F455012

General Info

Members Datasets Scaffolds Average Seq Length
497 268 994 150

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100067413|Ga0075428_1000674133
Length 155
Sequence MSTHVSSSDQPGEPRPLIPALARFYPKATDLAWALVRVTAGLMLIPHGWPKVGMGPTAVGTRVSQGMEPVIFWGALIIFLETIGGLLIAVGLFTRIVAALLFIQFLVIWKVHWPRGWSASVGGLEFVIMWGLLFLAIMLRGGGPYSLDRKLGWEV

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 3.22
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100067413 3300006844 Bacteria 3917
2 JGI25153J46596_10000272 3300003215 Bacteria 40790
3 Ga0070676_10151324 3300005328 Bacteria 1485
4 Ga0070676_11046509 3300005328 Bacteria 614
5 Ga0070690_100001618 3300005330 Bacteria 11837
6 Ga0070690_100021058 3300005330 Bacteria 3978
7 Ga0070690_100189845 3300005330 Bacteria 1424
8 Ga0070677_10105336 3300005333 Bacteria 1251
9 Ga0068869_100013472 3300005334 Bacteria 5439
10 Ga0068869_100015093 3300005334 Bacteria 5172
11 Ga0068869_100911436 3300005334 Bacteria 761
12 Ga0070680_100004609 3300005336 Bacteria 10359
13 Ga0070680_100061594 3300005336 Bacteria 3072
14 Ga0070680_100137933 3300005336 Bacteria 2044
15 Ga0070682_100005792 3300005337 Bacteria 6898
16 Ga0070689_100002362 3300005340 Bacteria 12295
17 Ga0070689_100027369 3300005340 Bacteria 4298
18 Ga0070689_100100939 3300005340 Bacteria 2284
19 Ga0070689_100112774 3300005340 Bacteria 2164
20 Ga0070691_10007252 3300005341 Bacteria 5074
21 Ga0070691_10328289 3300005341 Bacteria 844
22 Ga0070687_100010412 3300005343 Bacteria 4021
23 Ga0070692_10026749 3300005345 Bacteria 2854
24 Ga0070692_10044840 3300005345 Bacteria 2279
25 Ga0070692_10188629 3300005345 Bacteria 1199
26 Ga0070668_100385261 3300005347 Bacteria 1194
27 Ga0070669_100041153 3300005353 Bacteria 3360
28 Ga0070669_100194901 3300005353 Bacteria 1591
29 Ga0070675_100089547 3300005354 Bacteria 2577
30 Ga0070675_101044690 3300005354 Bacteria 751
31 Ga0070671_100135116 3300005355 Bacteria 2079
32 Ga0070673_100157511 3300005364 Bacteria 1929
33 Ga0070673_100294498 3300005364 Bacteria 1427
34 Ga0070673_100501780 3300005364 Bacteria 1098
35 Ga0070688_100039480 3300005365 Bacteria 2888
36 Ga0070688_100219689 3300005365 Bacteria 1339
37 Ga0070688_100269726 3300005365 Bacteria 1219
38 Ga0070703_10015567 3300005406 Bacteria 2178
39 Ga0070701_10001709 3300005438 Bacteria 8243
40 Ga0070701_10176103 3300005438 Bacteria 1249
41 Ga0070701_10317757 3300005438 Bacteria 963
42 Ga0070705_100001364 3300005440 Bacteria 13017
43 Ga0070705_100044281 3300005440 Bacteria 2556
44 Ga0070705_100351046 3300005440 Bacteria 1075
45 Ga0070700_100008143 3300005441 Bacteria 5701
46 Ga0070700_100129257 3300005441 Bacteria 1702
47 Ga0070700_100337726 3300005441 Bacteria 1112
48 Ga0070700_100902790 3300005441 Bacteria 719
49 Ga0070694_100008910 3300005444 Bacteria 6146
50 Ga0070694_100075971 3300005444 Unclassified 2325
51 Ga0070694_100247742 3300005444 Bacteria 1346
52 Ga0070694_100731765 3300005444 Bacteria 806
53 Ga0070694_100943009 3300005444 Bacteria 714
54 Ga0070708_100914709 3300005445 Bacteria 824
55 Ga0070678_100551657 3300005456 Unclassified 1023
56 Ga0070678_101859516 3300005456 Bacteria 568
57 Ga0070662_100603103 3300005457 Bacteria 924
58 Ga0070662_101231636 3300005457 Bacteria 644
59 Ga0070681_10001086 3300005458 Bacteria 23200
60 Ga0070681_10076692 3300005458 Bacteria 3301
61 Ga0070681_11540808 3300005458 Bacteria 590
62 Ga0068867_100006554 3300005459 Bacteria 8223
63 Ga0068867_100086382 3300005459 Bacteria 2373
64 Ga0068867_100148210 3300005459 Bacteria 1841
65 Ga0070698_100287223 3300005471 Bacteria 1576
66 Ga0070699_100003681 3300005518 Bacteria 13569
67 Ga0070699_100865186 3300005518 Bacteria 828
68 Ga0070699_101328010 3300005518 Bacteria 660
69 Ga0070679_100021155 3300005530 Bacteria 6347
70 Ga0070684_101351175 3300005535 Bacteria 671
71 Ga0068853_100212523 3300005539 Bacteria 1764
72 Ga0070672_101037166 3300005543 Bacteria 728
73 Ga0070672_101431025 3300005543 Unclassified 619
74 Ga0070686_100009623 3300005544 Bacteria 5434
75 Ga0070686_100435538 3300005544 Bacteria 1005
76 Ga0070686_100439417 3300005544 Bacteria 1000
77 Ga0070686_100590909 3300005544 Bacteria 874
78 Ga0070695_100003138 3300005545 Bacteria 9633
79 Ga0070695_100022553 3300005545 Bacteria 3862
80 Ga0070695_100950298 3300005545 Bacteria 697
81 Ga0070696_100006543 3300005546 Bacteria 7783
82 Ga0070696_100013237 3300005546 Bacteria 5535
83 Ga0070696_100014975 3300005546 Bacteria 5206
84 Ga0070696_100070542 3300005546 Bacteria 2458
85 Ga0070693_100001945 3300005547 Bacteria 9458
86 Ga0070704_100020586 3300005549 Bacteria 4257
87 Ga0070704_100749101 3300005549 Bacteria 870
88 Ga0068855_100001718 3300005563 Bacteria 27377
89 Ga0068857_100094942 3300005577 Bacteria 2671
