F454892

General Info

Members Datasets Scaffolds Average Seq Length
496 165 992 313

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10228933|Ga0105246_102289332
Length 342
Sequence VFHVTPGDGSSLVVRTLVLRGALAVLVLCLAAVSFVWVLGSRNPFTPAGYVGYLTKGAVVGKSRFYGIQKGPTSAGRTWLLDVTNISVTPYTYTEEFTGNQAVLSRDNLKISFAIHTVWRVDETKIPLFMERFSTTVTDGDHEKSPDAVVRVAYGNYVREPLRTFARDEVQRRNGLAVKDELIPIGQAVLTRIREYASDSPFVITSVVVGNVQYPDEVADAVSRKLAATQELERKDTEIEIERKERTKREVQATGIANAMQIIRGQLNALYIQHEAIEAQKLMVNSPNHTTVYIPVGPMGVPLHGDVPDRRTSRPRAGRSGGWPLNRKKVEEKAPVLTEARA

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.26
Nodule 0
Rhizoplane 0.81
Rhizosphere 91.73
Stem 0
Stem Tuber 0
Unclassified 18.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10228933 3300011119 Bacteria 1462
2 Ga0065714_10096345 3300005288 Bacteria 1762
3 Ga0065714_10141525 3300005288 Unclassified 1168
4 Ga0065704_10015251 3300005289 Bacteria 1796
5 Ga0065712_10003558 3300005290 Bacteria 8921
6 Ga0065712_10121926 3300005290 Bacteria 1658
7 Ga0065715_10016487 3300005293 Unclassified 2052
8 Ga0065715_10089781 3300005293 Bacteria 8545
9 Ga0065715_10195934 3300005293 Bacteria 1388
10 Ga0065707_10007744 3300005295 Bacteria 3690
11 Ga0065707_10089535 3300005295 Unclassified 4345
12 Ga0065707_10142826 3300005295 Bacteria 1750
13 Ga0065707_10221321 3300005295 Bacteria 1224
14 Ga0070690_100029825 3300005330 Unclassified 3386
15 Ga0070690_100032773 3300005330 Bacteria 3247
16 Ga0070690_100238948 3300005330 Viruses 1280
17 Ga0070670_100004855 3300005331 Bacteria 11306
18 Ga0070670_100068180 3300005331 Bacteria 3054
19 Ga0070670_100098206 3300005331 Unclassified 2520
20 Ga0070670_100121148 3300005331 Unclassified 2257
21 Ga0070677_10046938 3300005333 Bacteria 1729
22 Ga0070677_10058159 3300005333 Unclassified 1587
23 Ga0070677_10093842 3300005333 Bacteria 1310
24 Ga0070677_10128241 3300005333 Bacteria 1154
25 Ga0068869_100021021 3300005334 Bacteria 4486
26 Ga0070666_10065300 3300005335 Bacteria 2469
27 Ga0070666_10309135 3300005335 Unclassified 1126
28 Ga0070680_100100572 3300005336 Bacteria 2400
29 Ga0070680_100512222 3300005336 Bacteria 1027
30 Ga0068868_100151458 3300005338 Bacteria 1910
31 Ga0070689_100016828 3300005340 Bacteria 5359
32 Ga0070689_100077204 3300005340 Bacteria 2610
33 Ga0070689_100100814 3300005340 Unclassified 2285
34 Ga0070689_100203957 3300005340 Bacteria 1616
35 Ga0070687_100036895 3300005343 Bacteria 2439
36 Ga0070687_100055031 3300005343 Bacteria 2076
37 Ga0070661_100125328 3300005344 Bacteria 1926
38 Ga0070668_100092351 3300005347 Unclassified 2387
39 Ga0070668_100268994 3300005347 Bacteria 1420
40 Ga0070669_100023343 3300005353 Bacteria 4429
41 Ga0070669_100050793 3300005353 Bacteria 3029
42 Ga0070669_100170600 3300005353 Unclassified 1696
43 Ga0070669_100340946 3300005353 Bacteria 1214
44 Ga0070675_100002742 3300005354 Bacteria 13244
45 Ga0070675_100012091 3300005354 Bacteria 6767
46 Ga0070675_100047215 3300005354 Bacteria 3528
47 Ga0070675_100053698 3300005354 Bacteria 3314
48 Ga0070675_100061606 3300005354 Bacteria 3098
49 Ga0070675_100088698 3300005354 Bacteria 2588
50 Ga0070675_100398347 3300005354 Unclassified 1228
51 Ga0070671_100013783 3300005355 Bacteria 6522
52 Ga0070674_100002486 3300005356 Bacteria 10207
53 Ga0070673_100007873 3300005364 Bacteria 7060
54 Ga0070673_100015624 3300005364 Bacteria 5338
55 Ga0070673_100020376 3300005364 Unclassified 4783
56 Ga0070673_100025023 3300005364 Unclassified 4386
57 Ga0070673_100380432 3300005364 Bacteria 1258
