F455093

General Info

Members Datasets Scaffolds Average Seq Length
497 238 994 271

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0412628|Ga0496106_0412628_85_987
Length 300
Sequence MPRTASEPVLRESPSSVQLGTPLSCGVQSMRLSEAGELGLLAELERRGLAQRIEHDAAALGDGVVVTQDALVEGVHFRLGWISWRDLGWRAAAVNLSDLAASGADPEGLIVTLAAPGDTNVEDLLELYAGLGEAGAPVLGGDTTRAEQLVLSVTAVGRSARVPGRAGARPGDALVVTGPLGAAGAAFRRDTFVRPPLRLVEGKELAAHAHAMLDLSDGLAVDAKHIAARSGCRLVIELERVPIAEGAQLDDVGFGEDYELLAAVAQETHFTEIGRCEEGDGVALTLNGVPYELGGWEHFR

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
113 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
114 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 11.87
Rhizosphere 87.73
Stem 0
Stem Tuber 0
Unclassified 7.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0412628 3300048909 Unclassified 1085
2 JGI25407J50210_10006209 3300003373 Bacteria 2969
3 Ga0070658_10006751 3300005327 Bacteria 9289
4 Ga0070658_10023673 3300005327 Bacteria 4925
5 Ga0070658_10074433 3300005327 Bacteria 2785
6 Ga0070676_10140208 3300005328 Bacteria 1538
7 Ga0070683_100007038 3300005329 Bacteria 9469
8 Ga0070680_100023753 3300005336 Bacteria 4893
9 Ga0070680_100176442 3300005336 Bacteria 1799
10 Ga0070680_100268355 3300005336 Bacteria 1445
11 Ga0068868_100030224 3300005338 Bacteria 4154
12 Ga0070660_100001920 3300005339 Bacteria 14322
13 Ga0070687_100129659 3300005343 Bacteria 1454
14 Ga0070661_100044248 3300005344 Bacteria 3253
15 Ga0070661_100077899 3300005344 Bacteria 2445
16 Ga0070668_100011671 3300005347 Bacteria 6540
17 Ga0070671_100070000 3300005355 Bacteria 2927
18 Ga0070688_100160355 3300005365 Unclassified 1545
19 Ga0070659_100058103 3300005366 Bacteria 3052
20 Ga0070703_10004573 3300005406 Bacteria 3886
21 Ga0070709_10215584 3300005434 Bacteria 1366
22 Ga0070714_100309100 3300005435 Bacteria 1475
23 Ga0070714_100570260 3300005435 Bacteria 1085
24 Ga0070713_100104205 3300005436 Bacteria 2462
25 Ga0070710_10288847 3300005437 Bacteria 1067
26 Ga0070710_10307497 3300005437 Bacteria 1036
27 Ga0070711_100012355 3300005439 Bacteria 5331
28 Ga0070711_100029826 3300005439 Bacteria 3604
29 Ga0070705_100008410 3300005440 Bacteria 5112
30 Ga0070694_100019034 3300005444 Bacteria 4363
31 Ga0070708_100024788 3300005445 Bacteria 5123
32 Ga0070708_100144365 3300005445 Bacteria 2209
33 Ga0070708_100272987 3300005445 Bacteria 1590
34 Ga0070662_100026086 3300005457 Bacteria 4044
35 Ga0070681_10044602 3300005458 Bacteria 4439
36 Ga0070681_10105782 3300005458 Bacteria 2756
37 Ga0070681_10365206 3300005458 Bacteria 1354
38 Ga0070706_100011458 3300005467 Bacteria 8241
39 Ga0070706_100097517 3300005467 Bacteria 2730
40 Ga0070707_100001094 3300005468 Bacteria 26790
41 Ga0070707_100136641 3300005468 Bacteria 2385
42 Ga0070698_100032557 3300005471 Bacteria 5399
43 Ga0070698_100034412 3300005471 Bacteria 5243
44 Ga0070698_100108518 3300005471 Bacteria 2742
45 Ga0070698_100763842 3300005471 Bacteria 910
46 Ga0070699_100023921 3300005518 Bacteria 5266
47 Ga0070699_100047749 3300005518 Bacteria 3704
48 Ga0070679_100006186 3300005530 Bacteria 11144
49 Ga0070679_100234596 3300005530 Bacteria 1794
50 Ga0070679_100435707 3300005530 Bacteria 1256
51 Ga0070684_100000907 3300005535 Bacteria 20969
52 Ga0070684_100030266 3300005535 Bacteria 4598
53 Ga0070684_100095810 3300005535 Bacteria 2645
54 Ga0070684_100249132 3300005535 Unclassified 1623
55 Ga0070684_100668070 3300005535 Unclassified 968
56 Ga0070697_100099445 3300005536 Bacteria 2415
57 Ga0070697_100758630 3300005536 Bacteria 857
58 Ga0068853_100129990 3300005539 Bacteria 2254
59 Ga0070686_100129011 3300005544 Bacteria 1746
60 Ga0070695_100065176 3300005545 Bacteria 2371
61 Ga0070695_100121803 3300005545 Unclassified 1786
62 Ga0070696_100088653 3300005546 Unclassified 2199
63 Ga0070693_100071711 3300005547 Bacteria 2042
64 Ga0070693_100183192 3300005547 Unclassified 1349
65 Ga0068855_100101393 3300005563 Bacteria 3314
66 Ga0068855_100117635 3300005563 Bacteria 3044
67 Ga0070664_100125389 3300005564 Bacteria 2252
68 Ga0068857_100201467 3300005577 Unclassified 1814
69 Ga0068856_100237837 3300005614 Unclassified 1837
70 Ga0068856_100327523 3300005614 Bacteria 1549
71 Ga0070702_100046962 3300005615 Unclassified 2450
72 Ga0070702_100084356 3300005615 Unclassified 1910
73 Ga0070702_100239370 3300005615 Bacteria 1224
74 Ga0068861_100005908 3300005719 Bacteria 8318
75 Ga0081455_10004052 3300005937 Bacteria 16607
76 Ga0081455_10012594 3300005937 Bacteria 8430
77 Ga0081455_10069270 3300005937 Bacteria 2934
78 Ga0081538_10000254 3300005981 Bacteria 60558
79 Ga0081538_10000820 3300005981 Bacteria 33705
80 Ga0081538_10005518 3300005981 Bacteria 11360
81 Ga0081539_10005141 3300005985 Bacteria 13634
82 Ga0070717_10020482 3300006028 Bacteria 5202
