F455126

General Info

Members Datasets Scaffolds Average Seq Length
497 396 231 213

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2874123672|2874125756
Length 240
Sequence HDDEGLAQYSSPPCFMHELDPEFRVPLSDWSEVKRWRKAERERLIAARLAVAADARAAMSQRIAEGLDTLIGDIDGRMVSLYWPFRGEPDLRPWMASINARGGRTALPVVIDKGQPLVFRGYAQGDRLEKGVWNIPIPAEGDPVLPDIVISPIVGIDPQHYRLGYGGGFFDRTLAAMPFKPLVIGVGYELQRIATIYPQPHDIPMDRVVTELSNPSRVCLKTRSAEADGVVFENRSGADF

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
10 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
11 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
12 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
13 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
14 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
15 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
16 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
17 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
18 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
19 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2738543024 Aminobacter sp. AP02 Isolate Unclassified
21 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
22 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
23 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
24 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
25 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
26 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
27 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
28 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
29 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
30 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
31 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
32 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
33 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
34 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
35 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
36 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
37 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
38 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
39 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
40 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
41 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
42 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
43 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
44 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
45 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
46 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
47 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
48 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
49 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
50 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
51 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
52 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
53 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
54 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
55 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
56 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
57 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
58 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
59 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
60 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
61 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
62 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
63 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
64 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
65 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
66 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
67 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
68 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
69 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
70 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
71 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
72 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
73 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
74 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
75 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
76 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
77 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
78 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
79 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
80 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
81 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
82 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
83 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
84 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
85 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
86 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
87 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
88 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
89 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
90 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
91 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
92 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
93 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
94 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
95 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
96 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
97 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
98 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
99 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
100 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
101 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
102 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
103 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
104 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
105 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
106 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
107 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
108 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
109 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
110 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
111 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
112 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
113 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
114 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
115 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
116 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
117 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
118 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
119 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
120 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
121 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
122 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
123 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
124 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
125 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
126 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
127 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