58 Ga0070667_100009339 3300005367 Bacteria 8132
59 Ga0070667_100326867 3300005367 Unclassified 1385
60 Ga0070701_10128093 3300005438 Bacteria 1439
61 Ga0070700_100150263 3300005441 Bacteria 1592
62 Ga0070700_100272876 3300005441 Unclassified 1223
63 Ga0070694_100163535 3300005444 Bacteria 1635
64 Ga0070694_100254755 3300005444 Bacteria 1329
65 Ga0070708_100184004 3300005445 Unclassified 1953
66 Ga0070708_100195248 3300005445 Bacteria 1894
67 Ga0070678_100028318 3300005456 Bacteria 3819
68 Ga0070678_100050506 3300005456 Unclassified 3009
69 Ga0070678_100127691 3300005456 Bacteria 2015
70 Ga0070678_100174638 3300005456 Unclassified 1753
71 Ga0070678_100396798 3300005456 Unclassified 1197
72 Ga0070681_10198814 3300005458 Bacteria 1923
73 Ga0068867_100008836 3300005459 Bacteria 7111
74 Ga0068867_100040915 3300005459 Unclassified 3386
75 Ga0070685_10077973 3300005466 Unclassified 1980
76 Ga0070706_100001714 3300005467 Bacteria 22789
77 Ga0070706_100060534 3300005467 Bacteria 3495
78 Ga0070707_100002506 3300005468 Bacteria 17487
79 Ga0070707_100109916 3300005468 Bacteria 2673
80 Ga0070698_100065011 3300005471 Bacteria 3674
81 Ga0070698_100100368 3300005471 Bacteria 2867
82 Ga0070698_100320186 3300005471 Unclassified 1481
83 Ga0070699_100393827 3300005518 Unclassified 1252
84 Ga0068853_100283982 3300005539 Bacteria 1526
85 Ga0070686_100046003 3300005544 Unclassified 2751
86 Ga0070686_100175984 3300005544 Bacteria 1517
87 Ga0070695_100370028 3300005545 Bacteria 1079
88 Ga0070696_100167599 3300005546 Bacteria 1622
89 Ga0070665_100039825 3300005548 Bacteria 4724
90 Ga0070704_100016483 3300005549 Bacteria 4671
91 Ga0070664_100065884 3300005564 Bacteria 3092
92 Ga0070664_100068677 3300005564 Unclassified 3030
93 Ga0070664_100109114 3300005564 Bacteria 2414
94 Ga0068857_100043796 3300005577 Bacteria 3969
95 Ga0068857_100137609 3300005577 Bacteria 2206
96 Ga0068852_100176424 3300005616 Bacteria 2007
97 Ga0068859_100149863 3300005617 Unclassified 2408
98 Ga0068859_100162072 3300005617 Unclassified 2315
99 Ga0068859_100346294 3300005617 Bacteria 1581
100 Ga0068864_100056225 3300005618 Bacteria 3400
101 Ga0068864_100115646 3300005618 Bacteria 2393
102 Ga0068864_100170937 3300005618 Bacteria 1981
103 Ga0068866_10010227 3300005718 Unclassified 4015
104 Ga0068861_100014559 3300005719 Bacteria 5521
105 Ga0068861_100455086 3300005719 Bacteria 1148
106 Ga0068870_10002906 3300005840 Bacteria 7215
107 Ga0068870_10154259 3300005840 Unclassified 1355
108 Ga0068870_10163172 3300005840 Unclassified 1323
109 Ga0068870_10222911 3300005840 Bacteria 1155
110 Ga0068858_100014005 3300005842 Bacteria 7568
111 Ga0068858_100097162 3300005842 Bacteria 2745
112 Ga0068860_100103415 3300005843 Bacteria 2718
113 Ga0068860_100230981 3300005843 Bacteria 1798
114 Ga0068862_100062887 3300005844 Bacteria 3193
115 Ga0068862_100098981 3300005844 Bacteria 2548
116 Ga0068862_100310674 3300005844 Unclassified 1453
117 Ga0068862_100546195 3300005844 Bacteria 1106
118 Ga0081455_10162994 3300005937 Bacteria 1707
119 Ga0081539_10008783 3300005985 Bacteria 8660
120 Ga0081539_10016975 3300005985 Bacteria 5154
121 Ga0075365_10020234 3300006038 Bacteria 4122
122 Ga0075365_10028203 3300006038 Bacteria 3579
123 Ga0075368_10012184 3300006042 Bacteria 3141
124 Ga0075364_10007225 3300006051 Bacteria 6581
125 Ga0075364_10009647 3300006051 Bacteria 5799
126 Ga0075364_10018474 3300006051 Bacteria 4365
127 Ga0075362_10001350 3300006177 Bacteria 7762
128 Ga0075367_10004758 3300006178 Bacteria 6676
