria 2409
293 Ga0373935_0051301 3300035692 Bacteria 2620
294 Ga0373935_0095632 3300035692 Bacteria 1951
295 Ga0373935_0132022 3300035692 Bacteria 1679
296 Ga0373935_0260373 3300035692 Unclassified 1216
297 Ga0373927_0004660 3300035695 Bacteria 9556
298 Ga0373927_0071213 3300035695 Bacteria 2250
299 Ga0373927_0071670 3300035695 Unclassified 2242
300 Ga0373927_0135304 3300035695 Unclassified 1610
301 Ga0373933_0298208 3300035724 Bacteria 1043
302 Ga0373947_0023287 3300035725 Bacteria 3601
303 Ga0373947_0034271 3300035725 Bacteria 3002
304 Ga0373947_0319033 3300035725 Bacteria 1039
305 Ga0373937_0000516 3300036401 Bacteria 34938
306 Ga0373937_0372050 3300036401 Bacteria 1355
307 Ga0373937_0535530 3300036401 Unclassified 1113
308 Ga0316582_0014153 3300036647 Bacteria 4518
309 Ga0373925_0003916 3300037068 Bacteria 11369
310 Ga0373925_0029911 3300037068 Bacteria 3995
311 Ga0373925_0043167 3300037068 Bacteria 3346
312 Ga0373925_0056992 3300037068 Bacteria 2927
313 Ga0373925_0187734 3300037068 Bacteria 1639
314 Ga0373925_0231796 3300037068 Bacteria 1477
315 Ga0395900_0280480 3300037418 Bacteria 1658
316 Ga0395898_0049139 3300037466 Bacteria 4134
317 Ga0436365_1164737 3300039437 Bacteria 1153
318 Ga0436365_1484538 3300039437 Bacteria 1574
319 Ga0436360_0964451 3300039438 Unclassified 918
320 Ga0436361_0500930 3300039447 Bacteria 4731
321 Ga0436361_0756350 3300039447 Bacteria 1537
322 Ga0436363_0941191 3300039450 Bacteria 913
323 Ga0451851_0866917 3300041507 Bacteria 1275
324 Ga0451577_0281480 3300042876 Bacteria 1507
325 Ga0466966_0156298 3300044684 Bacteria 1389
326 Ga0466963_0076779 3300044694 Bacteria 2256
327 Ga0466958_0074163 3300045836 Bacteria 2085
328 Ga0466967_0488842 3300045976 Bacteria 1207
329 Ga0495592_0074288 3300046454 Bacteria 2470
330 Ga0495603_0011897 3300046455 Bacteria 5266
331 Ga0495603_0165975 3300046455 Bacteria 1280
332 Ga0495653_0080514 3300046463 Bacteria 2410
333 Ga0495580_0045931 3300046472 Bacteria 3101
334 Ga0495582_0199328 3300046473 Bacteria 1143
335 Ga0495605_0092054 3300046474 Bacteria 1404
336 Ga0495605_0118200 3300046474 Bacteria 1204
337 Ga0495662_0001642 3300046476 Bacteria 11141
338 Ga0495662_0005169 3300046476 Bacteria 6541
339 Ga0495664_0003707 3300046477 Bacteria 8335
340 Ga0495664_0390023 3300046477 Bacteria 837
341 Ga0495584_0006067 3300046491 Bacteria 6362
342 Ga0495585_0161146 3300046492 Bacteria 1164
343 Ga0495594_0039951 3300046499 Unclassified 2566
344 Ga0495607_0127019 3300046501 Bacteria 1332
345 Ga0495630_0003076 3300046517 Bacteria 11570
346 Ga0495630_0007874 3300046517 Bacteria 7638
347 Ga0495630_0110640 3300046517 Bacteria 2081
348 Ga0495632_0056643 3300046519 Bacteria 1916
349 Ga0495663_0068744 3300046525 Bacteria 1125
350 Ga0495666_0011416 3300046526 Bacteria 4429
351 Ga0495665_0019716 3300046531 Bacteria 3627
352 Ga0495665_0067433 3300046531 Bacteria 1888