128 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
129 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
130 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
131 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
132 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
133 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
134 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
135 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
136 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
137 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
138 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
139 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
140 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
141 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
142 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
143 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
144 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
145 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
146 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
147 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
148 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
149 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
150 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
151 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
152 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
153 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
154 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
155 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
156 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
157 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
158 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
159 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
160 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
161 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
162 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
163 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
164 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
165 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
166 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
167 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
168 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
169 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
170 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
171 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
172 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
173 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
174 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
175 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
176 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
177 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
178 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
179 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
180 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
181 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
182 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
183 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
184 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
185 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
186 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
187 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
188 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
189 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
190 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
191 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
192 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
193 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
194 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
195 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
196 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
197 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
198 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
199 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
200 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
201 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
202 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
203 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
204 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
205 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
206 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
207 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
208 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
209 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
210 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
211 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
212 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
213 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
214 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
215 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
216 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
217 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
218 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
219 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
220 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
221 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
222 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
223 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
224 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
225 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
226 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
227 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
228 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
229 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
230 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
231 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
232 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
233 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
234 3004167301 Mesorhizobium loti 582 Isolate Unclassified
235 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
236 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
237 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
238 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
239 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
240 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
241 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
242 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
243 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
244 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
245 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
246 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
247 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
248 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
249 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
250 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
251 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
252 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
253 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