90 Ga0068854_101343197 3300005578 Bacteria 645
91 Ga0068856_100029319 3300005614 Bacteria 5376
92 Ga0068856_100947150 3300005614 Bacteria 880
93 Ga0070702_100489628 3300005615 Bacteria 901
94 Ga0068852_100053560 3300005616 Bacteria 3474
95 Ga0068859_101771028 3300005617 Bacteria 682
96 Ga0068864_100089063 3300005618 Bacteria 2719
97 Ga0068864_100737402 3300005618 Bacteria 965
98 Ga0068866_10003077 3300005718 Bacteria 6880
99 Ga0068861_100014965 3300005719 Bacteria 5455
100 Ga0068861_100358261 3300005719 Bacteria 1282
101 Ga0068870_10009941 3300005840 Bacteria 4347
102 Ga0068870_10167691 3300005840 Bacteria 1308
103 Ga0068863_100664451 3300005841 Unclassified 1034
104 Ga0068858_100033433 3300005842 Bacteria 4772
105 Ga0068860_100025097 3300005843 Bacteria 5752
106 Ga0068860_101120337 3300005843 Bacteria 806
107 Ga0068862_100007827 3300005844 Bacteria 8840
108 Ga0068862_100035387 3300005844 Bacteria 4229
109 Ga0068862_100173220 3300005844 Bacteria 1933
110 Ga0068862_100391304 3300005844 Bacteria 1298
111 Ga0081539_10000539 3300005985 Bacteria 78266
112 Ga0075367_10166858 3300006178 Bacteria 1370
113 Ga0097621_100010860 3300006237 Bacteria 6682
114 Ga0097621_100022809 3300006237 Bacteria 4863
115 Ga0068871_100001893 3300006358 Bacteria 14164
116 Ga0075428_100003497 3300006844 Bacteria 17203
117 Ga0075428_100225261 3300006844 Bacteria 2024
118 Ga0075428_100443364 3300006844 Bacteria 1391
119 Ga0075428_100556940 3300006844 Bacteria 1225
120 Ga0075428_101038437 3300006844 Bacteria 867
121 Ga0075430_100026846 3300006846 Bacteria 4897
122 Ga0075430_100030093 3300006846 Bacteria 4610
123 Ga0075430_100042314 3300006846 Bacteria 3852
124 Ga0075430_100059313 3300006846 Bacteria 3217
125 Ga0075430_100304792 3300006846 Bacteria 1317
126 Ga0075430_100459612 3300006846 Bacteria 1050
127 Ga0075430_100564814 3300006846 Bacteria 938
128 Ga0075431_100000602 3300006847 Bacteria 30370
129 Ga0075431_100110114 3300006847 Bacteria 2842
130 Ga0075431_100493759 3300006847 Bacteria 1216
131 Ga0075431_100755058 3300006847 Unclassified 948
132 Ga0075431_100895015 3300006847 Bacteria 857
133 Ga0075433_10127965 3300006852 Bacteria 2256
134 Ga0075433_10153678 3300006852 Bacteria 2047
135 Ga0075433_11087133 3300006852 Bacteria 695
136 Ga0075434_100008377 3300006871 Bacteria 9610
137 Ga0075434_100202496 3300006871 Bacteria 2005
138 Ga0075434_100275858 3300006871 Bacteria 1701
139 Ga0075429_100006520 3300006880 Bacteria 10108
140 Ga0075429_100028541 3300006880 Bacteria 4845
141 Ga0075429_100058860 3300006880 Bacteria 3346
142 Ga0075429_100112297 3300006880 Bacteria 2382
143 Ga0068865_100012036 3300006881 Bacteria 5437
144 Ga0068865_100032166 3300006881 Bacteria 3502
145 Ga0068865_100775843 3300006881 Unclassified 825
146 Ga0075436_100000757 3300006914 Bacteria 21369
147 Ga0075436_100203457 3300006914 Bacteria 1402
148 Ga0097620_101771242 3300006931 Bacteria 682
149 Ga0075435_100004414 3300007076 Bacteria 9655
150 Ga0075435_100265704 3300007076 Bacteria 1463
151 Ga0075435_101019642 3300007076 Unclassified 723
152 Ga0099794_10006722 3300007265 Bacteria 4673
153 Ga0099795_10081880 3300007788 Bacteria 1236
154 Ga0111539_10000725 3300009094 Bacteria 42875
155 Ga0111539_10017474 3300009094 Bacteria 8880
156 Ga0111539_10021852 3300009094 Bacteria 7867
157 Ga0111539_10301655 3300009094 Bacteria 1864
158 Ga0111539_10734135 3300009094 Bacteria 1150
159 Ga0111539_11582067 3300009094 Unclassified 760
160 Ga0105245_10003254 3300009098 Bacteria 14565
161 Ga0105245_10809321 3300009098 Bacteria 975
162 Ga0114129_10000227 3300009147 Bacteria 62698
163 Ga0114129_10007276 3300009147 Bacteria 15756
164 Ga0114129_10014984 3300009147 Bacteria 11042
165 Ga0114129_10829359 3300009147 Bacteria 1177
166 Ga0105243_10001846 3300009148 Bacteria 18113
167 Ga0105243_10003261 3300009148 Bacteria 13210
168 Ga0105243_10070872 3300009148 Bacteria 2816
169 Ga0105243_10494342 3300009148 Bacteria 1158
170 Ga0105241_10023722 3300009174 Bacteria 4551
171 Ga0105242_10003078 3300009176 Bacteria 13014
172 Ga0105242_11721877 3300009176 Bacteria 663
173 Ga0105248_10122287 3300009177 Bacteria 2936
174 Ga0105248_11105394 3300009177 Unclassified 896
175 Ga0105249_10003380 3300009553 Bacteria 13816
176 Ga0105249_10030745 3300009553 Bacteria 4854
177 Ga0105249_11352220 3300009553 Bacteria 784
178 Ga0099796_10075592 3300010159 Bacteria 1225
179 Ga0105239_10342090 3300010375 Bacteria 1688
180 Ga0105246_10348701 3300011119 Bacteria 1212
181 Ga0105246_10424353 3300011119 Bacteria 1111
182 Ga0157378_10013506 3300013297 Bacteria 7142
183 Ga0157378_10262690 3300013297 Bacteria 1657
184 Ga0157378_11552339 3300013297 Bacteria 707
185 Ga0157375_10454384 3300013308 Bacteria 1447