129 Ga0075367_10018837 3300006178 Bacteria 3815
130 Ga0075367_10081552 3300006178 Bacteria 1957
131 Ga0075367_10116364 3300006178 Bacteria 1644
132 Ga0075367_10135986 3300006178 Bacteria 1520
133 Ga0075366_10015731 3300006195 Unclassified 4342
134 Ga0075366_10018037 3300006195 Unclassified 4074
135 Ga0075366_10030957 3300006195 Bacteria 3147
136 Ga0075366_10037311 3300006195 Bacteria 2869
137 Ga0075366_10053305 3300006195 Bacteria 2403
138 Ga0075366_10078263 3300006195 Bacteria 1973
139 Ga0097621_100042247 3300006237 Bacteria 3672
140 Ga0097621_100067045 3300006237 Bacteria 2958
141 Ga0075370_10003032 3300006353 Bacteria 7918
142 Ga0075370_10084352 3300006353 Bacteria 1828
143 Ga0068871_100167695 3300006358 Unclassified 1881
144 Ga0075428_100000012 3300006844 Bacteria 176329
145 Ga0075428_100003939 3300006844 Bacteria 16287
146 Ga0075428_100004162 3300006844 Bacteria 15927
147 Ga0075428_100008394 3300006844 Bacteria 11450
148 Ga0075428_100060855 3300006844 Bacteria 4135
149 Ga0075428_100060966 3300006844 Bacteria 4131
150 Ga0075428_100130432 3300006844 Bacteria 2735
151 Ga0075428_100152856 3300006844 Bacteria 2507
152 Ga0075428_100207654 3300006844 Bacteria 2117
153 Ga0075428_100223067 3300006844 Bacteria 2035
154 Ga0075428_100272095 3300006844 Bacteria 1822
155 Ga0075428_100366212 3300006844 Bacteria 1546
156 Ga0075430_100001739 3300006846 Bacteria 17796
157 Ga0075430_100014186 3300006846 Bacteria 6792
158 Ga0075430_100062010 3300006846 Bacteria 3141
159 Ga0075430_100075803 3300006846 Bacteria 2819
160 Ga0075430_100092357 3300006846 Bacteria 2531
161 Ga0075431_100002793 3300006847 Bacteria 16916
162 Ga0075431_100006284 3300006847 Bacteria 11805
163 Ga0075431_100006717 3300006847 Bacteria 11423
164 Ga0075431_100061575 3300006847 Bacteria 3872
165 Ga0075431_100129911 3300006847 Bacteria 2599
166 Ga0075431_100165766 3300006847 Bacteria 2271
167 Ga0075431_100193516 3300006847 Bacteria 2083
168 Ga0075431_100196028 3300006847 Bacteria 2068
169 Ga0075431_100342678 3300006847 Bacteria 1504
170 Ga0075431_100558244 3300006847 Bacteria 1132
171 Ga0075433_10002424 3300006852 Bacteria 14184
172 Ga0075433_10011107 3300006852 Bacteria 7243
173 Ga0075433_10190057 3300006852 Bacteria 1827
174 Ga0075433_10199381 3300006852 Bacteria 1780
175 Ga0075433_10493179 3300006852 Bacteria 1078
176 Ga0075434_100010668 3300006871 Bacteria 8627
177 Ga0075434_100011102 3300006871 Bacteria 8477
178 Ga0075434_100039333 3300006871 Bacteria 4686
179 Ga0075434_100055213 3300006871 Unclassified 3947
180 Ga0075434_100258687 3300006871 Bacteria 1759
181 Ga0075434_100280462 3300006871 Bacteria 1686
182 Ga0075429_100000657 3300006880 Bacteria 26769
183 Ga0075429_100005185 3300006880 Bacteria 11205
184 Ga0075429_100008364 3300006880 Bacteria 9006
185 Ga0075429_100067637 3300006880 Bacteria 3109
186 Ga0075429_100186025 3300006880 Bacteria 1820
187 Ga0075429_100198683 3300006880 Bacteria 1757
188 Ga0075429_100251078 3300006880 Unclassified 1549
189 Ga0075429_100419567 3300006880 Bacteria 1172
190 Ga0075429_100460899 3300006880 Bacteria 1114
191 Ga0097620_100149860 3300006931 Unclassified 2408
192 Ga0097620_100162065 3300006931 Unclassified 2315
193 Ga0097620_100346298 3300006931 Bacteria 1581
194 Ga0111539_10000001 3300009094 Bacteria 1035431
195 Ga0111539_10000439 3300009094 Bacteria 52493
196 Ga0111539_10000713 3300009094 Bacteria 43163
197 Ga0111539_10000731 3300009094 Bacteria 42694
198 Ga0111539_10001326 3300009094 Bacteria 32991
199 Ga0111539_10003382 3300009094 Bacteria 21034