353 Ga0495640_0009041 3300046533 Bacteria 7772
354 Ga0495640_0079867 3300046533 Bacteria 2177
355 Ga0495640_0211297 3300046533 Unclassified 1226
356 Ga0495586_0037637 3300046535 Bacteria 2598
357 Ga0495586_0148513 3300046535 Unclassified 1318
358 Ga0495598_0003325 3300046537 Bacteria 3404
359 Ga0495598_0031944 3300046537 Bacteria 1484
360 Ga0495645_0007511 3300046543 Bacteria 7587
361 Ga0495656_0048180 3300046615 Bacteria 1810
362 Ga0495634_0001077 3300046642 Bacteria 25473
363 Ga0495634_0002631 3300046642 Bacteria 14774
364 Ga0495634_0302871 3300046642 Bacteria 966
365 Ga0495635_0009588 3300046663 Bacteria 6766
366 Ga0495588_0014717 3300046674 Unclassified 3751
367 Ga0495623_0179150 3300046679 Bacteria 1233
368 Ga0495647_0038503 3300046681 Bacteria 1808
369 Ga0495647_0064413 3300046681 Bacteria 1453
370 Ga0495669_0066372 3300046684 Bacteria 1639
371 Ga0495613_0009107 3300046689 Bacteria 7362
372 Ga0495624_0017777 3300046690 Bacteria 4766
373 Ga0495660_0176771 3300046810 Bacteria 1036
374 Ga0495581_0025032 3300047315 Bacteria 3459
375 Ga0495581_0100557 3300047315 Bacteria 1680
376 Ga0495581_0195730 3300047315 Unclassified 1182
377 Ga0495604_0150389 3300047317 Bacteria 1655
378 Ga0495674_0033579 3300047319 Bacteria 4646
379 Ga0495674_0050535 3300047319 Bacteria 3668
380 Ga0495676_0030291 3300047321 Bacteria 4596
381 Ga0495683_0072236 3300047323 Bacteria 1693
382 Ga0495684_0000320 3300047471 Bacteria 38898
383 Ga0495684_0001997 3300047471 Bacteria 16401
384 Ga0495684_0009215 3300047471 Bacteria 7620
385 Ga0495593_0024337 3300047673 Bacteria 3357
386 Ga0496100_0336377 3300048903 Bacteria 1137
387 Ga0496101_0018360 3300048904 Bacteria 4755
388 Ga0496101_0035095 3300048904 Bacteria 3546
389 Ga0496102_0027509 3300048905 Bacteria 5078
390 Ga0496102_0068397 3300048905 Bacteria 3258
391 Ga0496102_0093959 3300048905 Bacteria 2778
392 Ga0496103_0010402 3300048906 Bacteria 5505
393 Ga0496103_0034378 3300048906 Bacteria 3099
394 Ga0496104_0000736 3300048907 Bacteria 28143
395 Ga0496104_0003017 3300048907 Bacteria 14499
396 Ga0496104_0029587 3300048907 Bacteria 5081
397 Ga0496104_0122814 3300048907 Bacteria 2493
398 Ga0496105_0017381 3300048908 Bacteria 5765
399 Ga0496105_0025297 3300048908 Bacteria 4831
400 Ga0496105_0105441 3300048908 Bacteria 2327
401 Ga0496105_0173530 3300048908 Bacteria 1767
402 Ga0496106_0018733 3300048909 Bacteria 5127
403 Ga0496106_0027499 3300048909 Bacteria 4236
404 Ga0496107_0032607 3300048910 Bacteria 3723
405 Ga0496108_0002441 3300048911 Bacteria 14859
406 Ga0496108_0235862 3300048911 Bacteria 1591
407 Ga0496109_0477106 3300048912 Bacteria 1178
408 Ga0496110_0010178 3300048913 Bacteria 7640
409 Ga0496110_0034496 3300048913 Bacteria 4383
410 Ga0496110_0584919 3300048913 Bacteria 1013
411 Ga0496111_0257007 3300048914 Bacteria 1296