186 Ga0157375_11354731 3300013308 Bacteria 837
187 Ga0163163_10954031 3300014325 Bacteria 921
188 Ga0157380_10042312 3300014326 Bacteria 3561
189 Ga0157380_10249650 3300014326 Bacteria 1605
190 Ga0157380_10383077 3300014326 Bacteria 1328
191 Ga0157380_10718449 3300014326 Bacteria 1006
192 Ga0157377_10079248 3300014745 Bacteria 1916
193 Ga0157379_10533638 3300014968 Bacteria 1090
194 Ga0157376_10159129 3300014969 Bacteria 2045
195 Ga0157376_10474975 3300014969 Bacteria 1224
196 Ga0163161_10186041 3300017792 Bacteria 1594
197 Ga0163161_10587018 3300017792 Bacteria 917
198 Ga0209758_1000638 3300025297 Bacteria 53416
199 Ga0207653_10004705 3300025885 Bacteria 4276
200 Ga0207682_10038343 3300025893 Bacteria 1944
201 Ga0207642_10004572 3300025899 Bacteria 4470
202 Ga0207642_10084510 3300025899 Bacteria 1550
203 Ga0207688_10030380 3300025901 Bacteria 2979
204 Ga0207680_10269137 3300025903 Bacteria 1181
205 Ga0207645_10111137 3300025907 Bacteria 1774
206 Ga0207645_10176539 3300025907 Bacteria 1401
207 Ga0207645_11155244 3300025907 Bacteria 521
208 Ga0207643_10013413 3300025908 Bacteria 4437
209 Ga0207643_10034672 3300025908 Bacteria 2828
210 Ga0207654_10146780 3300025911 Bacteria 1510
211 Ga0207707_10005436 3300025912 Bacteria 11138
212 Ga0207707_10115965 3300025912 Bacteria 2340
213 Ga0207660_10042244 3300025917 Bacteria 3199
214 Ga0207660_10074384 3300025917 Bacteria 2479
215 Ga0207660_10092685 3300025917 Bacteria 2243
216 Ga0207662_10000065 3300025918 Bacteria 46256
217 Ga0207662_10006431 3300025918 Bacteria 6340
218 Ga0207652_10022846 3300025921 Bacteria 5180
219 Ga0207681_10190664 3300025923 Bacteria 1568
220 Ga0207681_10896548 3300025923 Bacteria 742
221 Ga0207659_10776001 3300025926 Bacteria 823
222 Ga0207687_10009356 3300025927 Bacteria 6408
223 Ga0207644_10826054 3300025931 Bacteria 775
224 Ga0207686_10011069 3300025934 Bacteria 4928
225 Ga0207709_10001128 3300025935 Bacteria 19505
226 Ga0207709_10002501 3300025935 Bacteria 11504
227 Ga0207709_10362703 3300025935 Unclassified 1097
228 Ga0207670_10008782 3300025936 Bacteria 5723
229 Ga0207670_10023811 3300025936 Bacteria 3816
230 Ga0207670_10086957 3300025936 Bacteria 2201
231 Ga0207670_10351161 3300025936 Bacteria 1168
232 Ga0207670_10655471 3300025936 Unclassified 866
233 Ga0207669_10025125 3300025937 Bacteria 3213
234 Ga0207669_10410022 3300025937 Bacteria 1064
235 Ga0207704_10006157 3300025938 Bacteria 5568
236 Ga0207704_10020774 3300025938 Bacteria 3482
237 Ga0207704_10590940 3300025938 Unclassified 908
238 Ga0207665_10095164 3300025939 Bacteria 2069
239 Ga0207691_10294451 3300025940 Bacteria 1395
240 Ga0207711_10052567 3300025941 Bacteria 3492
241 Ga0207711_10095612 3300025941 Bacteria 2621
242 Ga0207689_10020558 3300025942 Bacteria 5554
243 Ga0207689_10035621 3300025942 Bacteria 4134
244 Ga0207689_10829057 3300025942 Unclassified 781
245 Ga0207651_10915598 3300025960 Bacteria 781
246 Ga0207712_10018061 3300025961 Bacteria 4588
247 Ga0207712_10023598 3300025961 Bacteria 4062
248 Ga0207668_10429782 3300025972 Bacteria 1123
249 Ga0207640_10005331 3300025981 Bacteria 7007
250 Ga0207703_10031440 3300026035 Bacteria 4197
251 Ga0207703_10242171 3300026035 Bacteria 1622
252 Ga0207708_10000961 3300026075 Bacteria 21578
253 Ga0207708_10006414 3300026075 Bacteria 8716
254 Ga0207708_10063009 3300026075 Bacteria 2833
255 Ga0207708_10170381 3300026075 Bacteria 1724
256 Ga0207708_10768734 3300026075 Bacteria 828
257 Ga0207702_10044468 3300026078 Bacteria 3733
258 Ga0207702_10073683 3300026078 Bacteria 2945
259 Ga0207641_10484340 3300026088 Bacteria 1199
260 Ga0207641_10583165 3300026088 Bacteria 1093
261 Ga0207648_10003835 3300026089 Bacteria 15703
262 Ga0207648_10010295 3300026089 Bacteria 8881
263 Ga0207648_11397117 3300026089 Unclassified 658
264 Ga0207676_10075112 3300026095 Bacteria 2725
265 Ga0207676_10434886 3300026095 Bacteria 1234
266 Ga0207675_100000558 3300026118 Bacteria 36410
267 Ga0207675_100016791 3300026118 Bacteria 6838
268 Ga0207675_100541645 3300026118 Bacteria 1162
269 Ga0207675_100563484 3300026118 Bacteria 1139
270 Ga0207683_10485457 3300026121 Unclassified 1140
271 Ga0209969_1001260 3300027360 Bacteria 3484
272 Ga0209996_1005951 3300027395 Unclassified 1568
273 Ga0210000_1002582 3300027462 Bacteria 2583
274 Ga0209995_1003280 3300027471 Bacteria 2578
275 Ga0209179_1009071 3300027512 Bacteria 1695
276 Ga0209999_1005708 3300027543 Bacteria 2239
277 Ga0209588_1004390 3300027671 Bacteria 3973
278 Ga0209971_1013168 3300027682 Bacteria 1960
279 Ga0209966_1067144 3300027695 Bacteria 781
280 Ga0207428_10005218 3300027907 Bacteria 12141
281 Ga0207428_10021550 3300027907 Bacteria 5455
282 Ga0207428_10187007 3300027907 Bacteria 1562