200 Ga0111539_10006618 3300009094 Bacteria 14931
201 Ga0111539_10024455 3300009094 Bacteria 7410
202 Ga0111539_10026577 3300009094 Bacteria 7077
203 Ga0111539_10031190 3300009094 Bacteria 6478
204 Ga0111539_10051799 3300009094 Bacteria 4887
205 Ga0111539_10054101 3300009094 Bacteria 4777
206 Ga0111539_10067496 3300009094 Bacteria 4223
207 Ga0111539_10072881 3300009094 Bacteria 4050
208 Ga0111539_10109852 3300009094 Bacteria 3236
209 Ga0111539_10166494 3300009094 Bacteria 2577
210 Ga0111539_10188675 3300009094 Unclassified 2406
211 Ga0111539_10198990 3300009094 Unclassified 2337
212 Ga0111539_10240923 3300009094 Bacteria 2106
213 Ga0111539_10372329 3300009094 Bacteria 1663
214 Ga0111539_10394526 3300009094 Bacteria 1612
215 Ga0111539_10759460 3300009094 Bacteria 1128
216 Ga0114129_10001521 3300009147 Bacteria 31392
217 Ga0114129_10002134 3300009147 Bacteria 27265
218 Ga0114129_10025633 3300009147 Bacteria 8353
219 Ga0114129_10028486 3300009147 Bacteria 7914
220 Ga0114129_10029808 3300009147 Bacteria 7726
221 Ga0114129_10030675 3300009147 Bacteria 7605
222 Ga0114129_10034860 3300009147 Bacteria 7110
223 Ga0114129_10044441 3300009147 Bacteria 6249
224 Ga0114129_10062636 3300009147 Bacteria 5195
225 Ga0114129_10062647 3300009147 Bacteria 5195
226 Ga0114129_10093906 3300009147 Bacteria 4155
227 Ga0114129_10218733 3300009147 Bacteria 2571
228 Ga0114129_10250239 3300009147 Bacteria 2379
229 Ga0114129_10263407 3300009147 Bacteria 2309
230 Ga0114129_10345374 3300009147 Unclassified 1973
231 Ga0114129_10374417 3300009147 Bacteria 1881
232 Ga0114129_10439236 3300009147 Bacteria 1713
233 Ga0114129_10492173 3300009147 Bacteria 1603
234 Ga0114129_10653770 3300009147 Bacteria 1356
235 Ga0105243_10026380 3300009148 Bacteria 4446
236 Ga0105242_10010758 3300009176 Bacteria 7023
237 Ga0105248_10024322 3300009177 Bacteria 6735
238 Ga0105248_10116709 3300009177 Bacteria 3010
239 Ga0105248_10220050 3300009177 Bacteria 2138
240 Ga0105248_10255970 3300009177 Bacteria 1971
241 Ga0105249_10196639 3300009553 Bacteria 1971
242 Ga0105239_10722006 3300010375 Bacteria 1140
243 Ga0105246_10023809 3300011119 Bacteria 3968
244 Ga0105246_10043148 3300011119 Unclassified 3059
245 Ga0157370_10246029 3300013104 Unclassified 1654
246 Ga0157374_10077161 3300013296 Bacteria 3152
247 Ga0163162_10189937 3300013306 Unclassified 2181
248 Ga0163162_10328186 3300013306 Bacteria 1663
249 Ga0157375_10237383 3300013308 Unclassified 1982
250 Ga0157375_10310433 3300013308 Bacteria 1741
251 Ga0157375_10381086 3300013308 Unclassified 1577
252 Ga0157375_10566565 3300013308 Bacteria 1297
253 Ga0157375_10571963 3300013308 Unclassified 1291
254 Ga0163163_10047793 3300014325 Bacteria 4207
255 Ga0163163_10096165 3300014325 Bacteria 2982
256 Ga0157380_10005202 3300014326 Bacteria 9094
257 Ga0157380_10006269 3300014326 Bacteria 8351
258 Ga0157380_10008180 3300014326 Bacteria 7454
259 Ga0157380_10009995 3300014326 Bacteria 6811
260 Ga0157380_10072356 3300014326 Bacteria 2792
261 Ga0157380_10073090 3300014326 Bacteria 2779
262 Ga0157380_10130626 3300014326 Bacteria 2142
263 Ga0157380_10195093 3300014326 Bacteria 1791
264 Ga0157380_10266849 3300014326 Bacteria 1558
265 Ga0157380_10291419 3300014326 Bacteria 1499
266 Ga0157380_10298093 3300014326 Unclassified 1483
267 Ga0157377_10059723 3300014745 Bacteria 2174
268 Ga0157377_10079255 3300014745 Unclassified 1916
269 Ga0157376_10231167 3300014969 Bacteria 1718
270 Ga0163161_10007729 3300017792 Bacteria 7438
271 Ga0163161_10041346 3300017792 Bacteria 3313