412 Ga0496112_0011960 3300048915 Bacteria 7954
413 Ga0496112_0083698 3300048915 Bacteria 3155
414 Ga0496113_0013855 3300048916 Bacteria 5479
415 Ga0496113_0021565 3300048916 Bacteria 4545
416 Ga0496113_0073932 3300048916 Bacteria 2598
417 Ga0496114_0034704 3300048917 Bacteria 4162
418 Ga0496114_0140261 3300048917 Bacteria 2092
419 Ga0496114_0245971 3300048917 Bacteria 1573
420 Ga0496115_0031765 3300048918 Bacteria 4162
421 Ga0496115_0036123 3300048918 Bacteria 3911
422 Ga0496115_0175799 3300048918 Bacteria 1770
423 Ga0496115_0637535 3300048918 Bacteria 844
424 Ga0501032_0120461 3300049569 Bacteria 1735
425 Ga0501033_0021983 3300049570 Bacteria 4812
426 Ga0501034_0531393 3300049571 Bacteria 1087
427 Ga0501036_0207946 3300049572 Bacteria 1645
428 Ga0501037_0342127 3300049573 Bacteria 1033
429 Ga0501039_0139378 3300049575 Unclassified 1905
430 Ga0501041_0224200 3300049577 Bacteria 1180
431 Ga0501042_0421571 3300049578 Bacteria 967
432 Ga0501043_0050964 3300049579 Bacteria 3254
433 Ga0501046_0130797 3300049580 Bacteria 1904
434 Ga0501046_0343404 3300049580 Bacteria 1085
435 Ga0501047_0003616 3300049581 Bacteria 14572
436 Ga0501047_0272455 3300049581 Bacteria 1539
437 Ga0501069_0348058 3300049585 Bacteria 873
438 Ga0501070_0038491 3300049586 Bacteria 3990
439 Ga0501071_0033922 3300049587 Bacteria 3629
440 Ga0501072_0021791 3300049588 Bacteria 4969
441 Ga0501075_0041640 3300049591 Bacteria 3442
442 Ga0501076_0077379 3300049592 Bacteria 2669
443 Ga0501079_0024918 3300049741 Bacteria 4590
444 Ga0501080_0174864 3300049742 Unclassified 1979
445 Ga0501080_0246999 3300049742 Bacteria 1627
446 Ga0501044_0004547 3300049823 Bacteria 15509
447 Ga0501044_0020434 3300049823 Bacteria 7071
448 Ga0501045_0087210 3300049824 Bacteria 2304
449 nmdc:mga03683_152376_c1 3300050489 Bacteria 1044
450 nmdc:mga03n38_89222_c1 3300050490 Bacteria 1464
451 nmdc:mga00v17_92452_c1 3300050491 Bacteria 1902
452 nmdc:mga0yw44_107118_c1 3300050492 Bacteria 1787
453 nmdc:mga0yw44_12815_c1 3300050492 Bacteria 4386
454 nmdc:mga0yw44_27036_c1 3300050492 Bacteria 3283
455 nmdc:mga06z11_221826_c1 3300050494 Bacteria 1105
456 nmdc:mga06z11_222270_c1 3300050494 Bacteria 1104
457 nmdc:mga06z11_271312_c1 3300050494 Bacteria 1003
458 nmdc:mga06z11_296383_c1 3300050494 Bacteria 961
459 nmdc:mga06z11_73546_c1 3300050494 Unclassified 1815
460 nmdc:mga07m45_165287_c1 3300050496 Bacteria 1285
461 nmdc:mga07m45_191494_c1 3300050496 Bacteria 1189
462 nmdc:mga05p37_112050_c1 3300050507 Bacteria 3355
463 nmdc:mga05p37_67325_c1 3300050507 Bacteria 4406
464 nmdc:mga05p37_907137_c1 3300050507 Bacteria 949
465 nmdc:mga05p37_9260_c2 3300050507 Bacteria 8214
466 nmdc:mga0qj67_260465_c1 3300050509 Bacteria 1407
467 nmdc:mga06r32_143868_c1 3300050510 Bacteria 2361
468 nmdc:mga06r32_68107_c1 3300050510 Bacteria 3438
469 nmdc:mga08y16_234241_c1 3300050511 Bacteria 1899