254 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
255 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
256 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
257 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
258 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
259 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
260 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
261 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
262 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
263 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
264 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
265 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
266 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
267 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
268 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
269 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
270 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
271 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
272 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
273 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
274 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
275 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
276 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
277 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
278 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
279 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
280 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
281 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
282 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
283 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
284 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
285 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
286 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
287 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
288 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
289 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
290 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
291 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
292 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
293 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
294 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
295 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
296 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
301 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
302 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
317 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
318 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
321 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
322 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
379 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
380 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
381 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
382 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
383 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
384 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
385 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
386 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
387 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
388 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
389 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
390 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
391 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
392 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
393 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
394 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
395 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
396 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 46.48
Metatranscriptomes 0
Isolates 53.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.06
Nodule 46.08
Rhizoplane 1.01
Rhizosphere 34.61
Stem 0
Stem Tuber 0
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1004205 3300002705 Bacteria 4442
2 JGI25157J39369_1001164 3300002741 Bacteria 11280
3 rootH1_10088124 3300003323 Bacteria 1146
4 Ga0055529_1003056 3300003763 Bacteria 2925
5 Ga0070658_10315927 3300005327 Bacteria 1333
6 Ga0070683_100218698 3300005329 Bacteria 1810
7 Ga0070660_100107769 3300005339 Bacteria 2214
8 Ga0070661_100040925 3300005344 Bacteria 3381
9 Ga0070661_100731687 3300005344 Bacteria 808
10 Ga0070674_100303197 3300005356 Bacteria 1274
11 Ga0070659_100092779 3300005366 Bacteria 2422
12 Ga0070659_100656265 3300005366 Bacteria 905
13 Ga0070663_100411129 3300005455 Bacteria 1108
14 Ga0068867_100226494 3300005459 Bacteria 1509
15 Ga0070706_100447722 3300005467 Bacteria 1202
16 Ga0070679_100565944 3300005530 Bacteria 1080
17 Ga0070684_100084386 3300005535 Bacteria 2815
18 Ga0068853_100179647 3300005539 Bacteria 1919
19 Ga0068853_100575205 3300005539 Bacteria 1069
20 Ga0070665_100043221 3300005548 Bacteria 4529
21 Ga0070665_100054833 3300005548 Bacteria 3998
22 Ga0070665_100119898 3300005548 Bacteria 2633
23 Ga0070665_100142084 3300005548 Bacteria 2404
24 Ga0070665_100224660 3300005548 Bacteria 1878
25 Ga0068855_100062162 3300005563 Bacteria 4360
26 Ga0068855_100164315 3300005563 Bacteria 2517
27 Ga0068855_100476196 3300005563 Bacteria 1360
28 Ga0070664_100065795 3300005564 Bacteria 3094
29 Ga0068856_100142459 3300005614 Bacteria 2404
30 Ga0068852_100171812 3300005616 Bacteria 2032
31 Ga0068852_100457334 3300005616 Bacteria 1265
32 Ga0068859_100574706 3300005617 Bacteria 1221
33 Ga0068864_100208626 3300005618 Bacteria 1798
34 Ga0081455_10029008 3300005937 Bacteria 5049
35 Ga0075365_10012266 3300006038 Bacteria 5081
36 Ga0075365_10067047 3300006038 Bacteria 2409
37 Ga0075365_10255303 3300006038 Bacteria 1232
38 Ga0075368_10035433 3300006042 Bacteria 1947
39 Ga0075368_10079797 3300006042 Bacteria 1330
40 Ga0075363_100053161 3300006048 Bacteria 2164
41 Ga0075363_100138230 3300006048 Bacteria 1370
42 Ga0075363_100286842 3300006048 Bacteria 953
43 Ga0075364_10069370 3300006051 Bacteria 2319
44 Ga0075364_10091186 3300006051 Bacteria 2022
45 Ga0075362_10038312 3300006177 Bacteria 2106
46 Ga0075362_10205909 3300006177 Bacteria 959
47 Ga0075367_10099714 3300006178 Bacteria 1774
48 Ga0075367_10101562 3300006178 Bacteria 1759
49 Ga0075369_10007257 3300006186 Bacteria 4215
50 Ga0075369_10140712 3300006186 Bacteria 1100
51 Ga0075366_10123951 3300006195 Bacteria 1558
52 Ga0097621_100459363 3300006237 Bacteria 1148
53 Ga0075370_10108322 3300006353 Bacteria 1612
54 Ga0097620_100574625 3300006931 Bacteria 1221
55 Ga0105240_10177831 3300009093 Bacteria 2514
56 Ga0105240_10303524 3300009093 Bacteria 1826
57 Ga0105240_10665674 3300009093 Bacteria 1139
58 Ga0105243_10227724 3300009148 Bacteria 1652
59 Ga0105237_10028343 3300009545 Bacteria 5706
60 Ga0105237_10120114 3300009545 Bacteria 2622
61 Ga0105237_10257973 3300009545 Bacteria 1746
62 Ga0105238_10010408 3300009551 Bacteria 9336
63 Ga0105238_10123148 3300009551 Bacteria 2572
64 Ga0105238_10550480 3300009551 Bacteria 1158
65 Ga0105239_10122092 3300010375 Bacteria 2894
66 Ga0105239_10789596 3300010375 Bacteria 1088