83 Ga0070717_10058282 3300006028 Bacteria 3193
84 Ga0075364_10361878 3300006051 Bacteria 989
85 Ga0070715_10012098 3300006163 Bacteria 3127
86 Ga0070715_10048120 3300006163 Unclassified 1821
87 Ga0070716_100028864 3300006173 Bacteria 2993
88 Ga0070716_100150943 3300006173 Bacteria 1494
89 Ga0070712_100068085 3300006175 Bacteria 2535
90 Ga0070712_100153687 3300006175 Bacteria 1769
91 Ga0075428_100557951 3300006844 Bacteria 1224
92 Ga0075431_100020022 3300006847 Bacteria 6832
93 Ga0075433_10005496 3300006852 Bacteria 9952
94 Ga0075434_100317492 3300006871 Bacteria 1578
95 Ga0075434_100352642 3300006871 Bacteria 1492
96 Ga0068865_100255805 3300006881 Unclassified 1384
97 Ga0075436_100090209 3300006914 Bacteria 2130
98 Ga0075436_100147165 3300006914 Bacteria 1656
99 Ga0105240_10092682 3300009093 Bacteria 3688
100 Ga0111539_10008138 3300009094 Bacteria 13357
101 Ga0111539_10072722 3300009094 Bacteria 4055
102 Ga0111539_10612025 3300009094 Bacteria 1269
103 Ga0105245_10172224 3300009098 Bacteria 2062
104 Ga0105245_10382849 3300009098 Unclassified 1401
105 Ga0105245_10448623 3300009098 Unclassified 1298
106 Ga0114129_10017324 3300009147 Bacteria 10256
107 Ga0114129_10017956 3300009147 Bacteria 10073
108 Ga0114129_10030984 3300009147 Bacteria 7564
109 Ga0114129_10180700 3300009147 Bacteria 2871
110 Ga0105243_10038925 3300009148 Bacteria 3705
111 Ga0105243_10085375 3300009148 Bacteria 2587
112 Ga0105243_10461354 3300009148 Bacteria 1194
113 Ga0105241_10066157 3300009174 Bacteria 2794
114 Ga0105241_10102154 3300009174 Bacteria 2281
115 Ga0105242_10452548 3300009176 Bacteria 1211
116 Ga0105242_10777096 3300009176 Bacteria 945
117 Ga0105237_10070666 3300009545 Bacteria 3487
118 Ga0105239_10174198 3300010375 Bacteria 2407
119 Ga0157370_10079961 3300013104 Bacteria 3078
120 Ga0157369_10006178 3300013105 Bacteria 13900
121 Ga0157369_10138838 3300013105 Bacteria 2572
122 Ga0163162_10257618 3300013306 Bacteria 1876
123 Ga0157372_10141731 3300013307 Bacteria 2770
124 Ga0163163_10517597 3300014325 Unclassified 1255
125 Ga0157380_10111037 3300014326 Bacteria 2304
126 Ga0157380_10461794 3300014326 Bacteria 1222
127 Ga0182008_10042077 3300014497 Bacteria 2276
128 Ga0157377_10209315 3300014745 Bacteria 1243
129 Ga0197907_10782359 3300020069 Bacteria 1257
130 Ga0206354_10953667 3300020081 Bacteria 1321
131 Ga0206353_10658428 3300020082 Bacteria 6321
132 Ga0207653_10000822 3300025885 Bacteria 10362
133 Ga0207692_10018561 3300025898 Bacteria 3125
134 Ga0207692_10092158 3300025898 Bacteria 1646
135 Ga0207688_10019580 3300025901 Bacteria 3689
136 Ga0207688_10223875 3300025901 Bacteria 1134
137 Ga0207685_10068183 3300025905 Unclassified 1433
138 Ga0207705_10084508 3300025909 Bacteria 2317
139 Ga0207705_10084968 3300025909 Bacteria 2311
140 Ga0207707_10013513 3300025912 Bacteria 7116
141 Ga0207707_10038664 3300025912 Bacteria 4169
142 Ga0207707_10146862 3300025912 Bacteria 2062
143 Ga0207695_10161338 3300025913 Bacteria 2173
144 Ga0207693_10000282 3300025915 Bacteria 47278
145 Ga0207693_10230691 3300025915 Unclassified 1454
146 Ga0207660_10007053 3300025917 Bacteria 7280
147 Ga0207660_10228762 3300025917 Bacteria 1462
148 Ga0207662_10144700 3300025918 Bacteria 1508
149 Ga0207657_10000388 3300025919 Bacteria 46370
150 Ga0207657_10034434 3300025919 Bacteria 4554
151 Ga0207649_10028452 3300025920 Bacteria 3290
152 Ga0207652_10095104 3300025921 Bacteria 2624
153 Ga0207646_10004038 3300025922 Bacteria 16215
154 Ga0207646_10087583 3300025922 Bacteria 2786
155 Ga0207646_10296149 3300025922 Bacteria 1462
156 Ga0207687_10057995 3300025927 Bacteria 2722
157 Ga0207700_10150686 3300025928 Bacteria 1921
158 Ga0207700_10243167 3300025928 Bacteria 1535
159 Ga0207664_10179707 3300025929 Bacteria 1816
160 Ga0207664_10339000 3300025929 Bacteria 1329
161 Ga0207664_10462658 3300025929 Bacteria 1133
162 Ga0207644_10110371 3300025931 Unclassified 2079
163 Ga0207644_10222519 3300025931 Bacteria 1497
164 Ga0207706_10045694 3300025933 Bacteria 3879
165 Ga0207706_10227009 3300025933 Bacteria 1634
166 Ga0207686_10324268 3300025934 Bacteria 1152
167 Ga0207709_10108899 3300025935 Bacteria 1848
168 Ga0207665_10005681 3300025939 Bacteria 8306
169 Ga0207665_10361150 3300025939 Unclassified 1098
170 Ga0207661_10009426 3300025944 Bacteria 7003
171 Ga0207661_10251160 3300025944 Bacteria 1572
172 Ga0207661_10314813 3300025944 Bacteria 1406
173 Ga0207679_10195246 3300025945 Bacteria 1686
174 Ga0207667_10125721 3300025949 Bacteria 2641
175 Ga0207667_10182069 3300025949 Bacteria 2158
176 Ga0207667_10249313 3300025949 Bacteria 1816
177 Ga0207677_10041757 3300026023 Bacteria 3035
178 Ga0207648_10201714 3300026089 Bacteria 1764
179 Ga0207648_10673006 3300026089 Bacteria 958