470 nmdc:mga08y16_82348_c1 3300050511 Bacteria 3354
471 nmdc:mga08y16_82515_c1 3300050511 Bacteria 3351
472 nmdc:mga0n895_11926_c1 3300050512 Bacteria 7776
473 nmdc:mga0n895_193258_c1 3300050512 Bacteria 2066
474 nmdc:mga0n895_25085_c1 3300050512 Bacteria 5628
475 nmdc:mga0n895_52459_c1 3300050512 Bacteria 4003
476 nmdc:mga0rr50_88985_c1 3300050513 Bacteria 2400
477 nmdc:mga08x19_198451_c1 3300050514 Bacteria 1375
478 nmdc:mga08x19_83214_c1 3300050514 Bacteria 2103
479 nmdc:mga0a205_180450_c1 3300050515 Bacteria 1593
480 nmdc:mga0a205_29157_c1 3300050515 Bacteria 5282
481 nmdc:mga0sz30_103919_c2 3300050516 Bacteria 941
482 Ga0495601_0007185 3300053077 Bacteria 6533
483 Ga0495601_0084710 3300053077 Bacteria 2036
484 Ga0495601_0101962 3300053077 Unclassified 1854
485 Ga0495601_0143805 3300053077 Unclassified 1556
486 Ga0495601_0210535 3300053077 Bacteria 1270
487 Ga0495612_0000187 3300053078 Bacteria 26308
488 Ga0495612_0047516 3300053078 Unclassified 1759
489 Ga0495655_0021445 3300053083 Bacteria 1462
490 Ga0495595_0111985 3300053084 Bacteria 1324
491 Ga0495619_0024812 3300053085 Bacteria 3846
492 Ga0495619_0028806 3300053085 Bacteria 3584
493 Ga0501084_0052676 3300054114 Bacteria 3404
494 Ga0501082_0206442 3300060353 Unclassified 1709
495 Ga0501082_0542865 3300060353 Bacteria 1017
496 Ga0530510_0135572 3300061734 Unclassified 1812
497 Ga0530510_0187170 3300061734 Bacteria 1536
498 Ga0530510_0334964 3300061734 Bacteria 1135
499 Ga0207660_10428439
500 JGI24750J21931_1001322
501 JGI24748J21848_1006041
502 JGI24744J21845_10000476
503 JGI24742J22300_10002181
504 Ga0070658_10095043
505 Ga0070690_100041020
506 Ga0070690_100082250
507 Ga0070690_100117372
508 Ga0070670_100057253
509 Ga0068869_100063329
510 Ga0070666_10066992
511 Ga0070680_100018259
512 Ga0070680_100253143
513 Ga0068868_100034119
514 Ga0070660_100085773
515 Ga0070689_100011034
516 Ga0070689_100079514
517 Ga0070689_100344502
518 Ga0070687_100067385
519 Ga0070687_100289493
520 Ga0070661_100319936
521 Ga0070692_10039673
522 Ga0070669_100034721
523 Ga0070675_100027493
524 Ga0070671_100042716
525 Ga0070671_100267866
526 Ga0070671_100346061
527 Ga0070674_100071780
528 Ga0070674_100089715
529 Ga0070674_100163258
530 Ga0070673_100002526
531 Ga0070688_100018147
532 Ga0070659_100087275
533 Ga0070667_100113407
534 Ga0070714_100091977
535 Ga0070713_100047429
536 Ga0070713_100647650
537 Ga0070713_100809275
538 Ga0070710_10164476
539 Ga0070711_100079928
540 Ga0070711_100103403
541 Ga0070705_100174443
542 Ga0070705_100403424
543 Ga0070700_100084574
544 Ga0070708_100022020
545 Ga0070663_100160812
546 Ga0070678_100057593
547 Ga0070678_100078313
548 Ga0070662_100061316
549 Ga0070662_100835356
550 Ga0070681_10035474
551 Ga0070681_10344377
552 Ga0068867_100013474
553 Ga0070685_10044174
554 Ga0070707_100041972
555 Ga0070699_100282653