283 Ga0207428_10271955 3300027907 Bacteria 1259
284 Ga0207428_10339553 3300027907 Bacteria 1107
285 Ga0268265_10021621 3300028380 Bacteria 4509
286 Ga0268265_10023502 3300028380 Bacteria 4345
287 Ga0268265_10361420 3300028380 Bacteria 1329
288 Ga0307408_102060079 3300031548 Bacteria 549
289 Ga0307408_102310492 3300031548 Bacteria 521
290 Ga0307407_10675354 3300031903 Bacteria 776
291 Ga0307412_10242192 3300031911 Bacteria 1396
292 Ga0307409_101302100 3300031995 Bacteria 752
293 Ga0307416_100026919 3300032002 Bacteria 4247
294 Ga0307416_100858359 3300032002 Bacteria 1006
295 Ga0307411_10671065 3300032005 Bacteria 900
296 Ga0373930_0036022 3300034816 Bacteria 1037
297 Ga0373948_0096271 3300034817 Unclassified 692
298 Ga0373958_0054397 3300034819 Bacteria 853
299 Ga0373958_0074346 3300034819 Bacteria 759
300 Ga0373938_0025150 3300034957 Bacteria 1237
301 Ga0373926_0137199 3300035083 Bacteria 928
302 Ga0373926_0200725 3300035083 Bacteria 767
303 Ga0373928_0044296 3300035084 Bacteria 1032
304 Ga0373944_0043172 3300035089 Bacteria 1400
305 Ga0373951_0177198 3300035091 Bacteria 611
306 Ga0373952_0075738 3300035092 Bacteria 850
307 Ga0373923_0088904 3300035111 Bacteria 1349
308 Ga0373932_0028138 3300035112 Bacteria 1543
309 Ga0373932_0282481 3300035112 Bacteria 614
310 Ga0373936_0002778 3300035113 Bacteria 6525
311 Ga0373936_0013677 3300035113 Bacteria 3096
312 Ga0373939_0143696 3300035114 Bacteria 862
313 Ga0373941_0176393 3300035115 Bacteria 799
314 Ga0373945_0064970 3300035116 Bacteria 1369
315 Ga0373954_0000032 3300035118 Bacteria 54647
316 Ga0373960_0094031 3300035121 Bacteria 962
317 Ga0373943_0000430 3300035170 Bacteria 17741
318 Ga0373943_0001101 3300035170 Bacteria 12059
319 Ga0373946_0006111 3300035171 Bacteria 4361
320 Ga0373955_0207407 3300035172 Bacteria 1168
321 Ga0373961_0012139 3300035241 Bacteria 2151
322 Ga0373962_0102944 3300035242 Unclassified 893
323 Ga0373931_0006619 3300035691 Bacteria 5425
324 Ga0373931_0010385 3300035691 Bacteria 4475
325 Ga0373931_0126278 3300035691 Bacteria 1467
326 Ga0373931_0188908 3300035691 Bacteria 1224
327 Ga0373931_0461897 3300035691 Bacteria 813
328 Ga0373931_0774015 3300035691 Unclassified 638
329 Ga0373935_0020892 3300035692 Bacteria 4005
330 Ga0373927_0041679 3300035695 Bacteria 2977
331 Ga0373927_0280305 3300035695 Bacteria 1096
332 Ga0373933_0034797 3300035724 Bacteria 2938
333 Ga0373947_0000445 3300035725 Bacteria 23493
334 Ga0373947_0034744 3300035725 Bacteria 2982
335 Ga0373937_0000633 3300036401 Bacteria 30781
336 Ga0373937_0679794 3300036401 Bacteria 975
337 Ga0373937_0910258 3300036401 Unclassified 828
338 Ga0373925_0001425 3300037068 Bacteria 20711
339 Ga0373925_0185348 3300037068 Bacteria 1649
340 Ga0451807_0986236 3300041486 Bacteria 965
341 Ga0451835_0899282 3300041492 Unclassified 758
342 Ga0451853_3937487 3300041512 Unclassified 506
343 Ga0439443_026337 3300042003 Bacteria 941
344 Ga0439435_0005031 3300042436 Bacteria 2883
345 Ga0439444_0049208 3300042437 Bacteria 852
346 Ga0439464_0019938 3300042439 Bacteria 1833
347 Ga0439460_0186508 3300042461 Bacteria 702
348 Ga0451577_0176268 3300042876 Bacteria 1927
349 Ga0439440_0271647 3300042993 Bacteria 521
350 Ga0451576_0000675 3300045051 Bacteria 69506
351 Ga0451576_0018399 3300045051 Bacteria 7659
352 Ga0451576_0070338 3300045051 Bacteria 3642
353 Ga0451576_0505599 3300045051 Bacteria 1269
354 Ga0451576_0603133 3300045051 Bacteria 1154
355 Ga0451576_0648379 3300045051 Unclassified 1109
356 Ga0495592_0000919 3300046454 Bacteria 20403
357 Ga0495641_0138445 3300046461 Bacteria 1087
358 Ga0495580_0049044 3300046472 Bacteria 2987
359 Ga0495582_0118077 3300046473 Bacteria 1493
360 Ga0495639_0521337 3300046475 Unclassified 608
361 Ga0495662_0031981 3300046476 Bacteria 2541
362 Ga0495662_0036129 3300046476 Bacteria 2385
363 Ga0495584_0469840 3300046491 Bacteria 640
364 Ga0495594_0291387 3300046499 Bacteria 930
365 Ga0495628_0118116 3300046516 Bacteria 2036
366 Ga0495628_0226639 3300046516 Bacteria 1402
367 Ga0495628_0881304 3300046516 Bacteria 622
368 Ga0495630_0276073 3300046517 Bacteria 1284
369 Ga0495630_0507693 3300046517 Bacteria 924
370 Ga0495644_0140620 3300046523 Bacteria 922
371 Ga0495644_0155606 3300046523 Bacteria 876
372 Ga0495666_0037108 3300046526 Bacteria 2371
373 Ga0495666_0046768 3300046526 Bacteria 2085
374 Ga0495642_0217068 3300046528 Bacteria 835
375 Ga0495642_0333385 3300046528 Bacteria 666
376 Ga0495640_0001911 3300046533 Bacteria 16609
377 Ga0495640_0347298 3300046533 Bacteria 916
378 Ga0495586_0000811 3300046535 Bacteria 17980
379 Ga0495587_0130951 3300046536 Bacteria 1433
380 Ga0495598_0178907 3300046537 Bacteria 756
381 Ga0495621_0198355 3300046539 Bacteria 807