67 Ga0157371_10523500 3300013102 Bacteria 877
68 Ga0157370_10101547 3300013104 Bacteria 2694
69 Ga0157370_10137997 3300013104 Bacteria 2272
70 Ga0157369_10109919 3300013105 Bacteria 2931
71 Ga0157378_10246898 3300013297 Bacteria 1707
72 Ga0163163_10231624 3300014325 Bacteria 1896
73 Ga0157379_10467818 3300014968 Bacteria 1166
74 Ga0157376_10229069 3300014969 Bacteria 1725
75 Ga0209026_1000002 3300025250 Bacteria 1136158
76 Ga0209148_1000038 3300025254 Bacteria 493744
77 Ga0209759_1000119 3300025256 Bacteria 141051
78 Ga0209233_1000625 3300025261 Bacteria 17770
79 Ga0209233_1004929 3300025261 Bacteria 4490
80 Ga0209455_1000204 3300025272 Bacteria 85420
81 Ga0209758_1004234 3300025297 Bacteria 12146
82 Ga0207426_1013264 3300025302 Bacteria 3060
83 Ga0207647_10036303 3300025904 Bacteria 3133
84 Ga0207654_10412887 3300025911 Bacteria 941
85 Ga0207695_10001421 3300025913 Bacteria 40289
86 Ga0207695_10382064 3300025913 Bacteria 1294
87 Ga0207671_10217701 3300025914 Bacteria 1495
88 Ga0207671_10291768 3300025914 Bacteria 1288
89 Ga0207657_10046718 3300025919 Bacteria 3791
90 Ga0207657_10804066 3300025919 Bacteria 727
91 Ga0207649_10242238 3300025920 Bacteria 1295
92 Ga0207694_10280247 3300025924 Bacteria 1369
93 Ga0207679_10078931 3300025945 Bacteria 2509
94 Ga0207678_10290841 3300026067 Bacteria 1403
95 Ga0207702_10735579 3300026078 Bacteria 973
96 Ga0207648_10415121 3300026089 Bacteria 1221
97 Ga0207674_10629602 3300026116 Bacteria 1036
98 Ga0207698_10218775 3300026142 Bacteria 1719
99 Ga0207698_10292678 3300026142 Bacteria 1512
100 Ga0268266_10079619 3300028379 Bacteria 2853
101 Ga0268266_10160055 3300028379 Bacteria 2036
102 Ga0395899_0063073 3300037312 Bacteria 2727
103 Ga0395899_0114055 3300037312 Bacteria 1941
104 Ga0395899_0341428 3300037312 Bacteria 1004
105 Ga0395899_0416446 3300037312 Bacteria 886
106 Ga0395900_0002013 3300037418 Bacteria 22906
107 Ga0395900_0044547 3300037418 Bacteria 4571
108 Ga0395900_0120865 3300037418 Bacteria 2687
109 Ga0395900_0565647 3300037418 Bacteria 1080
110 Ga0395900_0594753 3300037418 Bacteria 1047
111 Ga0395900_0656328 3300037418 Bacteria 985
112 Ga0395898_0124437 3300037466 Bacteria 2470
113 Ga0395898_0299292 3300037466 Bacteria 1535
114 Ga0395898_0909125 3300037466 Bacteria 818
115 Ga0395905_0130449 3300037471 Bacteria 2364
116 Ga0395905_0269327 3300037471 Bacteria 1589
117 Ga0395905_0562894 3300037471 Bacteria 1041
118 Ga0395901_0002160 3300038443 Bacteria 20081
119 Ga0395901_0009565 3300038443 Bacteria 9835
120 Ga0395901_0228294 3300038443 Bacteria 1944
121 Ga0395901_0802045 3300038443 Bacteria 930
122 Ga0439465_0150499 3300041413 Bacteria 831
123 Ga0439458_0047467 3300042157 Bacteria 1054
124 Ga0466963_0026066 3300044694 Bacteria 3737
125 Ga0466960_0242760 3300044901 Bacteria 998
126 Ga0495597_0095856 3300046542 Bacteria 1255
127 Ga0495668_0032117 3300046616 Bacteria 2956
128 Ga0495625_0021704 3300046660 Bacteria 4937
129 Ga0495635_0419507 3300046663 Bacteria 887
130 Ga0495674_0712308 3300047319 Bacteria 787
131 Ga0495687_082420 3300047443 Bacteria 1256
132 Ga0495602_0542490 3300048088 Bacteria 807
133 Ga0495626_0259997 3300048091 Bacteria 694
134 Ga0496102_0289478 3300048905 Bacteria 1544
135 Ga0496103_0593433 3300048906 Bacteria 706
136 Ga0496104_1012195 3300048907 Bacteria 735
137 Ga0496112_0042943 3300048915 Bacteria 4425
138 Ga0496119_0026156 3300048922 Bacteria 4054
139 Ga0496119_0256235 3300048922 Bacteria 880
140 Ga0496120_0003364 3300048923 Bacteria 14675
141 Ga0496125_0096406 3300048928 Bacteria 2196
142 Ga0496126_0049080 3300048929 Bacteria 3855
143 Ga0496126_0118888 3300048929 Bacteria 2294
144 Ga0501031_0000202 3300049568 Bacteria 33947
145 Ga0501031_0011232 3300049568 Bacteria 5835
146 Ga0501032_0000443 3300049569 Bacteria 33947
147 Ga0501032_0018481 3300049569 Bacteria 4882
148 Ga0501033_0000097 3300049570 Bacteria 83228
149 Ga0501033_0041854 3300049570 Bacteria 3416
150 Ga0501033_0164409 3300049570 Bacteria 1596
151 Ga0501033_0203098 3300049570 Bacteria 1415
152 Ga0501033_0224655 3300049570 Bacteria 1335
153 Ga0501033_0308950 3300049570 Bacteria 1112
154 Ga0501034_0000186 3300049571 Bacteria 116500
155 Ga0501034_0000883 3300049571 Bacteria 43964
156 Ga0501034_0002372 3300049571 Bacteria 22880
157 Ga0501034_0002798 3300049571 Bacteria 20405
158 Ga0501034_0024097 3300049571 Bacteria 6191
159 Ga0501034_0045710 3300049571 Bacteria 4423
160 Ga0501034_0048069 3300049571 Bacteria 4306
161 Ga0501034_0217254 3300049571 Bacteria 1865
162 Ga0501034_0482085 3300049571 Bacteria 1155
163 Ga0501036_0000002 3300049572 Bacteria 293106
164 Ga0501036_0015868 3300049572 Bacteria 6290
165 Ga0501037_0000443 3300049573 Bacteria 33927
166 Ga0501037_0102206 3300049573 Bacteria 2067
167 Ga0501038_0000002 3300049574 Bacteria 330446
168 Ga0501038_0024080 3300049574 Bacteria 5433
169 Ga0501038_0291895 3300049574 Bacteria 1281
170 Ga0501039_0000002 3300049575 Bacteria 375152
171 Ga0501039_0033679 3300049575 Bacteria 3951
172 Ga0501040_0002065 3300049576 Bacteria 12945
173 Ga0501040_0146910 3300049576 Bacteria 1662
174 Ga0501043_0000543 3300049579 Bacteria 33914
175 Ga0501043_0017000 3300049579 Bacteria 5702
176 Ga0501043_0295852 3300049579 Bacteria 1238
177 Ga0501046_0020274 3300049580 Bacteria 5501
178 Ga0501047_0002238 3300049581 Bacteria 18520
179 Ga0501047_0002948 3300049581 Bacteria 16125
180 Ga0501047_0115522 3300049581 Bacteria 2566
181 Ga0501047_0390409 3300049581 Bacteria 1225
182 Ga0501068_0122945 3300049584 Bacteria 1619
183 Ga0501070_0003059 3300049586 Bacteria 14564
184 Ga0501070_0008443 3300049586 Bacteria 8699
185 Ga0501070_0057177 3300049586 Bacteria 3233
186 Ga0501071_0285806 3300049587 Bacteria 1248
187 Ga0501072_0311738 3300049588 Bacteria 1251
188 Ga0501073_0033080 3300049589 Bacteria 3684
189 Ga0501074_0027600 3300049590 Bacteria 4116
190 Ga0501074_0056177 3300049590 Bacteria 2837
191 Ga0501079_0444188 3300049741 Bacteria 1018
192 Ga0501080_0086653 3300049742 Bacteria 2910
193 Ga0501080_0113647 3300049742 Bacteria 2510
194 Ga0501035_0000100 3300049822 Bacteria 107321
195 Ga0501035_0010431 3300049822 Bacteria 8612
196 Ga0501035_0044924 3300049822 Bacteria 3975
197 Ga0501035_0218185 3300049822 Bacteria 1629
198 Ga0501035_0339813 3300049822 Bacteria 1258
199 Ga0501035_0384296 3300049822 Bacteria 1170
200 Ga0501044_0000002 3300049823 Bacteria 375152
201 Ga0501044_0039724 3300049823 Bacteria 4906
202 Ga0501044_0213019 3300049823 Bacteria 1885
203 Ga0501044_0485235 3300049823 Bacteria 1138
204 Ga0501045_0034234 3300049824 Bacteria 3686
205 nmdc:mga03683_127883_c1 3300050489 Bacteria 1135
206 nmdc:mga03683_83481_c1 3300050489 Bacteria 1383
207 nmdc:mga03n38_106623_c1 3300050490 Bacteria 1359
208 nmdc:mga03n38_160457_c1 3300050490 Bacteria 1138
209 nmdc:mga03n38_92813_c1 3300050490 Bacteria 1441
210 nmdc:mga00v17_80255_c1 3300050491 Bacteria 2036
211 nmdc:mga00v17_84405_c1 3300050491 Bacteria 1988
212 nmdc:mga0yw44_187212_c1 3300050492 Bacteria 1364
213 nmdc:mga0yw44_42472_c1 3300050492 Bacteria 2711
214 nmdc:mga0yw44_43317_c1 3300050492 Bacteria 2687
215 nmdc:mga0yw44_49807_c1 3300050492 Bacteria 2530
216 nmdc:mga0yw44_54336_c1 3300050492 Bacteria 2434
217 nmdc:mga0yw44_73165_c1 3300050492 Bacteria 2132
218 nmdc:mga0k408_154330_c1 3300050493 Bacteria 1367
219 nmdc:mga06z11_158043_c1 3300050494 Bacteria 1294