556 Ga0070679_100024950
557 Ga0070679_100069129
558 Ga0070697_100005061
559 Ga0068853_100348746
560 Ga0070672_100056653
561 Ga0070686_100066325
562 Ga0070686_100168924
563 Ga0070696_100102091
564 Ga0070696_100110737
565 Ga0070693_100010398
566 Ga0070665_100071652
567 Ga0070665_100316454
568 Ga0070704_100232851
569 Ga0070664_100134528
570 Ga0068857_100110632
571 Ga0068854_100013365
572 Ga0068856_100211682
573 Ga0070702_100026893
574 Ga0070702_100104613
575 Ga0070702_100280424
576 Ga0068852_100045704
577 Ga0068859_100077773
578 Ga0068864_100090129
579 Ga0068866_10063795
580 Ga0068861_100242907
581 Ga0068861_100330874
582 Ga0068870_10010066
583 Ga0068858_100489462
584 Ga0068862_100020669
585 Ga0081455_10005147
586 Ga0081455_10015547
587 Ga0081455_10021090
588 Ga0081455_10072363
589 Ga0081455_10138625
590 Ga0081538_10059249
591 Ga0081540_1000192
592 Ga0081540_1006458
593 Ga0081540_1040161
594 Ga0070717_10022173
595 Ga0070717_10145388
596 Ga0070717_10209035
597 Ga0075365_10006486
598 Ga0075365_10060105
599 Ga0075365_10113700
600 Ga0075365_10141157
601 Ga0075365_10235337
602 Ga0075363_100071432
603 Ga0075364_10071178
604 Ga0075364_10079244
605 Ga0070715_10002531
606 Ga0070712_100001451
607 Ga0070712_100016897
608 Ga0070712_100069192
609 Ga0070712_100110960
610 Ga0070712_100388891
611 Ga0070712_100467749
612 Ga0075362_10104769
613 Ga0075362_10113518
614 Ga0075367_10022407
615 Ga0075367_10131941
616 Ga0075367_10200768
617 Ga0075366_10012203
618 Ga0075370_10083274
619 Ga0068871_100045011
620 Ga0068871_100591319
621 Ga0075428_100186800
622 Ga0075430_100017996
623 Ga0075431_100079433
624 Ga0075431_100164560
625 Ga0075431_100222512
626 Ga0075434_100027344
627 Ga0075434_100033205
628 Ga0075434_100051342
629 Ga0075434_100231180
630 Ga0075434_100682754
631 Ga0075429_100031205
632 Ga0068865_100048973
633 Ga0068865_100393658
634 Ga0068865_100463783
635 Ga0075436_100006369
636 Ga0075436_100265942
637 Ga0097620_100077776
638 Ga0075435_100136427
639 Ga0075435_100232688
640 Ga0099794_10038112
641 Ga0105240_10212514
642 Ga0111539_10024422
643 Ga0111539_10079745
644 Ga0105247_10049816
645 Ga0105247_10147417
646 Ga0114129_10009821
647 Ga0114129_10132099
648 Ga0114129_10134756
649 Ga0114129_11297836
650 Ga0105241_10097281
651 Ga0105242_10223307
652 Ga0105242_10307574
653 Ga0105248_10019505
654 Ga0105248_10022044
655 Ga0105248_10036069
656 Ga0105248_10485299
657 Ga0105248_10521910
658 Ga0105237_10134858
659 Ga0105238_10160565
660 Ga0105238_10341484
661 Ga0105249_10052440
662 Ga0105239_10035302
663 Ga0105239_10664834
664 Ga0105246_10131526
665 Ga0157370_10166920
666 Ga0157374_10064592
667 Ga0157378_10057519
668 Ga0163162_10255130
669 Ga0157375_10777003
670 Ga0163163_10007455
671 Ga0163163_10048998
672 Ga0157380_10157738
673 Ga0157380_10459981
674 Ga0157377_10009671
675 Ga0157377_10136038
676 Ga0157376_10089678