272 Ga0163161_10180164 3300017792 Unclassified 1620
273 Ga0163161_10327614 3300017792 Bacteria 1212
274 Ga0207682_10009744 3300025893 Bacteria 3785
275 Ga0207682_10039960 3300025893 Unclassified 1909
276 Ga0207682_10156768 3300025893 Bacteria 1029
277 Ga0207642_10161844 3300025899 Unclassified 1202
278 Ga0207688_10014944 3300025901 Bacteria 4212
279 Ga0207688_10104177 3300025901 Bacteria 1641
280 Ga0207688_10252128 3300025901 Bacteria 1069
281 Ga0207680_10032894 3300025903 Unclassified 2953
282 Ga0207680_10060798 3300025903 Bacteria 2301
283 Ga0207680_10196336 3300025903 Unclassified 1373
284 Ga0207645_10018025 3300025907 Bacteria 4654
285 Ga0207643_10000115 3300025908 Bacteria 54877
286 Ga0207643_10039045 3300025908 Bacteria 2670
287 Ga0207643_10039322 3300025908 Unclassified 2661
288 Ga0207684_10002869 3300025910 Bacteria 17108
289 Ga0207684_10132918 3300025910 Bacteria 2136
290 Ga0207660_10207872 3300025917 Unclassified 1532
291 Ga0207662_10068374 3300025918 Bacteria 2145
292 Ga0207662_10249758 3300025918 Unclassified 1164
293 Ga0207649_10029933 3300025920 Unclassified 3219
294 Ga0207646_10005513 3300025922 Bacteria 13302
295 Ga0207646_10059675 3300025922 Bacteria 3406
296 Ga0207646_10145572 3300025922 Bacteria 2135
297 Ga0207681_10029766 3300025923 Bacteria 3552
298 Ga0207681_10089511 3300025923 Unclassified 2194
299 Ga0207681_10102206 3300025923 Bacteria 2069
300 Ga0207681_10187561 3300025923 Bacteria 1580
301 Ga0207681_10302160 3300025923 Bacteria 1267
302 Ga0207650_10051217 3300025925 Unclassified 3055
303 Ga0207650_10062791 3300025925 Unclassified 2776
304 Ga0207650_10096545 3300025925 Bacteria 2267
305 Ga0207659_10000370 3300025926 Bacteria 27017
306 Ga0207659_10005708 3300025926 Bacteria 7577
307 Ga0207659_10039476 3300025926 Bacteria 3293
308 Ga0207659_10142468 3300025926 Bacteria 1862
309 Ga0207659_10324395 3300025926 Unclassified 1271
310 Ga0207659_10357278 3300025926 Unclassified 1213
311 Ga0207644_10006714 3300025931 Bacteria 7496
312 Ga0207644_10052370 3300025931 Unclassified 2933
313 Ga0207690_10043718 3300025932 Unclassified 2950
314 Ga0207690_10081172 3300025932 Bacteria 2265
315 Ga0207686_10012088 3300025934 Bacteria 4742
316 Ga0207709_10005646 3300025935 Bacteria 7072
317 Ga0207670_10047116 3300025936 Unclassified 2869
318 Ga0207670_10064780 3300025936 Bacteria 2506
319 Ga0207669_10005488 3300025937 Bacteria 5695
320 Ga0207711_10072943 3300025941 Bacteria 2983
321 Ga0207711_10083599 3300025941 Unclassified 2793
322 Ga0207711_10122324 3300025941 Bacteria 2324
323 Ga0207711_10148623 3300025941 Bacteria 2113
324 Ga0207711_10163464 3300025941 Bacteria 2016
325 Ga0207689_10000842 3300025942 Bacteria 29533
326 Ga0207679_10001161 3300025945 Bacteria 16779
327 Ga0207679_10035266 3300025945 Bacteria 3538
328 Ga0207679_10035329 3300025945 Unclassified 3535
329 Ga0207679_10336473 3300025945 Bacteria 1312
330 Ga0207651_10001204 3300025960 Bacteria 11588
331 Ga0207651_10008232 3300025960 Bacteria 5619
332 Ga0207712_10119930 3300025961 Bacteria 1988
333 Ga0207668_10068287 3300025972 Bacteria 2527
334 Ga0207658_10067858 3300025986 Unclassified 2688
335 Ga0207658_10211679 3300025986 Unclassified 1625
336 Ga0207658_10218662 3300025986 Bacteria 1601
337 Ga0207677_10142300 3300026023 Bacteria 1838
338 Ga0207677_10227745 3300026023 Bacteria 1499
339 Ga0207703_10008996 3300026035 Bacteria 7865
340 Ga0207678_10068584 3300026067 Unclassified 3042
341 Ga0207678_10221468 3300026067 Bacteria 1620