180 Ga0207674_10177219 3300026116 Bacteria 2084
181 Ga0207675_100000962 3300026118 Bacteria 28741
182 Ga0207683_10015060 3300026121 Bacteria 6582
183 Ga0207683_10258544 3300026121 Bacteria 1590
184 Ga0268265_10418756 3300028380 Bacteria 1243
185 Ga0307409_100085082 3300031995 Bacteria 2570
186 Ga0307416_100062066 3300032002 Bacteria 3054
187 Ga0307416_100188249 3300032002 Unclassified 1943
188 Ga0307416_100290272 3300032002 Bacteria 1619
189 Ga0373948_0011388 3300034817 Bacteria 1571
190 Ga0373958_0001547 3300034819 Unclassified 3109
191 Ga0373938_0000617 3300034957 Bacteria 5745
192 Ga0373928_0001387 3300035084 Bacteria 4722
193 Ga0373929_0001714 3300035085 Bacteria 4122
194 Ga0373940_0006142 3300035088 Bacteria 2645
195 Ga0373951_0002970 3300035091 Bacteria 4203
196 Ga0373932_0002326 3300035112 Bacteria 4830
197 Ga0373941_0004224 3300035115 Bacteria 3302
198 Ga0373945_0015762 3300035116 Bacteria 2546
199 Ga0373953_0108834 3300035117 Bacteria 1171
200 Ga0373960_0001596 3300035121 Bacteria 5064
201 Ga0373943_0001644 3300035170 Bacteria 10143
202 Ga0373943_0062973 3300035170 Bacteria 1858
203 Ga0373943_0073010 3300035170 Unclassified 1742
204 Ga0373962_0002699 3300035242 Bacteria 4225
205 Ga0373924_0106312 3300035410 Bacteria 1210
206 Ga0373935_0048880 3300035692 Bacteria 2680
207 Ga0373927_0013531 3300035695 Bacteria 5420
208 Ga0373927_0121342 3300035695 Bacteria 1706
209 Ga0373947_0000371 3300035725 Bacteria 25349
210 Ga0373937_0073306 3300036401 Bacteria 3158
211 Ga0373937_0128770 3300036401 Bacteria 2363
212 Ga0373925_0001462 3300037068 Bacteria 20386
213 Ga0373925_0068598 3300037068 Bacteria 2677
214 Ga0373925_0382427 3300037068 Unclassified 1146
215 Ga0395899_0011630 3300037312 Bacteria 6735
216 Ga0395899_0038417 3300037312 Bacteria 3585
217 Ga0395899_0072174 3300037312 Bacteria 2526
218 Ga0395899_0148311 3300037312 Bacteria 1664
219 Ga0395899_0276470 3300037312 Bacteria 1144
220 Ga0395899_0342165 3300037312 Bacteria 1003
221 Ga0395900_0001207 3300037418 Bacteria 31970
222 Ga0395900_0009094 3300037418 Bacteria 10180
223 Ga0395900_0012967 3300037418 Bacteria 8516
224 Ga0395900_0022774 3300037418 Bacteria 6410
225 Ga0395900_0025462 3300037418 Bacteria 6057
226 Ga0395900_0026624 3300037418 Bacteria 5921
227 Ga0395900_0062446 3300037418 Bacteria 3829
228 Ga0395900_0243980 3300037418 Bacteria 1801
229 Ga0395900_0395810 3300037418 Unclassified 1347
230 Ga0395900_0580233 3300037418 Unclassified 1063
231 Ga0395898_0008432 3300037466 Bacteria 10895
232 Ga0395898_0010371 3300037466 Bacteria 9744
233 Ga0395898_0016704 3300037466 Bacteria 7501
234 Ga0395898_0040647 3300037466 Bacteria 4597
235 Ga0395898_0042903 3300037466 Bacteria 4460
236 Ga0395898_0064016 3300037466 Bacteria 3567
237 Ga0395898_0095306 3300037466 Bacteria 2859
238 Ga0395898_0157298 3300037466 Unclassified 2174
239 Ga0395898_0471485 3300037466 Bacteria 1195
240 Ga0395898_0559336 3300037466 Bacteria 1086
241 Ga0395905_0002078 3300037471 Bacteria 22774
242 Ga0395905_0009228 3300037471 Bacteria 9656
243 Ga0395905_0017117 3300037471 Bacteria 6884
244 Ga0395905_0052744 3300037471 Bacteria 3807
245 Ga0395905_0123062 3300037471 Bacteria 2439
246 Ga0395905_0125000 3300037471 Bacteria 2419
247 Ga0395905_0266010 3300037471 Bacteria 1600
248 Ga0395905_0326911 3300037471 Bacteria 1423
249 Ga0395905_0332785 3300037471 Bacteria 1409
250 Ga0395901_0003858 3300038443 Bacteria 15084
251 Ga0395901_0010036 3300038443 Bacteria 9601
252 Ga0395901_0016074 3300038443 Bacteria 7626
253 Ga0395901_0016760 3300038443 Bacteria 7466
254 Ga0395901_0018320 3300038443 Bacteria 7149
255 Ga0395901_0026282 3300038443 Bacteria 5977
256 Ga0395901_0026829 3300038443 Bacteria 5914
257 Ga0395901_0027283 3300038443 Bacteria 5866
258 Ga0395901_0035743 3300038443 Bacteria 5133
259 Ga0395901_0038727 3300038443 Bacteria 4931
260 Ga0395901_0050076 3300038443 Bacteria 4341
261 Ga0395901_0100489 3300038443 Bacteria 3034
262 Ga0395901_0104547 3300038443 Bacteria 2972
263 Ga0395901_0153811 3300038443 Bacteria 2416
264 Ga0395901_0179324 3300038443 Bacteria 2222
265 Ga0395901_0298037 3300038443 Bacteria 1672
266 Ga0395901_0692799 3300038443 Bacteria 1017
267 Ga0436360_0995028 3300039438 Bacteria 12055
268 Ga0436362_1152412 3300039453 Bacteria 4084
269 Ga0439436_0036268 3300041404 Bacteria 1423
270 Ga0439461_0008318 3300041410 Bacteria 1856
271 Ga0439445_0006771 3300042004 Bacteria 2641
272 Ga0439462_0002233 3300042015 Bacteria 4470
273 Ga0450920_008453 3300042122 Bacteria 1881
274 Ga0439434_0002616 3300042435 Bacteria 5240
275 Ga0466969_0018054 3300044656 Bacteria 3680
276 Ga0466965_0035460 3300044683 Bacteria 2444
277 Ga0466965_0372107 3300044683 Bacteria 785
278 Ga0466966_0062202 3300044684 Bacteria 2354