382 Ga0495621_0238105 3300046539 Bacteria 741
383 Ga0495656_0362159 3300046615 Bacteria 753
384 Ga0495634_0001580 3300046642 Bacteria 20009
385 Ga0495635_0052478 3300046663 Bacteria 2809
386 Ga0495635_0289344 3300046663 Unclassified 1100
387 Ga0495657_0381441 3300046675 Unclassified 831
388 Ga0495647_0015194 3300046681 Bacteria 2694
389 Ga0495658_0019475 3300046683 Bacteria 3543
390 Ga0495613_0036702 3300046689 Bacteria 3634
391 Ga0495624_0443869 3300046690 Bacteria 777
392 Ga0495624_0598265 3300046690 Bacteria 657
393 Ga0495581_0212439 3300047315 Bacteria 1131
394 Ga0495604_0525295 3300047317 Bacteria 765
395 Ga0495636_0011018 3300047318 Bacteria 3578
396 Ga0495636_0022593 3300047318 Bacteria 2544
397 Ga0495674_0297780 3300047319 Bacteria 1318
398 Ga0495676_0107798 3300047321 Bacteria 2050
399 Ga0495680_0010222 3300047322 Bacteria 8378
400 Ga0495685_222530 3300047447 Unclassified 602
401 Ga0495684_0405906 3300047471 Bacteria 955
402 Ga0495593_0473953 3300047673 Bacteria 627
403 Ga0496100_0064135 3300048903 Bacteria 2430
404 Ga0496101_0016385 3300048904 Bacteria 5007
405 Ga0496102_0344118 3300048905 Bacteria 1404
406 Ga0496104_0071489 3300048907 Bacteria 3299
407 Ga0496105_0034250 3300048908 Bacteria 4176
408 Ga0496106_0172492 3300048909 Bacteria 1715
409 Ga0496109_0460563 3300048912 Bacteria 1201
410 Ga0496111_0052800 3300048914 Bacteria 2936
411 Ga0496111_0607906 3300048914 Bacteria 800
412 Ga0496111_0740617 3300048914 Bacteria 713
413 Ga0496112_0172384 3300048915 Bacteria 2129
414 Ga0496112_0346761 3300048915 Bacteria 1428
415 Ga0496115_0054708 3300048918 Bacteria 3205
416 Ga0496115_0154686 3300048918 Bacteria 1894
417 Ga0496115_0420602 3300048918 Bacteria 1082
418 Ga0501033_0154875 3300049570 Bacteria 1652
419 Ga0501036_0206334 3300049572 Bacteria 1652
420 Ga0501037_0528147 3300049573 Bacteria 798
421 Ga0501038_0120919 3300049574 Bacteria 2160
422 Ga0501038_0176040 3300049574 Unclassified 1729
423 Ga0501039_0781014 3300049575 Bacteria 745
424 Ga0501040_0040747 3300049576 Bacteria 3161
425 Ga0501040_0051126 3300049576 Bacteria 2828
426 Ga0501040_0525143 3300049576 Bacteria 854
427 Ga0501041_0004237 3300049577 Bacteria 8304
428 Ga0501042_0056784 3300049578 Bacteria 2793
429 Ga0501043_0857726 3300049579 Bacteria 654
430 Ga0501048_0031207 3300049582 Bacteria 3855
431 Ga0501048_0538518 3300049582 Bacteria 838
432 Ga0501048_0599102 3300049582 Bacteria 791
433 Ga0501072_0018851 3300049588 Bacteria 5323
434 Ga0501072_0313077 3300049588 Bacteria 1248
435 Ga0501074_0298209 3300049590 Bacteria 1145
436 Ga0501075_0005022 3300049591 Bacteria 9033
437 Ga0501076_0024169 3300049592 Bacteria 4693
438 Ga0501076_0138432 3300049592 Bacteria 1977
439 Ga0501077_0574620 3300049593 Bacteria 724
440 Ga0501079_0001948 3300049741 Bacteria 14782
441 Ga0501080_0020031 3300049742 Bacteria 6191
442 Ga0501081_0007214 3300049743 Bacteria 7227
443 Ga0501035_0279584 3300049822 Bacteria 1411
444 Ga0501045_0003071 3300049824 Bacteria 11423
445 nmdc:mga03683_95374_c1 3300050489 Bacteria 1302
446 nmdc:mga0k408_21767_c1 3300050493 Bacteria 3605
447 nmdc:mga06z11_134017_c1 3300050494 Bacteria 1394
448 nmdc:mga06z11_228798_c1 3300050494 Bacteria 1089
449 nmdc:mga07m45_304739_c1 3300050496 Bacteria 926
450 nmdc:mga07m45_72740_c1 3300050496 Bacteria 1957
451 nmdc:mga05p37_110705_c1 3300050507 Bacteria 3378
452 nmdc:mga05p37_221183_c1 3300050507 Bacteria 2285
453 nmdc:mga05p37_4078_c1 3300050507 Bacteria 17069
454 nmdc:mga05p37_76_c1 3300050507 Bacteria 86726
455 nmdc:mga09592_21291_c1 3300050508 Bacteria 5344
456 nmdc:mga09592_213771_c1 3300050508 Bacteria 1671
457 nmdc:mga09592_38662_c1 3300050508 Bacteria 4006
458 nmdc:mga09592_779621_c1 3300050508 Bacteria 810
459 nmdc:mga09592_844432_c1 3300050508 Bacteria 773
460 nmdc:mga0qj67_10287_c1 3300050509 Bacteria 6986
461 nmdc:mga0qj67_1120639_c1 3300050509 Unclassified 614
462 nmdc:mga0qj67_2151_c1 3300050509 Bacteria 14006
463 nmdc:mga0qj67_3805_c1 3300050509 Bacteria 10900
464 nmdc:mga0qj67_405325_c1 3300050509 Bacteria 1100
465 nmdc:mga0qj67_497125_c1 3300050509 Bacteria 981
466 nmdc:mga0qj67_683026_c1 3300050509 Bacteria 818
467 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
468 nmdc:mga06r32_14486_c1 3300050510 Bacteria 7156
469 nmdc:mga06r32_384685_c1 3300050510 Bacteria 1386
470 nmdc:mga06r32_701173_c1 3300050510 Unclassified 978
471 nmdc:mga08y16_1005365_c1 3300050511 Bacteria 814
472 nmdc:mga08y16_14440_c1 3300050511 Bacteria 8307
473 nmdc:mga08y16_503943_c1 3300050511 Unclassified 1230
474 nmdc:mga08y16_743652_c1 3300050511 Bacteria 977
475 nmdc:mga08y16_961_c1 3300050511 Bacteria 28000
476 nmdc:mga0n895_162236_c1 3300050512 Bacteria 2267
477 nmdc:mga0n895_272981_c1 3300050512 Bacteria 1715