220 nmdc:mga06z11_198927_c1 3300050494 Bacteria 1163
221 nmdc:mga07m45_99343_c1 3300050496 Bacteria 1671
222 Ga0495601_0462171 3300053077 Bacteria 820
223 Ga0495655_0119080 3300053083 Bacteria 802
224 Ga0500643_003905 3300053087 Bacteria 6925
225 Ga0500658_0152269 3300053134 Bacteria 1043
226 Ga0500658_0193284 3300053134 Bacteria 929
227 Ga0500604_0039434 3300053151 Bacteria 1420
228 Ga0500620_000126 3300053155 Bacteria 15428
229 Ga0500620_015788 3300053155 Bacteria 2143
230 Ga0500627_0064104 3300053158 Bacteria 1620
231 Ga0500611_011586 3300053727 Bacteria 1464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100224660 Ga0070665_1002246603 165
2 3300009093 Ga0105240_10303524 Ga0105240_103035242 165
3 3300025913 Ga0207695_10001421 Ga0207695_1000142131 165
4 3300014968 Ga0157379_10467818 Ga0157379_104678182 186
5 3300006237 Ga0097621_100459363 Ga0097621_1004593632 190
6 3300046663 Ga0495635_0419507 Ga0495635_0419507_234_809 191
7 3300047319 Ga0495674_0712308 Ga0495674_0712308_184_759 191
8 3300048088 Ga0495602_0542490 Ga0495602_0542490_171_746 191
9 3300005937 Ga0081455_10029008 Ga0081455_100290083 192
10 3300014325 Ga0163163_10231624 Ga0163163_102316241 192
11 3300041413 Ga0439465_0150499 Ga0439465_0150499_40_618 192
12 3300044694 Ga0466963_0026066 Ga0466963_0026066_1781_2434 192
13 3300053087 Ga0500643_003905 Ga0500643_003905_5137_5715 192
14 3300005467 Ga0070706_100447722 Ga0070706_1004477222 193
15 3300005617 Ga0068859_100574706 Ga0068859_1005747062 193
16 3300005618 Ga0068864_100208626 Ga0068864_1002086261 193
17 3300006931 Ga0097620_100574625 Ga0097620_1005746252 193
18 iso_pu_bacteria 2965032056 2965032925 193
19 iso_pu_bacteria 2979742915 2979745271 193
20 iso_pu_bacteria 637000159 637073609 193
21 iso_pu_bacteria 2643221550 2643772809 194
22 iso_pu_bacteria 2693429783 2694631964 196
23 iso_pu_bacteria 2693429784 2694634615 196
24 iso_pu_bacteria 2924754689 2924760269 196
25 iso_pu_bacteria 8004395343 8004395624 196
26 3300048922 Ga0496119_0256235 Ga0496119_0256235_268_861 197
27 3300049571 Ga0501034_0217254 Ga0501034_0217254_83_739 197
28 3300049581 Ga0501047_0390409 Ga0501047_0390409_132_788 197
29 3300049742 Ga0501080_0113647 Ga0501080_0113647_1739_2395 197
30 3300053134 Ga0500658_0193284 Ga0500658_0193284_37_630 197
31 3300053151 Ga0500604_0039434 Ga0500604_0039434_301_894 197
32 3300005548 Ga0070665_100054833 Ga0070665_1000548334 198
33 3300009545 Ga0105237_10257973 Ga0105237_102579733 198
34 3300010375 Ga0105239_10122092 Ga0105239_101220921 198
35 3300013102 Ga0157371_10523500 Ga0157371_105235002 198
36 3300028379 Ga0268266_10079619 Ga0268266_100796193 198
37 3300037312 Ga0395899_0416446 Ga0395899_0416446_52_660 198
38 3300037418 Ga0395900_0002013 Ga0395900_0002013_21974_22582 198
39 3300038443 Ga0395901_0002160 Ga0395901_0002160_18484_19092 198
40 3300049571 Ga0501034_0048069 Ga0501034_0048069_1800_2408 198
41 3300049571 Ga0501034_0482085 Ga0501034_0482085_218_826 198
42 iso_pu_bacteria 2970540015 2970547738 199
43 3300037466 Ga0395898_0299292 Ga0395898_0299292_919_1521 200
44 3300037471 Ga0395905_0130449 Ga0395905_0130449_1744_2346 200
45 3300048091 Ga0495626_0259997 Ga0495626_0259997_25_636 200
46 3300049568 Ga0501031_0000202 Ga0501031_0000202_29589_30191 200
47 3300049569 Ga0501032_0000443 Ga0501032_0000443_3757_4359 200
48 3300049570 Ga0501033_0000097 Ga0501033_0000097_29589_30191 200
49 3300049570 Ga0501033_0164409 Ga0501033_0164409_262_864 200
50 3300049571 Ga0501034_0000186 Ga0501034_0000186_86308_86910 200
51 3300049572 Ga0501036_0000002 Ga0501036_0000002_262918_263520 200
52 3300049573 Ga0501037_0000443 Ga0501037_0000443_29582_30184 200
53 3300049574 Ga0501038_0000002 Ga0501038_0000002_2949_3551 200
54 3300049575 Ga0501039_0000002 Ga0501039_0000002_344962_345564 200
55 3300049576 Ga0501040_0002065 Ga0501040_0002065_3757_4359 200
56 3300049579 Ga0501043_0000543 Ga0501043_0000543_3736_4338 200
57 3300049581 Ga0501047_0002948 Ga0501047_0002948_11460_12062 200
58 3300049584 Ga0501068_0122945 Ga0501068_0122945_963_1574 200
59 3300049586 Ga0501070_0008443 Ga0501070_0008443_5623_6225 200
60 3300049822 Ga0501035_0000100 Ga0501035_0000100_77131_77733 200
61 3300049823 Ga0501044_0000002 Ga0501044_0000002_29589_30191 200
62 3300049823 Ga0501044_0485235 Ga0501044_0485235_98_700 200
63 3300009545 Ga0105237_10028343 Ga0105237_100283434 201
64 3300009551 Ga0105238_10010408 Ga0105238_100104085 201
65 3300026142 Ga0207698_10292678 Ga0207698_102926782 201
66 3300048905 Ga0496102_0289478 Ga0496102_0289478_840_1499 201
67 3300048929 Ga0496126_0118888 Ga0496126_0118888_1125_1823 201
68 3300037312 Ga0395899_0341428 Ga0395899_0341428_136_795 204
69 3300037418 Ga0395900_0044547 Ga0395900_0044547_2282_2941 204
70 3300037471 Ga0395905_0269327 Ga0395905_0269327_256_915 204
71 iso_pu_bacteria 2894772417 2894776908 206
72 3300053077 Ga0495601_0462171 Ga0495601_0462171_46_708 207
73 3300025302 Ga0207426_1013264 Ga0207426_10132642 209
74 3300037418 Ga0395900_0594753 Ga0395900_0594753_364_1023 209
75 3300038443 Ga0395901_0228294 Ga0395901_0228294_557_1216 209
76 3300049571 Ga0501034_0000883 Ga0501034_0000883_1556_2197 209
77 iso_pu_bacteria 2937868953 2937873659 209
78 iso_pu_bacteria 2643221551 2643775524 210
79 iso_pu_bacteria 2643221555 2643793970 210
80 3300003323 rootH1_10088124 rootH1_100881242 211
81 iso_pu_bacteria 2503198000 2503202610 211
82 iso_pu_bacteria 2509276018 2509373042 211
83 iso_pu_bacteria 2510065059 2510319865 211
84 iso_pu_bacteria 2512875016 2512930615 211
85 iso_pu_bacteria 2513237090 2513612080 211
86 iso_pu_bacteria 2588253730 2588516264 211
87 iso_pu_bacteria 2687453392 2688599113 211
88 iso_pu_bacteria 2756170246 2756677812 211
89 iso_pu_bacteria 2791355123 2792752951 211
90 iso_pu_bacteria 2844002411 2844006741 211
91 iso_pu_bacteria 2856320880 2856325128 211
92 iso_pu_bacteria 2856328259 2856330517 211
93 iso_pu_bacteria 2856334872 2856335320 211
94 iso_pu_bacteria 2857367948 2857374515 211
95 iso_pu_bacteria 2869249662 2869256607 211
96 iso_pu_bacteria 2869256925 2869258302 211
97 iso_pu_bacteria 2869264136 2869265555 211
98 iso_pu_bacteria 2869271264 2869276639 211
99 iso_pu_bacteria 2869278585 2869280850 211
100 iso_pu_bacteria 2871459585 2871462985 211
101 iso_pu_bacteria 2871466892 2871473656 211
102 iso_pu_bacteria 2871495908 2871500506 211
103 iso_pu_bacteria 2874131515 2874138713 211
104 iso_pu_bacteria 2874139085 2874141482 211
105 iso_pu_bacteria 2874162495 2874163815 211
106 iso_pu_bacteria 2874168670 2874172620 211
107 iso_pu_bacteria 2876363079 2876368038 211
108 iso_pu_bacteria 2876399893 2876399977 211
109 iso_pu_bacteria 2876406927 2876412666 211
110 iso_pu_bacteria 2878738818 2878743211 211
111 iso_pu_bacteria 2878760144 2878764595 211
112 iso_pu_bacteria 2878767105 2878771696 211
113 iso_pu_bacteria 2878774303 2878778416 211
114 iso_pu_bacteria 2878781027 2878781238 211
115 iso_pu_bacteria 2903448605 2903452059 211
116 iso_pu_bacteria 2903521522 2903527034 211
117 iso_pu_bacteria 2903528002 2903533261 211
118 iso_pu_bacteria 2903540706 2903545319 211
119 iso_pu_bacteria 2906363423 2906366970 211
120 iso_pu_bacteria 2906370794 2906375771 211
121 iso_pu_bacteria 2906386501 2906388571 211
122 iso_pu_bacteria 2906408224 2906410524 211
123 iso_pu_bacteria 2922151315 2922153989 211