279 Ga0466966_0127606 3300044684 Bacteria 1559
280 Ga0466961_0011516 3300044693 Bacteria 5656
281 Ga0466961_0043722 3300044693 Bacteria 2868
282 Ga0466963_0000102 3300044694 Bacteria 30465
283 Ga0466963_0006967 3300044694 Bacteria 6726
284 Ga0466963_0014787 3300044694 Bacteria 4818
285 Ga0466963_0035996 3300044694 Bacteria 3226
286 Ga0466963_0046479 3300044694 Bacteria 2862
287 Ga0466964_0017878 3300044706 Bacteria 2716
288 Ga0466964_0019921 3300044706 Bacteria 2581
289 Ga0466971_0010596 3300044719 Bacteria 4030
290 Ga0466971_0016144 3300044719 Bacteria 3289
291 Ga0466968_0004990 3300044735 Bacteria 4972
292 Ga0466968_0010554 3300044735 Bacteria 3584
293 Ga0466970_0009945 3300044765 Bacteria 4816
294 Ga0466957_0006273 3300044842 Bacteria 6708
295 Ga0466957_0054289 3300044842 Bacteria 2445
296 Ga0466957_0289810 3300044842 Bacteria 1097
297 Ga0466960_0135280 3300044901 Bacteria 1305
298 Ga0466959_0133402 3300045049 Bacteria 1759
299 Ga0466958_0002621 3300045836 Bacteria 9096
300 Ga0466958_0028253 3300045836 Bacteria 3325
301 Ga0466958_0057045 3300045836 Bacteria 2373
302 Ga0466967_0000094 3300045976 Bacteria 31562
303 Ga0466967_0001247 3300045976 Bacteria 14392
304 Ga0466967_0022779 3300045976 Bacteria 5120
305 Ga0466967_0035333 3300045976 Bacteria 4253
306 Ga0466967_0051504 3300045976 Bacteria 3608
307 Ga0466967_0067412 3300045976 Bacteria 3192
308 Ga0466967_0076955 3300045976 Bacteria 3002
309 Ga0466967_0092079 3300045976 Bacteria 2756
310 Ga0466967_0159269 3300045976 Bacteria 2117
311 Ga0466967_0161018 3300045976 Bacteria 2106
312 Ga0466967_0303553 3300045976 Bacteria 1536
313 Ga0495592_0063557 3300046454 Bacteria 2707
314 Ga0495603_0028096 3300046455 Bacteria 3393
315 Ga0495629_0012289 3300046459 Bacteria 6200
316 Ga0495629_0018985 3300046459 Bacteria 4917
317 Ga0495641_0003825 3300046461 Bacteria 10999
318 Ga0495651_0007432 3300046462 Bacteria 8379
319 Ga0495651_0009710 3300046462 Bacteria 7399
320 Ga0495651_0060816 3300046462 Bacteria 2892
321 Ga0495651_0085499 3300046462 Bacteria 2375
322 Ga0495653_0006673 3300046463 Bacteria 9471
323 Ga0495653_0073098 3300046463 Bacteria 2559
324 Ga0495653_0099394 3300046463 Bacteria 2111
325 Ga0495653_0213633 3300046463 Bacteria 1301
326 Ga0495580_0004702 3300046472 Bacteria 11446
327 Ga0495582_0003743 3300046473 Bacteria 8570
328 Ga0495639_0000481 3300046475 Bacteria 19003
329 Ga0495662_0072960 3300046476 Bacteria 1664
330 Ga0495664_0005759 3300046477 Bacteria 6821
331 Ga0495664_0155482 3300046477 Unclassified 1387
332 Ga0495608_0018058 3300046511 Bacteria 4873
333 Ga0495608_0244450 3300046511 Bacteria 1120
334 Ga0495618_0002744 3300046514 Bacteria 11198
335 Ga0495628_0019952 3300046516 Bacteria 5537
336 Ga0495628_0188033 3300046516 Bacteria 1560
337 Ga0495628_0444755 3300046516 Bacteria 942
338 Ga0495630_0000995 3300046517 Bacteria 19714
339 Ga0495630_0001315 3300046517 Bacteria 17081
340 Ga0495630_0082919 3300046517 Bacteria 2420
341 Ga0495630_0361766 3300046517 Bacteria 1111
342 Ga0495666_0000549 3300046526 Bacteria 16728
343 Ga0495652_0022850 3300046529 Bacteria 5548
344 Ga0495652_0046670 3300046529 Bacteria 3717
345 Ga0495652_0054710 3300046529 Bacteria 3397
346 Ga0495652_0416431 3300046529 Bacteria 948
347 Ga0495665_0001265 3300046531 Bacteria 13460
348 Ga0495640_0007169 3300046533 Bacteria 8779
349 Ga0495640_0016267 3300046533 Bacteria 5567
350 Ga0495640_0083890 3300046533 Bacteria 2114
351 Ga0495586_0024820 3300046535 Bacteria 3205
352 Ga0495587_0026929 3300046536 Bacteria 3502
353 Ga0495609_0050130 3300046538 Bacteria 1862
354 Ga0495645_0047593 3300046543 Bacteria 3124
355 Ga0495645_0060276 3300046543 Bacteria 2751
356 Ga0495645_0161155 3300046543 Bacteria 1551
357 Ga0495667_0006305 3300046559 Bacteria 8048
358 Ga0495656_0028346 3300046615 Bacteria 2246
359 Ga0495656_0057650 3300046615 Bacteria 1682
360 Ga0495656_0073923 3300046615 Bacteria 1521
361 Ga0495656_0228625 3300046615 Unclassified 933
362 Ga0495668_0240710 3300046616 Bacteria 991
363 Ga0495634_0004671 3300046642 Bacteria 10657
364 Ga0495634_0041168 3300046642 Bacteria 3138
365 Ga0495634_0078009 3300046642 Bacteria 2171
366 Ga0495635_0043935 3300046663 Bacteria 3082
367 Ga0495635_0045699 3300046663 Bacteria 3021
368 Ga0495635_0139883 3300046663 Bacteria 1649
369 Ga0495659_0016666 3300046664 Bacteria 2428
370 Ga0495657_0037692 3300046675 Bacteria 3330
371 Ga0495599_0071664 3300046678 Bacteria 2163
372 Ga0495623_0038014 3300046679 Bacteria 3078
373 Ga0495623_0124468 3300046679 Bacteria 1549
374 Ga0495646_0071900 3300046680 Bacteria 2035
375 Ga0495646_0078732 3300046680 Bacteria 1926
376 Ga0495646_0110407 3300046680 Unclassified 1567
377 Ga0495647_0000686 3300046681 Bacteria 10111