677 Ga0157376_10134822
678 Ga0163161_10053983
679 Ga0163161_10188263
680 Ga0228598_1008495
681 Ga0209758_1000188
682 Ga0209758_1022197
683 Ga0207697_10077075
684 Ga0207642_10120533
685 Ga0207642_10163043
686 Ga0207710_10024335
687 Ga0207710_10084826
688 Ga0207688_10006981
689 Ga0207688_10085923
690 Ga0207680_10021992
691 Ga0207647_10009985
692 Ga0207645_10014468
693 Ga0207643_10009065
694 Ga0207705_10151613
695 Ga0207684_10010342
696 Ga0207654_10176587
697 Ga0207693_10001371
698 Ga0207693_10007136
699 Ga0207693_10044173
700 Ga0207693_10121299
701 Ga0207693_10430205
702 Ga0207663_10075120
703 Ga0207663_10198714
704 Ga0207663_10424231
705 Ga0207660_10306745
706 Ga0207662_10000693
707 Ga0207662_10026365
708 Ga0207662_10138049
709 Ga0207657_10021390
710 Ga0207657_10032100
711 Ga0207652_10196015
712 Ga0207646_10367811
713 Ga0207694_10294274
714 Ga0207650_10272275
715 Ga0207687_10373937
716 Ga0207700_10011223
717 Ga0207700_10309023
718 Ga0207700_10434466
719 Ga0207664_10670937
720 Ga0207644_10033727
721 Ga0207644_10229666
722 Ga0207690_10126297
723 Ga0207706_10035712
724 Ga0207709_10022970
725 Ga0207670_10035572
726 Ga0207669_10174994
727 Ga0207704_10028581
728 Ga0207665_10116506
729 Ga0207691_10033411
730 Ga0207689_10005881
731 Ga0207661_10138837
732 Ga0207667_10386377
733 Ga0207712_10032092
734 Ga0207640_10048453
735 Ga0207658_10082004
736 Ga0207658_10093854
737 Ga0207658_10128848
738 Ga0207703_10348723
739 Ga0207639_10262796
740 Ga0207639_10640959
741 Ga0207678_10037059
742 Ga0207708_10002044
743 Ga0207708_10164699
744 Ga0207702_10171376
745 Ga0207641_10189725
746 Ga0207648_10021363
747 Ga0207676_10042923
748 Ga0207676_10323007
749 Ga0207674_10102783
750 Ga0207675_100032924
751 Ga0207683_10013849
752 Ga0207683_10014335
753 Ga0207683_10089723
754 Ga0207428_10068046
755 Ga0207428_10264223
756 Ga0268265_10034095
757 Ga0265338_10005024
758 Ga0265324_10092762
759 Ga0265760_10031483
760 Ga0265325_10012733
761 Ga0265325_10094589
762 Ga0265325_10115029
763 Ga0265325_10122520
764 Ga0265340_10008280
765 Ga0265339_10000066
766 Ga0265331_10181691
767 Ga0265313_10000685
768 Ga0316575_10006907
769 Ga0265342_10145606
770 Ga0316576_10047566
771 Ga0373930_0005749
772 Ga0373952_0006434
773 Ga0373932_0025149
774 Ga0373936_0015656
775 Ga0373936_0074227
776 Ga0373945_0034533
777 Ga0373953_0040605
778 Ga0373956_0071306
779 Ga0373943_0000075
780 Ga0373943_0075728
781 Ga0373946_0015916
782 Ga0373946_0080748
783 Ga0373955_0033826
784 Ga0373955_0224481
785 Ga0373961_0005038
786 Ga0373962_0049987
787 Ga0316574_0006767
788 Ga0373931_0017249
789 Ga0373931_0023592
790 Ga0373931_0041805
791 Ga0373935_0051301
792 Ga0373935_0095632
793 Ga0373935_0132022
794 Ga0373935_0260373
795 Ga0373927_0004660
796 Ga0373927_0071213
797 Ga0373927_0071670
798 Ga0373927_0135304
799 Ga0373933_0298208
800 Ga0373947_0023287
801 Ga0373947_0034271