124 iso_pu_bacteria 2922172374 2922177558 211
125 iso_pu_bacteria 2922178524 2922183025 211
126 iso_pu_bacteria 2924710171 2924710213 211
127 iso_pu_bacteria 2924718760 2924725664 211
128 iso_pu_bacteria 2924748358 2924753905 211
129 iso_pu_bacteria 2924762789 2924763878 211
130 iso_pu_bacteria 2924776078 2924777325 211
131 iso_pu_bacteria 2937848649 2937853680 211
132 iso_pu_bacteria 2937877337 2937879270 211
133 iso_pu_bacteria 2937972304 2937974997 211
134 iso_pu_bacteria 2937994558 2937999169 211
135 iso_pu_bacteria 2958034702 2958036813 211
136 iso_pu_bacteria 2958041894 2958050435 211
137 iso_pu_bacteria 2958084443 2958086445 211
138 iso_pu_bacteria 2958092219 2958098585 211
139 iso_pu_bacteria 2958122699 2958123165 211
140 iso_pu_bacteria 2958137437 2958142328 211
141 iso_pu_bacteria 2958144490 2958150696 211
142 iso_pu_bacteria 2958158011 2958159685 211
143 iso_pu_bacteria 2958165035 2958169643 211
144 iso_pu_bacteria 2961136820 2961143369 211
145 iso_pu_bacteria 2961163497 2961168103 211
146 iso_pu_bacteria 2963644680 2963648611 211
147 iso_pu_bacteria 2965018300 2965022922 211
148 iso_pu_bacteria 2965025482 2965027292 211
149 iso_pu_bacteria 2965040258 2965040756 211
150 iso_pu_bacteria 2965047637 2965050173 211
151 iso_pu_bacteria 2965089291 2965095464 211
152 iso_pu_bacteria 2965102966 2965108024 211
153 iso_pu_bacteria 2965110997 2965112437 211
154 iso_pu_bacteria 2968016561 2968017512 211
155 iso_pu_bacteria 2968083720 2968083839 211
156 iso_pu_bacteria 2968171901 2968176503 211
157 iso_pu_bacteria 2970469710 2970472312 211
158 iso_pu_bacteria 2970489779 2970490861 211
159 iso_pu_bacteria 2970547951 2970554331 211
160 iso_pu_bacteria 2970554993 2970559442 211
161 iso_pu_bacteria 2970593180 2970595454 211
162 iso_pu_bacteria 2977872689 2977875286 211
163 iso_pu_bacteria 2977898635 2977899224 211
164 iso_pu_bacteria 2977915119 2977915932 211
165 iso_pu_bacteria 2977922695 2977929164 211
166 iso_pu_bacteria 2977935797 2977939488 211
167 iso_pu_bacteria 2977950692 2977957241 211
168 iso_pu_bacteria 2977957713 2977964258 211
169 iso_pu_bacteria 2977986579 2977988792 211
170 iso_pu_bacteria 2979793036 2979797927 211
171 iso_pu_bacteria 2987645492 2987645599 211
172 iso_pu_bacteria 2987659509 2987664117 211
173 iso_pu_bacteria 2987666974 2987670346 211
174 iso_pu_bacteria 2987673487 2987673512 211
175 iso_pu_bacteria 2996348954 2996351183 211
176 iso_pu_bacteria 3004167301 3004170136 211
177 iso_pu_bacteria 3004188549 3004193172 211
178 iso_pu_bacteria 3004195979 3004197883 211
179 iso_pu_bacteria 3004211236 3004212700 211
180 iso_pu_bacteria 3004218560 3004222723 211
181 iso_pu_bacteria 3004239961 3004245151 211
182 iso_pu_bacteria 3004275668 3004277881 211
183 iso_pu_bacteria 3004289098 3004296299 211
184 iso_pu_bacteria 649633066 649873545 211
185 iso_pu_bacteria 8004300914 8004305577 211
186 iso_pu_bacteria 8004361976 8004365413 211
187 iso_pu_bacteria 8004695233 8004695752 211
188 3300044901 Ga0466960_0242760 Ga0466960_0242760_57_719 212
189 iso_pu_bacteria 2643221595 2643987353 212
190 iso_pu_bacteria 2643221627 2644155677 212
191 iso_pu_bacteria 2844009547 2844014511 212
192 iso_pu_bacteria 2869234852 2869239227 212
193 iso_pu_bacteria 2871435913 2871438149 212
194 iso_pu_bacteria 2871451962 2871457685 212
195 iso_pu_bacteria 2871481445 2871488067 212
196 iso_pu_bacteria 2874116593 2874121788 212
197 iso_pu_bacteria 2876386047 2876391462 212
198 iso_pu_bacteria 2876420981 2876422679 212
199 iso_pu_bacteria 2878730984 2878732990 212
200 iso_pu_bacteria 2903513507 2903515689 212
201 iso_pu_bacteria 2906401398 2906403006 212
202 iso_pu_bacteria 2906427513 2906433579 212
203 iso_pu_bacteria 2924733363 2924734619 212
204 iso_pu_bacteria 2924741084 2924742014 212
205 iso_pu_bacteria 2937861824 2937865288 212
206 iso_pu_bacteria 2937980651 2937985924 212
207 iso_pu_bacteria 2958108152 2958110798 212
208 iso_pu_bacteria 2961183825 2961185174 212
209 iso_pu_bacteria 2968138860 2968141591 212
210 iso_pu_bacteria 2970510686 2970513797 212
211 iso_pu_bacteria 2970532167 2970536052 212
212 iso_pu_bacteria 2970619444 2970622943 212
213 iso_pu_bacteria 2970627176 2970628550 212
214 iso_pu_bacteria 2977851361 2977853083 212
215 iso_pu_bacteria 2977907340 2977914707 212
216 iso_pu_bacteria 2979764755 2979771546 212
217 iso_pu_bacteria 2979772303 2979775297 212
218 iso_pu_bacteria 2996386984 2996390960 212
219 iso_pu_bacteria 3004232784 3004234864 212
220 iso_pu_bacteria 3004248173 3004255164 212
221 iso_pu_bacteria 3004268573 3004269770 212
222 iso_pu_bacteria 3004334049 3004340305 212
223 iso_pu_bacteria 8004312739 8004318178 212
224 iso_pu_bacteria 8004727605 8004730121 212
225 3300005329 Ga0070683_100218698 Ga0070683_1002186983 213
226 3300005344 Ga0070661_100040925 Ga0070661_1000409254 213
227 3300005366 Ga0070659_100092779 Ga0070659_1000927793 213
228 3300005530 Ga0070679_100565944 Ga0070679_1005659442 213
229 3300005535 Ga0070684_100084386 Ga0070684_1000843863 213
230 3300005563 Ga0068855_100062162 Ga0068855_1000621623 213
231 3300005563 Ga0068855_100164315 Ga0068855_1001643153 213
232 3300005564 Ga0070664_100065795 Ga0070664_1000657953 213
233 3300005614 Ga0068856_100142459 Ga0068856_1001424593 213
234 3300005616 Ga0068852_100171812 Ga0068852_1001718122 213
235 3300009093 Ga0105240_10177831 Ga0105240_101778312 213
236 3300025914 Ga0207671_10217701 Ga0207671_102177012 213
237 3300025924 Ga0207694_10280247 Ga0207694_102802472 213
238 3300025945 Ga0207679_10078931 Ga0207679_100789312 213
239 3300026116 Ga0207674_10629602 Ga0207674_106296021 213
240 3300037312 Ga0395899_0063073 Ga0395899_0063073_329_985 213
241 3300037418 Ga0395900_0120865 Ga0395900_0120865_683_1339 213
242 3300037466 Ga0395898_0124437 Ga0395898_0124437_1713_2369 213
243 3300038443 Ga0395901_0009565 Ga0395901_0009565_1318_1974 213
244 3300049571 Ga0501034_0002798 Ga0501034_0002798_17300_17956 213
245 3300049581 Ga0501047_0115522 Ga0501047_0115522_1431_2087 213
246 3300053727 Ga0500611_011586 Ga0500611_011586_272_928 213
247 iso_pu_bacteria 2508501127 2509143540 213
248 iso_pu_bacteria 2738543024 2739308973 213
249 iso_pu_bacteria 2841734538 2841740403 213
250 iso_pu_bacteria 2871474448 2871476467 213
251 iso_pu_bacteria 2888343758 2888347822 213
252 iso_pu_bacteria 2889016732 2889023185 213
253 iso_pu_bacteria 2937836603 2937840043 213
254 iso_pu_bacteria 2958071322 2958072518 213
255 iso_pu_bacteria 2958100919 2958102646 213
256 iso_pu_bacteria 2965119406 2965126184 213
257 iso_pu_bacteria 2970524798 2970530061 213
258 iso_pu_bacteria 2979710463 2979710518 213
259 iso_pu_bacteria 8004633249 8004633924 213
260 3300005327 Ga0070658_10315927 Ga0070658_103159272 214
261 3300005339 Ga0070660_100107769 Ga0070660_1001077692 214
262 3300005344 Ga0070661_100731687 Ga0070661_1007316871 214
263 3300005366 Ga0070659_100656265 Ga0070659_1006562651 214
264 3300005455 Ga0070663_100411129 Ga0070663_1004111291 214
265 3300005539 Ga0068853_100179647 Ga0068853_1001796473 214
266 3300005548 Ga0070665_100119898 Ga0070665_1001198982 214
267 3300005563 Ga0068855_100476196 Ga0068855_1004761962 214
268 3300005616 Ga0068852_100457334 Ga0068852_1004573341 214
269 3300006038 Ga0075365_10012266 Ga0075365_100122663 214
270 3300006038 Ga0075365_10067047 Ga0075365_100670472 214