378 Ga0495647_0057986 3300046681 Bacteria 1521
379 Ga0495658_0019390 3300046683 Bacteria 3549
380 Ga0495658_0193717 3300046683 Bacteria 1265
381 Ga0495669_0126789 3300046684 Bacteria 1200
382 Ga0495613_0032934 3300046689 Bacteria 3850
383 Ga0495613_0048913 3300046689 Bacteria 3121
384 Ga0495624_0001215 3300046690 Bacteria 20309
385 Ga0495624_0049320 3300046690 Bacteria 2671
386 Ga0495581_0000299 3300047315 Bacteria 24150
387 Ga0495581_0002248 3300047315 Bacteria 10863
388 Ga0495674_0000604 3300047319 Bacteria 33665
389 Ga0495674_0032620 3300047319 Bacteria 4723
390 Ga0495674_0055798 3300047319 Bacteria 3463
391 Ga0495674_0110392 3300047319 Bacteria 2332
392 Ga0495676_0018113 3300047321 Bacteria 6212
393 Ga0495676_0025503 3300047321 Bacteria 5103
394 Ga0495676_0058214 3300047321 Bacteria 3041
395 Ga0495676_0126366 3300047321 Bacteria 1853
396 Ga0495676_0262307 3300047321 Unclassified 1175
397 Ga0495680_0001294 3300047322 Bacteria 27286
398 Ga0495680_0025327 3300047322 Bacteria 4912
399 Ga0495684_0003511 3300047471 Bacteria 12266
400 Ga0495684_0051972 3300047471 Bacteria 3126
401 Ga0495593_0002282 3300047673 Bacteria 11499
402 Ga0495602_0049332 3300048088 Bacteria 3771
403 Ga0495602_0230466 3300048088 Bacteria 1392
404 Ga0495614_0003952 3300048089 Bacteria 6653
405 Ga0496100_0010031 3300048903 Bacteria 5350
406 Ga0496101_0003189 3300048904 Bacteria 10166
407 Ga0496101_0008345 3300048904 Bacteria 6768
408 Ga0496101_0028790 3300048904 Bacteria 3882
409 Ga0496101_0145807 3300048904 Bacteria 1808
410 Ga0496101_0229347 3300048904 Bacteria 1443
411 Ga0496101_0237444 3300048904 Unclassified 1418
412 Ga0496101_0267895 3300048904 Bacteria 1333
413 Ga0496102_0115978 3300048905 Bacteria 2499
414 Ga0496102_0724319 3300048905 Unclassified 917
415 Ga0496103_0006215 3300048906 Bacteria 7136
416 Ga0496103_0062623 3300048906 Unclassified 2315
417 Ga0496103_0165922 3300048906 Bacteria 1417
418 Ga0496104_0005108 3300048907 Bacteria 11453
419 Ga0496104_0029649 3300048907 Bacteria 5076
420 Ga0496104_0034398 3300048907 Bacteria 4725
421 Ga0496104_0081675 3300048907 Bacteria 3082
422 Ga0496105_0010628 3300048908 Bacteria 7241
423 Ga0496105_0017229 3300048908 Bacteria 5787
424 Ga0496105_0037305 3300048908 Bacteria 4002
425 Ga0496105_0055166 3300048908 Bacteria 3281
426 Ga0496106_0046631 3300048909 Bacteria 3259
427 Ga0496107_0096438 3300048910 Bacteria 2164
428 Ga0496108_0002749 3300048911 Bacteria 14085
429 Ga0496108_0022135 3300048911 Bacteria 5226
430 Ga0496108_0035085 3300048911 Bacteria 4168
431 Ga0496108_0546618 3300048911 Bacteria 1010
432 Ga0496109_0003892 3300048912 Bacteria 12470
433 Ga0496109_0005622 3300048912 Bacteria 10487
434 Ga0496109_0229697 3300048912 Unclassified 1745
435 Ga0496110_0006563 3300048913 Bacteria 9237
436 Ga0496110_0118867 3300048913 Bacteria 2380
437 Ga0496110_0119992 3300048913 Bacteria 2368
438 Ga0496110_0148549 3300048913 Bacteria 2121
439 Ga0496110_0266278 3300048913 Archaea 1560
440 Ga0496111_0004710 3300048914 Bacteria 8653
441 Ga0496111_0055158 3300048914 Bacteria 2874
442 Ga0496111_0077244 3300048914 Bacteria 2427
443 Ga0496111_0107285 3300048914 Unclassified 2056
444 Ga0496111_0117922 3300048914 Bacteria 1959
445 Ga0496111_0123276 3300048914 Bacteria 1915
446 Ga0496111_0148998 3300048914 Bacteria 1735
447 Ga0496111_0246298 3300048914 Bacteria 1327
448 Ga0496112_0003099 3300048915 Bacteria 13632
449 Ga0496112_0031681 3300048915 Bacteria 5130
450 Ga0496112_0040576 3300048915 Bacteria 4551
451 Ga0496112_0053955 3300048915 Bacteria 3949
452 Ga0496112_0074491 3300048915 Bacteria 3356
453 Ga0496112_0076050 3300048915 Bacteria 3321
454 Ga0496113_0005096 3300048916 Bacteria 8162
455 Ga0496113_0243655 3300048916 Bacteria 1435
456 Ga0496113_0373901 3300048916 Bacteria 1144
457 Ga0496113_0485128 3300048916 Bacteria 993
458 Ga0496114_0026489 3300048917 Bacteria 4747
459 Ga0496114_0033298 3300048917 Bacteria 4245
460 Ga0496115_0010406 3300048918 Bacteria 6948
461 Ga0496115_0122568 3300048918 Bacteria 2140
462 Ga0496115_0154441 3300048918 Bacteria 1895
463 Ga0501040_0037742 3300049576 Bacteria 3283
464 Ga0501041_0295838 3300049577 Bacteria 1020
465 Ga0501047_0019893 3300049581 Bacteria 6444
466 Ga0501075_0126185 3300049591 Bacteria 1948
467 Ga0501076_0146214 3300049592 Bacteria 1922
468 Ga0501077_0009606 3300049593 Bacteria 6013
469 Ga0501081_0016243 3300049743 Bacteria 4920
470 Ga0501045_0144043 3300049824 Bacteria 1772
471 nmdc:mga0yw44_19545_c1 3300050492 Bacteria 3738
472 nmdc:mga05p37_243706_c1 3300050507 Bacteria 2160
473 nmdc:mga05p37_40030_c1 3300050507 Bacteria 5755
474 nmdc:mga05p37_69770_c1 3300050507 Bacteria 4323
475 nmdc:mga05p37_90666_c1 3300050507 Bacteria 3767
476 nmdc:mga0n895_258808_c1 3300050512 Bacteria 1766