478 nmdc:mga0n895_565796_c1 3300050512 Unclassified 1142
479 nmdc:mga0n895_647701_c1 3300050512 Bacteria 1056
480 nmdc:mga0n895_6604_c1 3300050512 Bacteria 9873
481 nmdc:mga0rr50_1204331_c1 3300050513 Bacteria 643
482 nmdc:mga0rr50_14899_c1 3300050513 Bacteria 5117
483 nmdc:mga0rr50_16983_c1 3300050513 Bacteria 4848
484 nmdc:mga0rr50_812134_c1 3300050513 Bacteria 798
485 nmdc:mga08x19_3842_c1 3300050514 Bacteria 8936
486 nmdc:mga08x19_91124_c1 3300050514 Bacteria 2012
487 nmdc:mga0a205_274523_c1 3300050515 Bacteria 1562
488 nmdc:mga0a205_387992_c1 3300050515 Bacteria 1261
489 Ga0495601_0053997 3300053077 Bacteria 2541
490 Ga0495612_0267331 3300053078 Bacteria 763
491 Ga0495595_0092529 3300053084 Bacteria 1452
492 Ga0495595_0342594 3300053084 Bacteria 754
493 Ga0500616_0060431 3300053153 Bacteria 1965
494 Ga0501084_0004093 3300054114 Bacteria 11875
495 Ga0501082_0027661 3300060353 Bacteria 4880
496 Ga0501082_0555099 3300060353 Bacteria 1005
497 Ga0530510_0003945 3300061734 Bacteria 10230
498 Ga0075428_100067413
499 JGI25153J46596_10000272
500 Ga0070676_10151324
501 Ga0070676_11046509
502 Ga0070690_100001618
503 Ga0070690_100021058
504 Ga0070690_100189845
505 Ga0070677_10105336
506 Ga0068869_100013472
507 Ga0068869_100015093
508 Ga0068869_100911436
509 Ga0070680_100004609
510 Ga0070680_100061594
511 Ga0070680_100137933
512 Ga0070682_100005792
513 Ga0070689_100002362
514 Ga0070689_100027369
515 Ga0070689_100100939
516 Ga0070689_100112774
517 Ga0070691_10007252
518 Ga0070691_10328289
519 Ga0070687_100010412
520 Ga0070692_10026749
521 Ga0070692_10044840
522 Ga0070692_10188629
523 Ga0070668_100385261
524 Ga0070669_100041153
525 Ga0070669_100194901
526 Ga0070675_100089547
527 Ga0070675_101044690
528 Ga0070671_100135116
529 Ga0070673_100157511
530 Ga0070673_100294498
531 Ga0070673_100501780
532 Ga0070688_100039480
533 Ga0070688_100219689
534 Ga0070688_100269726
535 Ga0070703_10015567
536 Ga0070701_10001709
537 Ga0070701_10176103
538 Ga0070701_10317757
539 Ga0070705_100001364
540 Ga0070705_100044281
541 Ga0070705_100351046
542 Ga0070700_100008143
543 Ga0070700_100129257
544 Ga0070700_100337726
545 Ga0070700_100902790
546 Ga0070694_100008910
547 Ga0070694_100075971
548 Ga0070694_100247742
549 Ga0070694_100731765
550 Ga0070694_100943009
551 Ga0070708_100914709
552 Ga0070678_100551657
553 Ga0070678_101859516
554 Ga0070662_100603103
555 Ga0070662_101231636
556 Ga0070681_10001086
557 Ga0070681_10076692
558 Ga0070681_11540808
559 Ga0068867_100006554
560 Ga0068867_100086382
561 Ga0068867_100148210
562 Ga0070698_100287223
563 Ga0070699_100003681
564 Ga0070699_100865186
565 Ga0070699_101328010
566 Ga0070679_100021155
567 Ga0070684_101351175
568 Ga0068853_100212523
569 Ga0070672_101037166
570 Ga0070672_101431025
571 Ga0070686_100009623
572 Ga0070686_100435538
573 Ga0070686_100439417
574 Ga0070686_100590909
575 Ga0070695_100003138
576 Ga0070695_100022553
577 Ga0070695_100950298
578 Ga0070696_100006543
579 Ga0070696_100013237
580 Ga0070696_100014975
581 Ga0070696_100070542
582 Ga0070693_100001945
583 Ga0070704_100020586
584 Ga0070704_100749101
585 Ga0068855_100001718
586 Ga0068857_100094942
587 Ga0068854_101343197
588 Ga0068856_100029319
589 Ga0068856_100947150
590 Ga0070702_100489628
591 Ga0068852_100053560
592 Ga0068859_101771028
593 Ga0068864_100089063
594 Ga0068864_100737402
595 Ga0068866_10003077
596 Ga0068861_100014965
597 Ga0068861_100358261
598 Ga0068870_10009941
599 Ga0068870_10167691
600 Ga0068863_100664451
601 Ga0068858_100033433
602 Ga0068860_100025097
603 Ga0068860_101120337
604 Ga0068862_100007827
605 Ga0068862_100035387
606 Ga0068862_100173220
607 Ga0068862_100391304
608 Ga0081539_10000539
609 Ga0075367_10166858
610 Ga0097621_100010860
611 Ga0097621_100022809
612 Ga0068871_100001893
613 Ga0075428_100003497
614 Ga0075428_100225261
615 Ga0075428_100443364
616 Ga0075428_100556940
617 Ga0075428_101038437
618 Ga0075430_100026846
619 Ga0075430_100030093
620 Ga0075430_100042314
621 Ga0075430_100059313
622 Ga0075430_100304792
623 Ga0075430_100459612
624 Ga0075430_100564814
625 Ga0075431_100000602
626 Ga0075431_100110114
627 Ga0075431_100493759
628 Ga0075431_100755058
629 Ga0075431_100895015
630 Ga0075433_10127965
631 Ga0075433_10153678
632 Ga0075433_11087133
633 Ga0075434_100008377
634 Ga0075434_100202496
635 Ga0075434_100275858
636 Ga0075429_100006520
637 Ga0075429_100028541
638 Ga0075429_100058860
639 Ga0075429_100112297
640 Ga0068865_100012036
641 Ga0068865_100032166
642 Ga0068865_100775843
643 Ga0075436_100000757
644 Ga0075436_100203457
645 Ga0097620_101771242
646 Ga0075435_100004414
647 Ga0075435_100265704
648 Ga0075435_101019642
649 Ga0099794_10006722
650 Ga0099795_10081880
651 Ga0111539_10000725