271 3300006042 Ga0075368_10035433 Ga0075368_100354332 214
272 3300006048 Ga0075363_100053161 Ga0075363_1000531613 214
273 3300006051 Ga0075364_10091186 Ga0075364_100911862 214
274 3300006178 Ga0075367_10101562 Ga0075367_101015622 214
275 3300006186 Ga0075369_10140712 Ga0075369_101407121 214
276 3300006353 Ga0075370_10108322 Ga0075370_101083222 214
277 3300009093 Ga0105240_10665674 Ga0105240_106656741 214
278 3300009545 Ga0105237_10120114 Ga0105237_101201142 214
279 3300009551 Ga0105238_10550480 Ga0105238_105504801 214
280 3300013104 Ga0157370_10137997 Ga0157370_101379972 214
281 3300013105 Ga0157369_10109919 Ga0157369_101099193 214
282 3300013297 Ga0157378_10246898 Ga0157378_102468982 214
283 3300025911 Ga0207654_10412887 Ga0207654_104128871 214
284 3300025913 Ga0207695_10382064 Ga0207695_103820642 214
285 3300025914 Ga0207671_10291768 Ga0207671_102917682 214
286 3300025919 Ga0207657_10046718 Ga0207657_100467182 214
287 3300025920 Ga0207649_10242238 Ga0207649_102422382 214
288 3300026078 Ga0207702_10735579 Ga0207702_107355792 214
289 3300026142 Ga0207698_10218775 Ga0207698_102187752 214
290 3300028379 Ga0268266_10160055 Ga0268266_101600552 214
291 3300046616 Ga0495668_0032117 Ga0495668_0032117_1524_2174 214
292 3300048928 Ga0496125_0096406 Ga0496125_0096406_754_1404 214
293 3300049571 Ga0501034_0002372 Ga0501034_0002372_15775_16437 214
294 3300050490 nmdc:mga03n38_160457_c1 nmdc:mga03n38_160457_c1_401_1051 214
295 3300050491 nmdc:mga00v17_80255_c1 nmdc:mga00v17_80255_c1_643_1293 214
296 3300050492 nmdc:mga0yw44_42472_c1 nmdc:mga0yw44_42472_c1_1128_1778 214
297 3300050492 nmdc:mga0yw44_73165_c1 nmdc:mga0yw44_73165_c1_932_1582 214
298 3300050494 nmdc:mga06z11_198927_c1 nmdc:mga06z11_198927_c1_211_861 214
299 3300050496 nmdc:mga07m45_99343_c1 nmdc:mga07m45_99343_c1_228_878 214
300 3300053083 Ga0495655_0119080 Ga0495655_0119080_31_681 214
301 iso_pu_bacteria 2508501123 2509117770 214
302 iso_pu_bacteria 2509276022 2509397119 214
303 iso_pu_bacteria 2599185301 2599939588 214
304 iso_pu_bacteria 2721755686 2723576117 214
305 iso_pu_bacteria 2847670302 2847670840 214
306 iso_pu_bacteria 2847686936 2847687020 214
307 iso_pu_bacteria 2856314179 2856316297 214
308 iso_pu_bacteria 2856349417 2856349975 214
309 iso_pu_bacteria 2856356410 2856363909 214
310 iso_pu_bacteria 2856364286 2856369096 214
311 iso_pu_bacteria 2857349434 2857355637 214
312 iso_pu_bacteria 2869162929 2869167364 214
313 iso_pu_bacteria 2869285874 2869288464 214
314 iso_pu_bacteria 2871429161 2871432155 214
315 iso_pu_bacteria 2871444079 2871445614 214
316 iso_pu_bacteria 2871488783 2871495673 214
317 iso_pu_bacteria 2874102143 2874104795 214
318 iso_pu_bacteria 2874123672 2874125756 214
319 iso_pu_bacteria 2874146452 2874151035 214
320 iso_pu_bacteria 2874155637 2874157373 214
321 iso_pu_bacteria 2876369609 2876372883 214
322 iso_pu_bacteria 2876392853 2876395212 214
323 iso_pu_bacteria 2876413966 2876417063 214
324 iso_pu_bacteria 2878035449 2878041620 214
325 iso_pu_bacteria 2878745973 2878748874 214
326 iso_pu_bacteria 2878753008 2878753528 214
327 iso_pu_bacteria 2881147464 2881152604 214
328 iso_pu_bacteria 2881155292 2881156223 214
329 iso_pu_bacteria 2881845957 2881849958 214
330 iso_pu_bacteria 2881853255 2881857785 214
331 iso_pu_bacteria 2882632389 2882633113 214
332 iso_pu_bacteria 2882912400 2882917231 214
333 iso_pu_bacteria 2885305155 2885310627 214
334 iso_pu_bacteria 2885318864 2885325188 214
335 iso_pu_bacteria 2885326080 2885333781 214
336 iso_pu_bacteria 2885342637 2885349251 214
337 iso_pu_bacteria 2885350715 2885355569 214
338 iso_pu_bacteria 2888337043 2888340634 214
339 iso_pu_bacteria 2888350351 2888356834 214
340 iso_pu_bacteria 2889010040 2889011886 214
341 iso_pu_bacteria 2903492973 2903495383 214
342 iso_pu_bacteria 2903492973 2903504116 214
343 iso_pu_bacteria 2904659560 2904661843 214
344 iso_pu_bacteria 2906308376 2906311226 214
345 iso_pu_bacteria 2906321335 2906323993 214
346 iso_pu_bacteria 2906328253 2906328406 214
347 iso_pu_bacteria 2906354277 2906360611 214
348 iso_pu_bacteria 2906414383 2906416434 214
349 iso_pu_bacteria 2922130491 2922135597 214
350 iso_pu_bacteria 2922158528 2922163232 214
351 iso_pu_bacteria 2922185730 2922189591 214
352 iso_pu_bacteria 2924726620 2924730160 214
353 iso_pu_bacteria 2924784321 2924789557 214
354 iso_pu_bacteria 2937813078 2937813448 214
355 iso_pu_bacteria 2937891427 2937896604 214
356 iso_pu_bacteria 2938014810 2938019290 214
357 iso_pu_bacteria 2958064165 2958065819 214
358 iso_pu_bacteria 2958115193 2958122542 214
359 iso_pu_bacteria 2958130278 2958132865 214
360 iso_pu_bacteria 2958179912 2958182979 214
361 iso_pu_bacteria 2961077736 2961080859 214
362 iso_pu_bacteria 2961114664 2961116996 214
363 iso_pu_bacteria 2961170736 2961177987 214
364 iso_pu_bacteria 2965062239 2965064101 214
365 iso_pu_bacteria 2967996073 2968003239 214
366 iso_pu_bacteria 2968003550 2968004065 214
367 iso_pu_bacteria 2968091066 2968092458 214
368 iso_pu_bacteria 2968097103 2968102114 214
369 iso_pu_bacteria 2968110612 2968112904 214
370 iso_pu_bacteria 2968117919 2968122865 214
371 iso_pu_bacteria 2968128360 2968128812 214
372 iso_pu_bacteria 2970503327 2970510663 214
373 iso_pu_bacteria 2977821940 2977822532 214
374 iso_pu_bacteria 2977828996 2977833525 214
375 iso_pu_bacteria 2977843712 2977845447 214
376 iso_pu_bacteria 2977858184 2977858588 214
377 iso_pu_bacteria 2977864932 2977872010 214
378 iso_pu_bacteria 2977942078 2977946103 214
379 iso_pu_bacteria 2977971508 2977976472 214
380 iso_pu_bacteria 2979779861 2979784828 214
381 iso_pu_bacteria 2979808191 2979815537 214
382 iso_pu_bacteria 2987636660 2987640771 214
383 iso_pu_bacteria 2996341866 2996348326 214
384 iso_pu_bacteria 3000135777 3000136222 214
385 iso_pu_bacteria 3004203850 3004208968 214
386 iso_pu_bacteria 8004374579 8004375100 214
387 iso_pu_bacteria 8004387939 8004390977 214
388 iso_pu_bacteria 8004445564 8004448284 214
389 iso_pu_bacteria 8004640170 8004643162 214
390 iso_pu_bacteria 8004703790 8004714502 214
391 iso_pu_bacteria 8004714634 8004717529 214
392 iso_pu_bacteria 8055617313 8055621956 214
393 3300005539 Ga0068853_100575205 Ga0068853_1005752052 215
394 3300005548 Ga0070665_100043221 Ga0070665_1000432212 215
395 3300006048 Ga0075363_100138230 Ga0075363_1001382302 215
396 3300006178 Ga0075367_10099714 Ga0075367_100997142 215
397 3300006186 Ga0075369_10007257 Ga0075369_100072573 215
398 3300006195 Ga0075366_10123951 Ga0075366_101239512 215
399 3300009551 Ga0105238_10123148 Ga0105238_101231482 215
400 3300025261 Ga0209233_1004929 Ga0209233_10049293 215
401 3300046542 Ga0495597_0095856 Ga0495597_0095856_292_954 215
402 3300046660 Ga0495625_0021704 Ga0495625_0021704_1801_2463 215
403 3300047443 Ga0495687_082420 Ga0495687_082420_489_1151 215
404 3300050492 nmdc:mga0yw44_43317_c1 nmdc:mga0yw44_43317_c1_994_1656 215
405 3300050492 nmdc:mga0yw44_49807_c1 nmdc:mga0yw44_49807_c1_647_1297 215
406 3300050493 nmdc:mga0k408_154330_c1 nmdc:mga0k408_154330_c1_446_1096 215
407 3300053134 Ga0500658_0152269 Ga0500658_0152269_251_913 215
408 3300053155 Ga0500620_000126 Ga0500620_000126_2636_3292 215
409 3300053155 Ga0500620_015788 Ga0500620_015788_1356_2018 215
410 3300053158 Ga0500627_0064104 Ga0500627_0064104_648_1310 215