477 nmdc:mga0n895_389581_c1 3300050512 Bacteria 1410
478 nmdc:mga0rr50_164196_c1 3300050513 Bacteria 1805
479 nmdc:mga0a205_45636_c1 3300050515 Bacteria 4226
480 nmdc:mga0a205_83309_c1 3300050515 Bacteria 3089
481 Ga0495601_0002963 3300053077 Bacteria 9657
482 Ga0495601_0030509 3300053077 Bacteria 3347
483 Ga0495601_0045951 3300053077 Bacteria 2748
484 Ga0495601_0047271 3300053077 Bacteria 2709
485 Ga0495601_0092972 3300053077 Bacteria 1942
486 Ga0495612_0007536 3300053078 Bacteria 4448
487 Ga0495595_0021571 3300053084 Bacteria 2815
488 Ga0495595_0075083 3300053084 Bacteria 1603
489 Ga0495619_0032727 3300053085 Bacteria 3374
490 Ga0495619_0036312 3300053085 Bacteria 3208
491 Ga0501084_0136436 3300054114 Bacteria 2065
492 Ga0501084_0166790 3300054114 Bacteria 1858
493 Ga0501084_0337525 3300054114 Bacteria 1273
494 Ga0501082_0008223 3300060353 Bacteria 8998
495 Ga0501082_0068482 3300060353 Bacteria 3056
496 Ga0466962_0003552 3300061719 Bacteria 7423
497 Ga0466962_0188885 3300061719 Bacteria 1005
498 Ga0496106_0412628
499 JGI25407J50210_10006209
500 Ga0070658_10006751
501 Ga0070658_10023673
502 Ga0070658_10074433
503 Ga0070676_10140208
504 Ga0070683_100007038
505 Ga0070680_100023753
506 Ga0070680_100176442
507 Ga0070680_100268355
508 Ga0068868_100030224
509 Ga0070660_100001920
510 Ga0070687_100129659
511 Ga0070661_100044248
512 Ga0070661_100077899
513 Ga0070668_100011671
514 Ga0070671_100070000
515 Ga0070688_100160355
516 Ga0070659_100058103
517 Ga0070703_10004573
518 Ga0070709_10215584
519 Ga0070714_100309100
520 Ga0070714_100570260
521 Ga0070713_100104205
522 Ga0070710_10288847
523 Ga0070710_10307497
524 Ga0070711_100012355
525 Ga0070711_100029826
526 Ga0070705_100008410
527 Ga0070694_100019034
528 Ga0070708_100024788
529 Ga0070708_100144365
530 Ga0070708_100272987
531 Ga0070662_100026086
532 Ga0070681_10044602
533 Ga0070681_10105782
534 Ga0070681_10365206
535 Ga0070706_100011458
536 Ga0070706_100097517
537 Ga0070707_100001094
538 Ga0070707_100136641
539 Ga0070698_100032557
540 Ga0070698_100034412
541 Ga0070698_100108518
542 Ga0070698_100763842
543 Ga0070699_100023921
544 Ga0070699_100047749
545 Ga0070679_100006186
546 Ga0070679_100234596
547 Ga0070679_100435707
548 Ga0070684_100000907
549 Ga0070684_100030266
550 Ga0070684_100095810
551 Ga0070684_100249132
552 Ga0070684_100668070
553 Ga0070697_100099445
554 Ga0070697_100758630
555 Ga0068853_100129990
556 Ga0070686_100129011
557 Ga0070695_100065176
558 Ga0070695_100121803
559 Ga0070696_100088653
560 Ga0070693_100071711
561 Ga0070693_100183192
562 Ga0068855_100101393
563 Ga0068855_100117635
564 Ga0070664_100125389
565 Ga0068857_100201467
566 Ga0068856_100237837
567 Ga0068856_100327523
568 Ga0070702_100046962
569 Ga0070702_100084356
570 Ga0070702_100239370
571 Ga0068861_100005908
572 Ga0081455_10004052
573 Ga0081455_10012594
574 Ga0081455_10069270
575 Ga0081538_10000254
576 Ga0081538_10000820
577 Ga0081538_10005518
578 Ga0081539_10005141
579 Ga0070717_10020482
580 Ga0070717_10058282
581 Ga0075364_10361878
582 Ga0070715_10012098
583 Ga0070715_10048120
584 Ga0070716_100028864
585 Ga0070716_100150943
586 Ga0070712_100068085
587 Ga0070712_100153687
588 Ga0075428_100557951
589 Ga0075431_100020022
590 Ga0075433_10005496
591 Ga0075434_100317492
592 Ga0075434_100352642
593 Ga0068865_100255805
594 Ga0075436_100090209
595 Ga0075436_100147165
596 Ga0105240_10092682
597 Ga0111539_10008138
598 Ga0111539_10072722
599 Ga0111539_10612025
600 Ga0105245_10172224
601 Ga0105245_10382849
602 Ga0105245_10448623
603 Ga0114129_10017324
604 Ga0114129_10017956
605 Ga0114129_10030984
606 Ga0114129_10180700
607 Ga0105243_10038925
608 Ga0105243_10085375
609 Ga0105243_10461354
610 Ga0105241_10066157
611 Ga0105241_10102154
612 Ga0105242_10452548
613 Ga0105242_10777096
614 Ga0105237_10070666
615 Ga0105239_10174198
616 Ga0157370_10079961
617 Ga0157369_10006178
618 Ga0157369_10138838
619 Ga0163162_10257618
620 Ga0157372_10141731
621 Ga0163163_10517597
622 Ga0157380_10111037
623 Ga0157380_10461794
624 Ga0182008_10042077
625 Ga0157377_10209315
626 Ga0197907_10782359
627 Ga0206354_10953667
628 Ga0206353_10658428
629 Ga0207653_10000822
630 Ga0207692_10018561
631 Ga0207692_10092158
632 Ga0207688_10019580
633 Ga0207688_10223875
634 Ga0207685_10068183
635 Ga0207705_10084508
636 Ga0207705_10084968
637 Ga0207707_10013513
638 Ga0207707_10038664
639 Ga0207707_10146862
640 Ga0207695_10161338
641 Ga0207693_10000282
642 Ga0207693_10230691
643 Ga0207660_10007053
644 Ga0207660_10228762
645 Ga0207662_10144700
646 Ga0207657_10000388
647 Ga0207657_10034434
648 Ga0207649_10028452
649 Ga0207652_10095104
650 Ga0207646_10004038
651 Ga0207646_10087583
652 Ga0207646_10296149
653 Ga0207687_10057995
654 Ga0207700_10150686