342 Ga0207708_10012556 3300026075 Bacteria 6315
343 Ga0207708_10021475 3300026075 Unclassified 4868
344 Ga0207708_10068375 3300026075 Unclassified 2719
345 Ga0207708_10147842 3300026075 Unclassified 1848
346 Ga0207648_10000566 3300026089 Bacteria 41515
347 Ga0207648_10040116 3300026089 Bacteria 4114
348 Ga0207648_10121552 3300026089 Bacteria 2296
349 Ga0207648_10180559 3300026089 Unclassified 1868
350 Ga0207676_10057556 3300026095 Bacteria 3062
351 Ga0207676_10230061 3300026095 Unclassified 1657
352 Ga0207674_10086422 3300026116 Unclassified 3131
353 Ga0207674_10094963 3300026116 Unclassified 2968
354 Ga0207674_10171059 3300026116 Bacteria 2126
355 Ga0207674_10337386 3300026116 Bacteria 1457
356 Ga0207675_100034599 3300026118 Bacteria 4711
357 Ga0207675_100241073 3300026118 Bacteria 1747
358 Ga0207675_100253611 3300026118 Bacteria 1703
359 Ga0207675_100356725 3300026118 Bacteria 1434
360 Ga0207675_100534093 3300026118 Bacteria 1170
361 Ga0207683_10001378 3300026121 Bacteria 21931
362 Ga0207683_10015547 3300026121 Bacteria 6480
363 Ga0207683_10145770 3300026121 Unclassified 2135
364 Ga0207683_10175598 3300026121 Bacteria 1941
365 Ga0207683_10382036 3300026121 Bacteria 1295
366 Ga0207428_10000002 3300027907 Bacteria 854851
367 Ga0207428_10005821 3300027907 Bacteria 11427
368 Ga0207428_10009838 3300027907 Bacteria 8565
369 Ga0207428_10012554 3300027907 Bacteria 7437
370 Ga0207428_10023233 3300027907 Bacteria 5217
371 Ga0207428_10059338 3300027907 Unclassified 3034
372 Ga0207428_10141765 3300027907 Bacteria 1834
373 Ga0207428_10236874 3300027907 Bacteria 1364
374 Ga0268266_10187434 3300028379 Bacteria 1887
375 Ga0268266_10434587 3300028379 Bacteria 1246
376 Ga0268265_10096170 3300028380 Unclassified 2380
377 Ga0268265_10320754 3300028380 Bacteria 1403
378 Ga0268265_10357037 3300028380 Bacteria 1336
379 Ga0268265_10419431 3300028380 Unclassified 1242
380 Ga0268265_10503984 3300028380 Bacteria 1141
381 Ga0268265_10579467 3300028380 Bacteria 1069
382 Ga0307408_100014706 3300031548 Bacteria 5202
383 Ga0307408_100144262 3300031548 Bacteria 1872
384 Ga0307408_100287589 3300031548 Bacteria 1371
385 Ga0307408_100332654 3300031548 Bacteria 1283
386 Ga0307405_10092308 3300031731 Bacteria 2008
387 Ga0307405_10096899 3300031731 Bacteria 1968
388 Ga0307413_10149801 3300031824 Bacteria 1624
389 Ga0307410_10085778 3300031852 Bacteria 2223
390 Ga0307412_10175872 3300031911 Bacteria 1605
391 Ga0307416_100009234 3300032002 Bacteria 6438
392 Ga0307416_100139170 3300032002 Bacteria 2203
393 Ga0307415_100042855 3300032126 Bacteria 3015
394 Ga0373941_0094624 3300035115 Bacteria 1030
395 Ga0436360_1224326 3300039438 Bacteria 2994
396 Ga0451807_2498113 3300041486 Bacteria 1201
397 Ga0451853_2360472 3300041512 Bacteria 1302
398 Ga0451577_0030716 3300042876 Bacteria 4852
399 Ga0451576_0114301 3300045051 Bacteria 2810
400 Ga0451576_0485709 3300045051 Bacteria 1297
401 Ga0495643_0011707 3300046522 Bacteria 5326
402 Ga0495656_0010286 3300046615 Bacteria 3396
403 Ga0495659_0006085 3300046664 Bacteria 3815
404 Ga0495636_0144765 3300047318 Unclassified 1063
405 Ga0496102_0134371 3300048905 Bacteria 2317
406 Ga0496107_0129982 3300048910 Bacteria 1859
407 Ga0496110_0653787 3300048913 Bacteria 951
408 Ga0501071_0340938 3300049587 Bacteria 1140
409 Ga0501076_0046708 3300049592 Bacteria 3422
410 Ga0501243_012281 3300049675 Bacteria 1351
411 Ga0501079_0128991 3300049741 Bacteria 1968
412 Ga0501080_0484025 3300049742 Bacteria 1107
413 nmdc:mga03683_3694_c1 3300050489 Bacteria 4985