411 3300010375 Ga0105239_10789596 Ga0105239_107895961 216
412 3300025919 Ga0207657_10804066 Ga0207657_108040661 216
413 3300037418 Ga0395900_0656328 Ga0395900_0656328_75_731 216
414 3300048907 Ga0496104_1012195 Ga0496104_1012195_32_688 216
415 3300048915 Ga0496112_0042943 Ga0496112_0042943_1900_2556 216
416 iso_pu_bacteria 2937822353 2937826622 216
417 iso_pu_bacteria 3005416602 3005420804 216
418 iso_pu_bacteria 8005314921 8005316656 216
419 3300003763 Ga0055529_1003056 Ga0055529_10030562 217
420 3300006038 Ga0075365_10255303 Ga0075365_102553032 217
421 3300006051 Ga0075364_10069370 Ga0075364_100693703 217
422 3300006177 Ga0075362_10038312 Ga0075362_100383122 217
423 3300006177 Ga0075362_10205909 Ga0075362_102059091 217
424 3300025254 Ga0209148_1000038 Ga0209148_100003819 217
425 3300025272 Ga0209455_1000204 Ga0209455_100020468 217
426 3300026067 Ga0207678_10290841 Ga0207678_102908412 217
427 3300042157 Ga0439458_0047467 Ga0439458_0047467_44_712 217
428 3300048906 Ga0496103_0593433 Ga0496103_0593433_11_670 217
429 3300048929 Ga0496126_0049080 Ga0496126_0049080_1167_1829 217
430 3300049568 Ga0501031_0011232 Ga0501031_0011232_3919_4584 217
431 3300049569 Ga0501032_0018481 Ga0501032_0018481_3347_4012 217
432 3300049570 Ga0501033_0041854 Ga0501033_0041854_1252_1917 217
433 3300049570 Ga0501033_0203098 Ga0501033_0203098_231_887 217
434 3300049570 Ga0501033_0224655 Ga0501033_0224655_589_1254 217
435 3300049570 Ga0501033_0308950 Ga0501033_0308950_244_900 217
436 3300049571 Ga0501034_0024097 Ga0501034_0024097_2161_2826 217
437 3300049571 Ga0501034_0045710 Ga0501034_0045710_1621_2286 217
438 3300049572 Ga0501036_0015868 Ga0501036_0015868_3147_3812 217
439 3300049573 Ga0501037_0102206 Ga0501037_0102206_1239_1904 217
440 3300049574 Ga0501038_0024080 Ga0501038_0024080_1635_2300 217
441 3300049575 Ga0501039_0033679 Ga0501039_0033679_1675_2340 217
442 3300049576 Ga0501040_0146910 Ga0501040_0146910_674_1339 217
443 3300049579 Ga0501043_0017000 Ga0501043_0017000_3425_4090 217
444 3300049580 Ga0501046_0020274 Ga0501046_0020274_3672_4337 217
445 3300049586 Ga0501070_0057177 Ga0501070_0057177_1089_1754 217
446 3300049588 Ga0501072_0311738 Ga0501072_0311738_516_1181 217
447 3300049590 Ga0501074_0056177 Ga0501074_0056177_1721_2386 217
448 3300049741 Ga0501079_0444188 Ga0501079_0444188_221_886 217
449 3300049742 Ga0501080_0086653 Ga0501080_0086653_404_1069 217
450 3300049822 Ga0501035_0044924 Ga0501035_0044924_1713_2378 217
451 3300049822 Ga0501035_0218185 Ga0501035_0218185_273_938 217
452 3300049822 Ga0501035_0339813 Ga0501035_0339813_67_753 217
453 3300049822 Ga0501035_0384296 Ga0501035_0384296_217_873 217
454 3300049823 Ga0501044_0039724 Ga0501044_0039724_2607_3272 217
455 3300049823 Ga0501044_0213019 Ga0501044_0213019_867_1532 217
456 3300049824 Ga0501045_0034234 Ga0501045_0034234_992_1657 217
457 3300050489 nmdc:mga03683_127883_c1 nmdc:mga03683_127883_c1_205_873 217
458 3300050491 nmdc:mga00v17_84405_c1 nmdc:mga00v17_84405_c1_234_902 217
459 3300050492 nmdc:mga0yw44_54336_c1 nmdc:mga0yw44_54336_c1_1503_2171 217
460 iso_pu_bacteria 2929199973 2929200676 217
461 iso_pu_bacteria 8055909800 8055915338 217
462 3300002705 JGI25156J39149_1004205 JGI25156J39149_10042052 218
463 3300002741 JGI25157J39369_1001164 JGI25157J39369_100116413 218
464 3300005356 Ga0070674_100303197 Ga0070674_1003031971 218
465 3300005459 Ga0068867_100226494 Ga0068867_1002264942 218
466 3300005548 Ga0070665_100142084 Ga0070665_1001420841 218
467 3300006042 Ga0075368_10079797 Ga0075368_100797971 218
468 3300006048 Ga0075363_100286842 Ga0075363_1002868421 218
469 3300009148 Ga0105243_10227724 Ga0105243_102277242 218
470 3300013104 Ga0157370_10101547 Ga0157370_101015472 218
471 3300014969 Ga0157376_10229069 Ga0157376_102290692 218
472 3300025250 Ga0209026_1000002 Ga0209026_1000002521 218
473 3300025256 Ga0209759_1000119 Ga0209759_100011959 218
474 3300025261 Ga0209233_1000625 Ga0209233_10006257 218
475 3300025297 Ga0209758_1004234 Ga0209758_10042349 218
476 3300025904 Ga0207647_10036303 Ga0207647_100363033 218
477 3300026089 Ga0207648_10415121 Ga0207648_104151212 218
478 3300037312 Ga0395899_0114055 Ga0395899_0114055_287_961 218
479 3300037418 Ga0395900_0565647 Ga0395900_0565647_167_841 218
480 3300037466 Ga0395898_0909125 Ga0395898_0909125_111_770 218
481 3300037471 Ga0395905_0562894 Ga0395905_0562894_330_989 218
482 3300038443 Ga0395901_0802045 Ga0395901_0802045_95_769 218
483 3300048922 Ga0496119_0026156 Ga0496119_0026156_3298_3957 218
484 3300048923 Ga0496120_0003364 Ga0496120_0003364_12321_12980 218
485 3300049574 Ga0501038_0291895 Ga0501038_0291895_410_1099 218
486 3300049579 Ga0501043_0295852 Ga0501043_0295852_167_856 218
487 3300049581 Ga0501047_0002238 Ga0501047_0002238_3492_4181 218
488 3300049586 Ga0501070_0003059 Ga0501070_0003059_9635_10324 218
489 3300049587 Ga0501071_0285806 Ga0501071_0285806_365_1054 218
490 3300049589 Ga0501073_0033080 Ga0501073_0033080_1518_2207 218
491 3300049590 Ga0501074_0027600 Ga0501074_0027600_153_842 218
492 3300049822 Ga0501035_0010431 Ga0501035_0010431_4461_5150 218
493 3300050489 nmdc:mga03683_83481_c1 nmdc:mga03683_83481_c1_566_1225 218
494 3300050490 nmdc:mga03n38_106623_c1 nmdc:mga03n38_106623_c1_238_897 218
495 3300050490 nmdc:mga03n38_92813_c1 nmdc:mga03n38_92813_c1_291_950 218
496 3300050492 nmdc:mga0yw44_187212_c1 nmdc:mga0yw44_187212_c1_404_1063 218
497 3300050494 nmdc:mga06z11_158043_c1 nmdc:mga06z11_158043_c1_467_1126 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01812

5-FTHF_cyc-lig

5-formyltetrahydrofolate cyclo-ligase family

37

211

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jcb-assembly2.cif.gz_B the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) 0.9145 36 214
1u3g-assembly1.cif.gz_A structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) 0.9 40 214
1u3g-assembly1.cif.gz_A structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) 0.8792 40 214
3hy6-assembly1.cif.gz_A structure of human mthfs with adp 0.8712 33 213
1sou-assembly1.cif.gz_A nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46 0.8662 40 215
ID Description Score Start End Superfamily
2jcbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9145 36 214 3.40.50.10420
1u3gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9 40 214 3.40.50.10420
af_A0A0G2L0J2_1_199_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8964 34 214 3.40.50.10420
af_O05575_1_191_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8924 40 215 3.40.50.10420
af_Q2FY23_1_179_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8907 40 211 3.40.50.10420
ID Description Score Start End GO Terms
AF-W7VZ60-F1-model_v4 Putative 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9928 133 211 GO:0005524
GO:0009396
GO:0030272
GO:0035999
AF-W7WM26-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9921 33 214 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A531ACD2-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase 0.9908 146 218 GO:0009396
GO:0030272
GO:0035999
AF-A0A848U6R5-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9895 104 214 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A5E8XDN3-F1-model_v4 deleted 0.9894 85 212

Feature Viewer

pLDDT pTM Quality
87.71 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map