655 Ga0207700_10243167
656 Ga0207664_10179707
657 Ga0207664_10339000
658 Ga0207664_10462658
659 Ga0207644_10110371
660 Ga0207644_10222519
661 Ga0207706_10045694
662 Ga0207706_10227009
663 Ga0207686_10324268
664 Ga0207709_10108899
665 Ga0207665_10005681
666 Ga0207665_10361150
667 Ga0207661_10009426
668 Ga0207661_10251160
669 Ga0207661_10314813
670 Ga0207679_10195246
671 Ga0207667_10125721
672 Ga0207667_10182069
673 Ga0207667_10249313
674 Ga0207677_10041757
675 Ga0207648_10201714
676 Ga0207648_10673006
677 Ga0207674_10177219
678 Ga0207675_100000962
679 Ga0207683_10015060
680 Ga0207683_10258544
681 Ga0268265_10418756
682 Ga0307409_100085082
683 Ga0307416_100062066
684 Ga0307416_100188249
685 Ga0307416_100290272
686 Ga0373948_0011388
687 Ga0373958_0001547
688 Ga0373938_0000617
689 Ga0373928_0001387
690 Ga0373929_0001714
691 Ga0373940_0006142
692 Ga0373951_0002970
693 Ga0373932_0002326
694 Ga0373941_0004224
695 Ga0373945_0015762
696 Ga0373953_0108834
697 Ga0373960_0001596
698 Ga0373943_0001644
699 Ga0373943_0062973
700 Ga0373943_0073010
701 Ga0373962_0002699
702 Ga0373924_0106312
703 Ga0373935_0048880
704 Ga0373927_0013531
705 Ga0373927_0121342
706 Ga0373947_0000371
707 Ga0373937_0073306
708 Ga0373937_0128770
709 Ga0373925_0001462
710 Ga0373925_0068598
711 Ga0373925_0382427
712 Ga0395899_0011630
713 Ga0395899_0038417
714 Ga0395899_0072174
715 Ga0395899_0148311
716 Ga0395899_0276470
717 Ga0395899_0342165
718 Ga0395900_0001207
719 Ga0395900_0009094
720 Ga0395900_0012967
721 Ga0395900_0022774
722 Ga0395900_0025462
723 Ga0395900_0026624
724 Ga0395900_0062446
725 Ga0395900_0243980
726 Ga0395900_0395810
727 Ga0395900_0580233
728 Ga0395898_0008432
729 Ga0395898_0010371
730 Ga0395898_0016704
731 Ga0395898_0040647
732 Ga0395898_0042903
733 Ga0395898_0064016
734 Ga0395898_0095306
735 Ga0395898_0157298
736 Ga0395898_0471485
737 Ga0395898_0559336
738 Ga0395905_0002078
739 Ga0395905_0009228
740 Ga0395905_0017117
741 Ga0395905_0052744
742 Ga0395905_0123062
743 Ga0395905_0125000
744 Ga0395905_0266010
745 Ga0395905_0326911
746 Ga0395905_0332785
747 Ga0395901_0003858
748 Ga0395901_0010036
749 Ga0395901_0016074
750 Ga0395901_0016760
751 Ga0395901_0018320
752 Ga0395901_0026282
753 Ga0395901_0026829
754 Ga0395901_0027283
755 Ga0395901_0035743
756 Ga0395901_0038727
757 Ga0395901_0050076
758 Ga0395901_0100489
759 Ga0395901_0104547
760 Ga0395901_0153811
761 Ga0395901_0179324
762 Ga0395901_0298037
763 Ga0395901_0692799
764 Ga0436360_0995028
765 Ga0436362_1152412
766 Ga0439436_0036268
767 Ga0439461_0008318
768 Ga0439445_0006771
769 Ga0439462_0002233
770 Ga0450920_008453
771 Ga0439434_0002616
772 Ga0466969_0018054
773 Ga0466965_0035460
774 Ga0466965_0372107
775 Ga0466966_0062202
776 Ga0466966_0127606
777 Ga0466961_0011516
778 Ga0466961_0043722
779 Ga0466963_0000102
780 Ga0466963_0006967
781 Ga0466963_0014787
782 Ga0466963_0035996
783 Ga0466963_0046479
784 Ga0466964_0017878
785 Ga0466964_0019921
786 Ga0466971_0010596
787 Ga0466971_0016144
788 Ga0466968_0004990
789 Ga0466968_0010554
790 Ga0466970_0009945
791 Ga0466957_0006273
792 Ga0466957_0054289
793 Ga0466957_0289810
794 Ga0466960_0135280
795 Ga0466959_0133402
796 Ga0466958_0002621
797 Ga0466958_0028253
798 Ga0466958_0057045
799 Ga0466967_0000094
800 Ga0466967_0001247
801 Ga0466967_0022779
802 Ga0466967_0035333
803 Ga0466967_0051504
804 Ga0466967_0067412
805 Ga0466967_0076955
806 Ga0466967_0092079
807 Ga0466967_0159269
808 Ga0466967_0161018
809 Ga0466967_0303553
810 Ga0495592_0063557
811 Ga0495603_0028096
812 Ga0495629_0012289
813 Ga0495629_0018985
814 Ga0495641_0003825
815 Ga0495651_0007432
816 Ga0495651_0009710
817 Ga0495651_0060816
818 Ga0495651_0085499
819 Ga0495653_0006673
820 Ga0495653_0073098
821 Ga0495653_0099394
822 Ga0495653_0213633
823 Ga0495580_0004702
824 Ga0495582_0003743
825 Ga0495639_0000481
826 Ga0495662_0072960
827 Ga0495664_0005759
828 Ga0495664_0155482
829 Ga0495608_0018058
830 Ga0495608_0244450
831 Ga0495618_0002744
832 Ga0495628_0019952
833 Ga0495628_0188033
834 Ga0495628_0444755
835 Ga0495630_0000995
836 Ga0495630_0001315
837 Ga0495630_0082919
838 Ga0495630_0361766
839 Ga0495666_0000549
840 Ga0495652_0022850
841 Ga0495652_0046670
842 Ga0495652_0054710
843 Ga0495652_0416431
844 Ga0495665_0001265
845 Ga0495640_0007169
846 Ga0495640_0016267
847 Ga0495640_0083890
848 Ga0495586_0024820
849 Ga0495587_0026929
850 Ga0495609_0050130
851 Ga0495645_0047593
852 Ga0495645_0060276
853 Ga0495645_0161155
854 Ga0495667_0006305
855 Ga0495656_0028346
856 Ga0495656_0057650
857 Ga0495656_0073923
858 Ga0495656_0228625
859 Ga0495668_0240710
860 Ga0495634_0004671
861 Ga0495634_0041168
862 Ga0495634_0078009
863 Ga0495635_0043935
864 Ga0495635_0045699
865 Ga0495635_0139883
866 Ga0495659_0016666