802 Ga0373947_0319033
803 Ga0373937_0000516
804 Ga0373937_0372050
805 Ga0373937_0535530
806 Ga0316582_0014153
807 Ga0373925_0003916
808 Ga0373925_0029911
809 Ga0373925_0043167
810 Ga0373925_0056992
811 Ga0373925_0187734
812 Ga0373925_0231796
813 Ga0395900_0280480
814 Ga0395898_0049139
815 Ga0436365_1164737
816 Ga0436365_1484538
817 Ga0436360_0964451
818 Ga0436361_0500930
819 Ga0436361_0756350
820 Ga0436363_0941191
821 Ga0451851_0866917
822 Ga0451577_0281480
823 Ga0466966_0156298
824 Ga0466963_0076779
825 Ga0466958_0074163
826 Ga0466967_0488842
827 Ga0495592_0074288
828 Ga0495603_0011897
829 Ga0495603_0165975
830 Ga0495653_0080514
831 Ga0495580_0045931
832 Ga0495582_0199328
833 Ga0495605_0092054
834 Ga0495605_0118200
835 Ga0495662_0001642
836 Ga0495662_0005169
837 Ga0495664_0003707
838 Ga0495664_0390023
839 Ga0495584_0006067
840 Ga0495585_0161146
841 Ga0495594_0039951
842 Ga0495607_0127019
843 Ga0495630_0003076
844 Ga0495630_0007874
845 Ga0495630_0110640
846 Ga0495632_0056643
847 Ga0495663_0068744
848 Ga0495666_0011416
849 Ga0495665_0019716
850 Ga0495665_0067433
851 Ga0495640_0009041
852 Ga0495640_0079867
853 Ga0495640_0211297
854 Ga0495586_0037637
855 Ga0495586_0148513
856 Ga0495598_0003325
857 Ga0495598_0031944
858 Ga0495645_0007511
859 Ga0495656_0048180
860 Ga0495634_0001077
861 Ga0495634_0002631
862 Ga0495634_0302871
863 Ga0495635_0009588
864 Ga0495588_0014717
865 Ga0495623_0179150
866 Ga0495647_0038503
867 Ga0495647_0064413
868 Ga0495669_0066372
869 Ga0495613_0009107
870 Ga0495624_0017777
871 Ga0495660_0176771
872 Ga0495581_0025032
873 Ga0495581_0100557
874 Ga0495581_0195730
875 Ga0495604_0150389
876 Ga0495674_0033579
877 Ga0495674_0050535
878 Ga0495676_0030291
879 Ga0495683_0072236
880 Ga0495684_0000320
881 Ga0495684_0001997
882 Ga0495684_0009215
883 Ga0495593_0024337
884 Ga0496100_0336377
885 Ga0496101_0018360
886 Ga0496101_0035095
887 Ga0496102_0027509
888 Ga0496102_0068397
889 Ga0496102_0093959
890 Ga0496103_0010402
891 Ga0496103_0034378
892 Ga0496104_0000736
893 Ga0496104_0003017
894 Ga0496104_0029587
895 Ga0496104_0122814
896 Ga0496105_0017381
897 Ga0496105_0025297
898 Ga0496105_0105441
899 Ga0496105_0173530
900 Ga0496106_0018733
901 Ga0496106_0027499
902 Ga0496107_0032607
903 Ga0496108_0002441
904 Ga0496108_0235862
905 Ga0496109_0477106
906 Ga0496110_0010178
907 Ga0496110_0034496
908 Ga0496110_0584919
909 Ga0496111_0257007
910 Ga0496112_0011960
911 Ga0496112_0083698
912 Ga0496113_0013855
913 Ga0496113_0021565
914 Ga0496113_0073932
915 Ga0496114_0034704
916 Ga0496114_0140261
917 Ga0496114_0245971
918 Ga0496115_0031765
919 Ga0496115_0036123
920 Ga0496115_0175799
921 Ga0496115_0637535
922 Ga0501032_0120461
923 Ga0501033_0021983
924 Ga0501034_0531393
925 Ga0501036_0207946
926 Ga0501037_0342127
927 Ga0501039_0139378
928 Ga0501041_0224200
929 Ga0501042_0421571
930 Ga0501043_0050964