652 Ga0111539_10017474
653 Ga0111539_10021852
654 Ga0111539_10301655
655 Ga0111539_10734135
656 Ga0111539_11582067
657 Ga0105245_10003254
658 Ga0105245_10809321
659 Ga0114129_10000227
660 Ga0114129_10007276
661 Ga0114129_10014984
662 Ga0114129_10829359
663 Ga0105243_10001846
664 Ga0105243_10003261
665 Ga0105243_10070872
666 Ga0105243_10494342
667 Ga0105241_10023722
668 Ga0105242_10003078
669 Ga0105242_11721877
670 Ga0105248_10122287
671 Ga0105248_11105394
672 Ga0105249_10003380
673 Ga0105249_10030745
674 Ga0105249_11352220
675 Ga0099796_10075592
676 Ga0105239_10342090
677 Ga0105246_10348701
678 Ga0105246_10424353
679 Ga0157378_10013506
680 Ga0157378_10262690
681 Ga0157378_11552339
682 Ga0157375_10454384
683 Ga0157375_11354731
684 Ga0163163_10954031
685 Ga0157380_10042312
686 Ga0157380_10249650
687 Ga0157380_10383077
688 Ga0157380_10718449
689 Ga0157377_10079248
690 Ga0157379_10533638
691 Ga0157376_10159129
692 Ga0157376_10474975
693 Ga0163161_10186041
694 Ga0163161_10587018
695 Ga0209758_1000638
696 Ga0207653_10004705
697 Ga0207682_10038343
698 Ga0207642_10004572
699 Ga0207642_10084510
700 Ga0207688_10030380
701 Ga0207680_10269137
702 Ga0207645_10111137
703 Ga0207645_10176539
704 Ga0207645_11155244
705 Ga0207643_10013413
706 Ga0207643_10034672
707 Ga0207654_10146780
708 Ga0207707_10005436
709 Ga0207707_10115965
710 Ga0207660_10042244
711 Ga0207660_10074384
712 Ga0207660_10092685
713 Ga0207662_10000065
714 Ga0207662_10006431
715 Ga0207652_10022846
716 Ga0207681_10190664
717 Ga0207681_10896548
718 Ga0207659_10776001
719 Ga0207687_10009356
720 Ga0207644_10826054
721 Ga0207686_10011069
722 Ga0207709_10001128
723 Ga0207709_10002501
724 Ga0207709_10362703
725 Ga0207670_10008782
726 Ga0207670_10023811
727 Ga0207670_10086957
728 Ga0207670_10351161
729 Ga0207670_10655471
730 Ga0207669_10025125
731 Ga0207669_10410022
732 Ga0207704_10006157
733 Ga0207704_10020774
734 Ga0207704_10590940
735 Ga0207665_10095164
736 Ga0207691_10294451
737 Ga0207711_10052567
738 Ga0207711_10095612
739 Ga0207689_10020558
740 Ga0207689_10035621
741 Ga0207689_10829057
742 Ga0207651_10915598
743 Ga0207712_10018061
744 Ga0207712_10023598
745 Ga0207668_10429782
746 Ga0207640_10005331
747 Ga0207703_10031440
748 Ga0207703_10242171
749 Ga0207708_10000961
750 Ga0207708_10006414
751 Ga0207708_10063009
752 Ga0207708_10170381
753 Ga0207708_10768734
754 Ga0207702_10044468
755 Ga0207702_10073683
756 Ga0207641_10484340
757 Ga0207641_10583165
758 Ga0207648_10003835
759 Ga0207648_10010295
760 Ga0207648_11397117
761 Ga0207676_10075112
762 Ga0207676_10434886
763 Ga0207675_100000558
764 Ga0207675_100016791
765 Ga0207675_100541645
766 Ga0207675_100563484
767 Ga0207683_10485457
768 Ga0209969_1001260
769 Ga0209996_1005951
770 Ga0210000_1002582
771 Ga0209995_1003280
772 Ga0209179_1009071
773 Ga0209999_1005708
774 Ga0209588_1004390
775 Ga0209971_1013168
776 Ga0209966_1067144
777 Ga0207428_10005218
778 Ga0207428_10021550
779 Ga0207428_10187007
780 Ga0207428_10271955
781 Ga0207428_10339553
782 Ga0268265_10021621
783 Ga0268265_10023502
784 Ga0268265_10361420
785 Ga0307408_102060079
786 Ga0307408_102310492
787 Ga0307407_10675354
788 Ga0307412_10242192
789 Ga0307409_101302100
790 Ga0307416_100026919
791 Ga0307416_100858359
792 Ga0307411_10671065
793 Ga0373930_0036022
794 Ga0373948_0096271
795 Ga0373958_0054397
796 Ga0373958_0074346
797 Ga0373938_0025150
798 Ga0373926_0137199
799 Ga0373926_0200725
800 Ga0373928_0044296
801 Ga0373944_0043172
802 Ga0373951_0177198
803 Ga0373952_0075738
804 Ga0373923_0088904
805 Ga0373932_0028138
806 Ga0373932_0282481
807 Ga0373936_0002778
808 Ga0373936_0013677
809 Ga0373939_0143696
810 Ga0373941_0176393
811 Ga0373945_0064970
812 Ga0373954_0000032
813 Ga0373960_0094031
814 Ga0373943_0000430
815 Ga0373943_0001101
816 Ga0373946_0006111
817 Ga0373955_0207407
818 Ga0373961_0012139
819 Ga0373962_0102944
820 Ga0373931_0006619
821 Ga0373931_0010385
822 Ga0373931_0126278
823 Ga0373931_0188908
824 Ga0373931_0461897
825 Ga0373931_0774015
826 Ga0373935_0020892
827 Ga0373927_0041679
828 Ga0373927_0280305
829 Ga0373933_0034797
830 Ga0373947_0000445
831 Ga0373947_0034744
832 Ga0373937_0000633
833 Ga0373937_0679794
834 Ga0373937_0910258
835 Ga0373925_0001425
836 Ga0373925_0185348
837 Ga0451807_0986236
838 Ga0451835_0899282
839 Ga0451853_3937487
840 Ga0439443_026337
841 Ga0439435_0005031
842 Ga0439444_0049208
843 Ga0439464_0019938
844 Ga0439460_0186508
845 Ga0451577_0176268
846 Ga0439440_0271647
847 Ga0451576_0000675
848 Ga0451576_0018399
849 Ga0451576_0070338
850 Ga0451576_0505599
851 Ga0451576_0603133
852 Ga0451576_0648379
853 Ga0495592_0000919
854 Ga0495641_0138445
855 Ga0495580_0049044
856 Ga0495582_0118077
857 Ga0495639_0521337
858 Ga0495662_0031981