867 Ga0495657_0037692
868 Ga0495599_0071664
869 Ga0495623_0038014
870 Ga0495623_0124468
871 Ga0495646_0071900
872 Ga0495646_0078732
873 Ga0495646_0110407
874 Ga0495647_0000686
875 Ga0495647_0057986
876 Ga0495658_0019390
877 Ga0495658_0193717
878 Ga0495669_0126789
879 Ga0495613_0032934
880 Ga0495613_0048913
881 Ga0495624_0001215
882 Ga0495624_0049320
883 Ga0495581_0000299
884 Ga0495581_0002248
885 Ga0495674_0000604
886 Ga0495674_0032620
887 Ga0495674_0055798
888 Ga0495674_0110392
889 Ga0495676_0018113
890 Ga0495676_0025503
891 Ga0495676_0058214
892 Ga0495676_0126366
893 Ga0495676_0262307
894 Ga0495680_0001294
895 Ga0495680_0025327
896 Ga0495684_0003511
897 Ga0495684_0051972
898 Ga0495593_0002282
899 Ga0495602_0049332
900 Ga0495602_0230466
901 Ga0495614_0003952
902 Ga0496100_0010031
903 Ga0496101_0003189
904 Ga0496101_0008345
905 Ga0496101_0028790
906 Ga0496101_0145807
907 Ga0496101_0229347
908 Ga0496101_0237444
909 Ga0496101_0267895
910 Ga0496102_0115978
911 Ga0496102_0724319
912 Ga0496103_0006215
913 Ga0496103_0062623
914 Ga0496103_0165922
915 Ga0496104_0005108
916 Ga0496104_0029649
917 Ga0496104_0034398
918 Ga0496104_0081675
919 Ga0496105_0010628
920 Ga0496105_0017229
921 Ga0496105_0037305
922 Ga0496105_0055166
923 Ga0496106_0046631
924 Ga0496107_0096438
925 Ga0496108_0002749
926 Ga0496108_0022135
927 Ga0496108_0035085
928 Ga0496108_0546618
929 Ga0496109_0003892
930 Ga0496109_0005622
931 Ga0496109_0229697
932 Ga0496110_0006563
933 Ga0496110_0118867
934 Ga0496110_0119992
935 Ga0496110_0148549
936 Ga0496110_0266278
937 Ga0496111_0004710
938 Ga0496111_0055158
939 Ga0496111_0077244
940 Ga0496111_0107285
941 Ga0496111_0117922
942 Ga0496111_0123276
943 Ga0496111_0148998
944 Ga0496111_0246298
945 Ga0496112_0003099
946 Ga0496112_0031681
947 Ga0496112_0040576
948 Ga0496112_0053955
949 Ga0496112_0074491
950 Ga0496112_0076050
951 Ga0496113_0005096
952 Ga0496113_0243655
953 Ga0496113_0373901
954 Ga0496113_0485128
955 Ga0496114_0026489
956 Ga0496114_0033298
957 Ga0496115_0010406
958 Ga0496115_0122568
959 Ga0496115_0154441
960 Ga0501040_0037742
961 Ga0501041_0295838
962 Ga0501047_0019893
963 Ga0501075_0126185
964 Ga0501076_0146214
965 Ga0501077_0009606
966 Ga0501081_0016243
967 Ga0501045_0144043
968 nmdc:mga0yw44_19545_c1
969 nmdc:mga05p37_243706_c1
970 nmdc:mga05p37_40030_c1
971 nmdc:mga05p37_69770_c1
972 nmdc:mga05p37_90666_c1
973 nmdc:mga0n895_258808_c1
974 nmdc:mga0n895_389581_c1
975 nmdc:mga0rr50_164196_c1
976 nmdc:mga0a205_45636_c1
977 nmdc:mga0a205_83309_c1
978 Ga0495601_0002963
979 Ga0495601_0030509
980 Ga0495601_0045951
981 Ga0495601_0047271
982 Ga0495601_0092972
983 Ga0495612_0007536
984 Ga0495595_0021571
985 Ga0495595_0075083
986 Ga0495619_0032727
987 Ga0495619_0036312
988 Ga0501084_0136436
989 Ga0501084_0166790
990 Ga0501084_0337525
991 Ga0501082_0008223
992 Ga0501082_0068482
993 Ga0466962_0003552
994 Ga0466962_0188885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

54

159

0.89

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

169

287

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9s-assembly1.cif.gz_B aathil complexed with amppcp 0.9062 1 254
1vqv-assembly1.cif.gz_B crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.9056 1 261
1vqv-assembly1.cif.gz_A crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.8809 1 261
6mfm-assembly1.cif.gz_A structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form 0.878 27 270
1vqv-assembly1.cif.gz_B crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.8645 1 261
ID Description Score Start End Superfamily
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8841 2 133 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8716 2 133 3.30.1330.10
af_Q60337_1_142_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8656 7 131 3.30.1330.10
af_P0AGG0_145_323_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.86 135 270 3.90.650.10
2yxzD01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8554 2 131 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A538BVZ3-F1-model_v4 Thiamine-monophosphate kinase 0.993 1 194 GO:0009030
GO:0009228
AF-A0A538D7W3-F1-model_v4 Thiamine-monophosphate kinase (TMP kinase) (Thiamine-phosphate kinase) (EC 2.7.4.16) 0.9881 1 273 GO:0000287
GO:0005524
GO:0009030
GO:0009228
GO:0009229
AF-A0A538KUP6-F1-model_v4 Thiamine-monophosphate kinase (TMP kinase) (Thiamine-phosphate kinase) (EC 2.7.4.16) 0.988 1 269 GO:0000287
GO:0005524
GO:0009030
GO:0009228
GO:0009229
AF-A0A537W4F2-F1-model_v4 Thiamine-phosphate kinase 0.9851 62 182 GO:0009030
GO:0009228
AF-A0A538D7W3-F1-model_v4 Thiamine-monophosphate kinase (TMP kinase) (Thiamine-phosphate kinase) (EC 2.7.4.16) 0.9845 1 273 GO:0000287
GO:0005524
GO:0009030
GO:0009228
GO:0009229

Map