414 nmdc:mga00v17_165780_c1 3300050491 Unclassified 1423
415 nmdc:mga00v17_2564_c1 3300050491 Bacteria 9327
416 nmdc:mga00v17_93747_c1 3300050491 Bacteria 1888
417 nmdc:mga00v17_943_c2 3300050491 Bacteria 11332
418 nmdc:mga0yw44_123460_c1 3300050492 Bacteria 1670
419 nmdc:mga0k408_148269_c1 3300050493 Bacteria 1397
420 nmdc:mga0k408_30739_c1 3300050493 Bacteria 3063
421 nmdc:mga0k408_31408_c1 3300050493 Bacteria 3032
422 nmdc:mga0k408_702_c1 3300050493 Bacteria 18324
423 nmdc:mga06z11_21454_c1 3300050494 Bacteria 3002
424 nmdc:mga06z11_49490_c1 3300050494 Bacteria 2144
425 nmdc:mga06z11_61993_c1 3300050494 Bacteria 1952
426 nmdc:mga06z11_6257_c1 3300050494 Bacteria 4827
427 nmdc:mga07m45_3738_c1 3300050496 Bacteria 7366
428 nmdc:mga07m45_98100_c1 3300050496 Bacteria 1682
429 nmdc:mga05p37_150026_c1 3300050507 Bacteria 1432
430 nmdc:mga05p37_192247_c1 3300050507 Bacteria 2477
431 nmdc:mga05p37_204142_c1 3300050507 Bacteria 2392
432 nmdc:mga05p37_417374_c1 3300050507 Bacteria 1563
433 nmdc:mga05p37_419751_c1 3300050507 Unclassified 1557
434 nmdc:mga05p37_44017_c1 3300050507 Bacteria 5492
435 nmdc:mga05p37_47380_c1 3300050507 Bacteria 5286
436 nmdc:mga05p37_475201_c1 3300050507 Unclassified 1441
437 nmdc:mga05p37_62014_c1 3300050507 Bacteria 4602
438 nmdc:mga05p37_686565_c1 3300050507 Unclassified 1140
439 nmdc:mga05p37_7742_c1 3300050507 Bacteria 12680
440 nmdc:mga05p37_82458_c1 3300050507 Bacteria 3962
441 nmdc:mga05p37_8841_c1 3300050507 Bacteria 11901
442 nmdc:mga05p37_91641_c1 3300050507 Bacteria 3745
443 nmdc:mga09592_10891_c1 3300050508 Bacteria 7401
444 nmdc:mga09592_118403_c1 3300050508 Bacteria 2273
445 nmdc:mga09592_166024_c1 3300050508 Bacteria 1908
446 nmdc:mga09592_262724_c1 3300050508 Bacteria 1497
447 nmdc:mga09592_4818_c1 3300050508 Bacteria 10933
448 nmdc:mga09592_614852_c1 3300050508 Bacteria 930
449 nmdc:mga09592_85229_c1 3300050508 Unclassified 2695
450 nmdc:mga09592_9097_c1 3300050508 Bacteria 8076
451 nmdc:mga09592_94194_c1 3300050508 Bacteria 2561
452 nmdc:mga0qj67_1134_c1 3300050509 Bacteria 18440
453 nmdc:mga0qj67_27866_c1 3300050509 Bacteria 4381
454 nmdc:mga0qj67_7760_c1 3300050509 Bacteria 7931
455 nmdc:mga0qj67_83287_c1 3300050509 Bacteria 2564
456 nmdc:mga0qj67_9237_c1 3300050509 Bacteria 7328
457 nmdc:mga06r32_113341_c1 3300050510 Bacteria 2669
458 nmdc:mga06r32_122653_c1 3300050510 Bacteria 2564
459 nmdc:mga06r32_149462_c1 3300050510 Bacteria 2314
460 nmdc:mga06r32_4451_c1 3300050510 Bacteria 12543
461 nmdc:mga06r32_487227_c1 3300050510 Bacteria 1211
462 nmdc:mga06r32_555014_c1 3300050510 Bacteria 1122
463 nmdc:mga06r32_5980_c1 3300050510 Bacteria 10951
464 nmdc:mga06r32_64555_c1 3300050510 Bacteria 3530
465 nmdc:mga06r32_96427_c1 3300050510 Unclassified 2497
466 nmdc:mga08y16_120252_c1 3300050511 Bacteria 2733
467 nmdc:mga08y16_122773_c1 3300050511 Bacteria 2703
468 nmdc:mga08y16_132744_c1 3300050511 Bacteria 2588
469 nmdc:mga08y16_166561_c1 3300050511 Unclassified 2289
470 nmdc:mga08y16_189260_c1 3300050511 Bacteria 2135
471 nmdc:mga08y16_20654_c1 3300050511 Bacteria 6951
472 nmdc:mga08y16_21272_c1 3300050511 Bacteria 6849
473 nmdc:mga08y16_27334_c1 3300050511 Bacteria 6010
474 nmdc:mga08y16_28138_c1 3300050511 Bacteria 5926
475 nmdc:mga08y16_283483_c1 3300050511 Bacteria 1708
476 nmdc:mga08y16_32768_c1 3300050511 Bacteria 5463
477 nmdc:mga08y16_348658_c1 3300050511 Bacteria 1521
478 nmdc:mga08y16_36065_c1 3300050511 Bacteria 5193
479 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