859 Ga0495662_0036129
860 Ga0495584_0469840
861 Ga0495594_0291387
862 Ga0495628_0118116
863 Ga0495628_0226639
864 Ga0495628_0881304
865 Ga0495630_0276073
866 Ga0495630_0507693
867 Ga0495644_0140620
868 Ga0495644_0155606
869 Ga0495666_0037108
870 Ga0495666_0046768
871 Ga0495642_0217068
872 Ga0495642_0333385
873 Ga0495640_0001911
874 Ga0495640_0347298
875 Ga0495586_0000811
876 Ga0495587_0130951
877 Ga0495598_0178907
878 Ga0495621_0198355
879 Ga0495621_0238105
880 Ga0495656_0362159
881 Ga0495634_0001580
882 Ga0495635_0052478
883 Ga0495635_0289344
884 Ga0495657_0381441
885 Ga0495647_0015194
886 Ga0495658_0019475
887 Ga0495613_0036702
888 Ga0495624_0443869
889 Ga0495624_0598265
890 Ga0495581_0212439
891 Ga0495604_0525295
892 Ga0495636_0011018
893 Ga0495636_0022593
894 Ga0495674_0297780
895 Ga0495676_0107798
896 Ga0495680_0010222
897 Ga0495685_222530
898 Ga0495684_0405906
899 Ga0495593_0473953
900 Ga0496100_0064135
901 Ga0496101_0016385
902 Ga0496102_0344118
903 Ga0496104_0071489
904 Ga0496105_0034250
905 Ga0496106_0172492
906 Ga0496109_0460563
907 Ga0496111_0052800
908 Ga0496111_0607906
909 Ga0496111_0740617
910 Ga0496112_0172384
911 Ga0496112_0346761
912 Ga0496115_0054708
913 Ga0496115_0154686
914 Ga0496115_0420602
915 Ga0501033_0154875
916 Ga0501036_0206334
917 Ga0501037_0528147
918 Ga0501038_0120919
919 Ga0501038_0176040
920 Ga0501039_0781014
921 Ga0501040_0040747
922 Ga0501040_0051126
923 Ga0501040_0525143
924 Ga0501041_0004237
925 Ga0501042_0056784
926 Ga0501043_0857726
927 Ga0501048_0031207
928 Ga0501048_0538518
929 Ga0501048_0599102
930 Ga0501072_0018851
931 Ga0501072_0313077
932 Ga0501074_0298209
933 Ga0501075_0005022
934 Ga0501076_0024169
935 Ga0501076_0138432
936 Ga0501077_0574620
937 Ga0501079_0001948
938 Ga0501080_0020031
939 Ga0501081_0007214
940 Ga0501035_0279584
941 Ga0501045_0003071
942 nmdc:mga03683_95374_c1
943 nmdc:mga0k408_21767_c1
944 nmdc:mga06z11_134017_c1
945 nmdc:mga06z11_228798_c1
946 nmdc:mga07m45_304739_c1
947 nmdc:mga07m45_72740_c1
948 nmdc:mga05p37_110705_c1
949 nmdc:mga05p37_221183_c1
950 nmdc:mga05p37_4078_c1
951 nmdc:mga05p37_76_c1
952 nmdc:mga09592_21291_c1
953 nmdc:mga09592_213771_c1
954 nmdc:mga09592_38662_c1
955 nmdc:mga09592_779621_c1
956 nmdc:mga09592_844432_c1
957 nmdc:mga0qj67_10287_c1
958 nmdc:mga0qj67_1120639_c1
959 nmdc:mga0qj67_2151_c1
960 nmdc:mga0qj67_3805_c1
961 nmdc:mga0qj67_405325_c1
962 nmdc:mga0qj67_497125_c1
963 nmdc:mga0qj67_683026_c1
964 nmdc:mga06r32_134_c1
965 nmdc:mga06r32_14486_c1
966 nmdc:mga06r32_384685_c1
967 nmdc:mga06r32_701173_c1
968 nmdc:mga08y16_1005365_c1
969 nmdc:mga08y16_14440_c1
970 nmdc:mga08y16_503943_c1
971 nmdc:mga08y16_743652_c1
972 nmdc:mga08y16_961_c1
973 nmdc:mga0n895_162236_c1
974 nmdc:mga0n895_272981_c1
975 nmdc:mga0n895_565796_c1
976 nmdc:mga0n895_647701_c1
977 nmdc:mga0n895_6604_c1
978 nmdc:mga0rr50_1204331_c1
979 nmdc:mga0rr50_14899_c1
980 nmdc:mga0rr50_16983_c1
981 nmdc:mga0rr50_812134_c1
982 nmdc:mga08x19_3842_c1
983 nmdc:mga08x19_91124_c1
984 nmdc:mga0a205_274523_c1
985 nmdc:mga0a205_387992_c1
986 Ga0495601_0053997
987 Ga0495612_0267331
988 Ga0495595_0092529
989 Ga0495595_0342594
990 Ga0500616_0060431
991 Ga0501084_0004093
992 Ga0501082_0027661
993 Ga0501082_0555099
994 Ga0530510_0003945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

32

113

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zk1-assembly1.cif.gz_A crystal structure of the sodium binding rotor ring at ph 5.3 0.4354 50 116
4xxi-assembly1.cif.gz_B crystal structure of the bilin-binding domain of phycobilisome core-membrane linker apce 0.3702 25 171
4xxi-assembly1.cif.gz_B crystal structure of the bilin-binding domain of phycobilisome core-membrane linker apce 0.3631 25 171
3ctw-assembly1.cif.gz_D crystal structure of rcda from caulobacter crescentus cb15 0.3584 60 172
3zk1-assembly1.cif.gz_A crystal structure of the sodium binding rotor ring at ph 5.3 0.3518 50 116
ID Description Score Start End Superfamily
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7088 54 172 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6634 54 172 1.10.10.1740
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6021 52 184 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6009 51 184 1.20.120.550
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5769 45 172 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A127EXS3-F1-model_v4 DoxX family protein 0.9261 30 187 GO:0005886
AF-A0A127EXS3-F1-model_v4 DoxX family protein 0.9206 30 187 GO:0005886
AF-N1UUC6-F1-model_v4 DoxX family protein 0.9135 50 185 GO:0005886
AF-A0A1F5NVW9-F1-model_v4 DoxX family protein 0.9134 53 183 GO:0005886
AF-A0A4S8Q7B4-F1-model_v4 DoxX family protein 0.912 48 184 GO:0005886

Map