931 Ga0501046_0130797
932 Ga0501046_0343404
933 Ga0501047_0003616
934 Ga0501047_0272455
935 Ga0501069_0348058
936 Ga0501070_0038491
937 Ga0501071_0033922
938 Ga0501072_0021791
939 Ga0501075_0041640
940 Ga0501076_0077379
941 Ga0501079_0024918
942 Ga0501080_0174864
943 Ga0501080_0246999
944 Ga0501044_0004547
945 Ga0501044_0020434
946 Ga0501045_0087210
947 nmdc:mga03683_152376_c1
948 nmdc:mga03n38_89222_c1
949 nmdc:mga00v17_92452_c1
950 nmdc:mga0yw44_107118_c1
951 nmdc:mga0yw44_12815_c1
952 nmdc:mga0yw44_27036_c1
953 nmdc:mga06z11_221826_c1
954 nmdc:mga06z11_222270_c1
955 nmdc:mga06z11_271312_c1
956 nmdc:mga06z11_296383_c1
957 nmdc:mga06z11_73546_c1
958 nmdc:mga07m45_165287_c1
959 nmdc:mga07m45_191494_c1
960 nmdc:mga05p37_112050_c1
961 nmdc:mga05p37_67325_c1
962 nmdc:mga05p37_907137_c1
963 nmdc:mga05p37_9260_c2
964 nmdc:mga0qj67_260465_c1
965 nmdc:mga06r32_143868_c1
966 nmdc:mga06r32_68107_c1
967 nmdc:mga08y16_234241_c1
968 nmdc:mga08y16_82348_c1
969 nmdc:mga08y16_82515_c1
970 nmdc:mga0n895_11926_c1
971 nmdc:mga0n895_193258_c1
972 nmdc:mga0n895_25085_c1
973 nmdc:mga0n895_52459_c1
974 nmdc:mga0rr50_88985_c1
975 nmdc:mga08x19_198451_c1
976 nmdc:mga08x19_83214_c1
977 nmdc:mga0a205_180450_c1
978 nmdc:mga0a205_29157_c1
979 nmdc:mga0sz30_103919_c2
980 Ga0495601_0007185
981 Ga0495601_0084710
982 Ga0495601_0101962
983 Ga0495601_0143805
984 Ga0495601_0210535
985 Ga0495612_0000187
986 Ga0495612_0047516
987 Ga0495655_0021445
988 Ga0495595_0111985
989 Ga0495619_0024812
990 Ga0495619_0028806
991 Ga0501084_0052676
992 Ga0501082_0206442
993 Ga0501082_0542865
994 Ga0530510_0135572
995 Ga0530510_0187170
996 Ga0530510_0334964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

51

276

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8957 4 243
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8952 5 247
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8814 4 243
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8695 11 247
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.856 5 247
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8988 5 247 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8921 4 243 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8778 4 243 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8771 9 243 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8685 23 247 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5N9A0I5-F1-model_v4 Dienelactone hydrolase family protein 0.991 91 249 GO:0016787
AF-A0A1V3XLL5-F1-model_v4 Dienelactone hydrolase family protein 0.985 167 249 GO:0016787
AF-A0A5N9A0I5-F1-model_v4 Dienelactone hydrolase family protein 0.9848 91 249 GO:0016787
AF-A0A7C7JRL5-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9836 165 249 GO:0016787
AF-A0A2D8MV26-F1-model_v4 Carboxymethylenebutenolidase 0.9824 50 249 GO:0016787

Map