480 nmdc:mga08y16_467985_c1 3300050511 Unclassified 1284
481 nmdc:mga08y16_5126_c1 3300050511 Bacteria 13691
482 nmdc:mga08y16_69620_c1 3300050511 Bacteria 3668
483 nmdc:mga08y16_71270_c1 3300050511 Bacteria 3622
484 nmdc:mga08y16_932_c1 3300050511 Bacteria 28369
485 nmdc:mga0n895_11532_c1 3300050512 Bacteria 7892
486 nmdc:mga0n895_136193_c1 3300050512 Bacteria 2482
487 nmdc:mga0n895_31290_c1 3300050512 Bacteria 5094
488 nmdc:mga0n895_38644_c1 3300050512 Unclassified 4625
489 nmdc:mga0rr50_144325_c1 3300050513 Bacteria 1918
490 nmdc:mga0a205_105220_c1 3300050515 Bacteria 2721
491 nmdc:mga0a205_16692_c1 3300050515 Bacteria 6877
492 nmdc:mga0a205_204701_c1 3300050515 Bacteria 1863
493 nmdc:mga0a205_245445_c1 3300050515 Bacteria 1671
494 nmdc:mga0a205_36869_c1 3300050515 Bacteria 4700
495 nmdc:mga0a205_45719_c1 3300050515 Bacteria 4222
496 Ga0501084_0187371 3300054114 Bacteria 1746
497 Ga0105246_10228933
498 Ga0065714_10096345
499 Ga0065714_10141525
500 Ga0065704_10015251
501 Ga0065712_10003558
502 Ga0065712_10121926
503 Ga0065715_10016487
504 Ga0065715_10089781
505 Ga0065715_10195934
506 Ga0065707_10007744
507 Ga0065707_10089535
508 Ga0065707_10142826
509 Ga0065707_10221321
510 Ga0070690_100029825
511 Ga0070690_100032773
512 Ga0070690_100238948
513 Ga0070670_100004855
514 Ga0070670_100068180
515 Ga0070670_100098206
516 Ga0070670_100121148
517 Ga0070677_10046938
518 Ga0070677_10058159
519 Ga0070677_10093842
520 Ga0070677_10128241
521 Ga0068869_100021021
522 Ga0070666_10065300
523 Ga0070666_10309135
524 Ga0070680_100100572
525 Ga0070680_100512222
526 Ga0068868_100151458
527 Ga0070689_100016828
528 Ga0070689_100077204
529 Ga0070689_100100814
530 Ga0070689_100203957
531 Ga0070687_100036895
532 Ga0070687_100055031
533 Ga0070661_100125328
534 Ga0070668_100092351
535 Ga0070668_100268994
536 Ga0070669_100023343
537 Ga0070669_100050793
538 Ga0070669_100170600
539 Ga0070669_100340946
540 Ga0070675_100002742
541 Ga0070675_100012091
542 Ga0070675_100047215
543 Ga0070675_100053698
544 Ga0070675_100061606
545 Ga0070675_100088698
546 Ga0070675_100398347
547 Ga0070671_100013783
548 Ga0070674_100002486
549 Ga0070673_100007873
550 Ga0070673_100015624
551 Ga0070673_100020376
552 Ga0070673_100025023
553 Ga0070673_100380432
554 Ga0070667_100009339
555 Ga0070667_100326867
556 Ga0070701_10128093
557 Ga0070700_100150263
558 Ga0070700_100272876
559 Ga0070694_100163535
560 Ga0070694_100254755
561 Ga0070708_100184004
562 Ga0070708_100195248
563 Ga0070678_100028318
564 Ga0070678_100050506
565 Ga0070678_100127691
566 Ga0070678_100174638
567 Ga0070678_100396798
568 Ga0070681_10198814
569 Ga0068867_100008836
570 Ga0068867_100040915
571 Ga0070685_10077973
572 Ga0070706_100001714
573 Ga0070706_100060534
574 Ga0070707_100002506
575 Ga0070707_100109916
576 Ga0070698_100065011
577 Ga0070698_100100368
578 Ga0070698_100320186
579 Ga0070699_100393827
580 Ga0068853_100283982
581 Ga0070686_100046003
582 Ga0070686_100175984
583 Ga0070695_100370028
584 Ga0070696_100167599
585 Ga0070665_100039825
586 Ga0070704_100016483
587 Ga0070664_100065884
588 Ga0070664_100068677
589 Ga0070664_100109114
590 Ga0068857_100043796
591 Ga0068857_100137609
592 Ga0068852_100176424
593 Ga0068859_100149863
594 Ga0068859_100162072
595 Ga0068859_100346294
596 Ga0068864_100056225
597 Ga0068864_100115646
598 Ga0068864_100170937
599 Ga0068866_10010227
600 Ga0068861_100014559
601 Ga0068861_100455086
602 Ga0068870_10002906
603 Ga0068870_10154259
604 Ga0068870_10163172
605 Ga0068870_10222911
606 Ga0068858_100014005
607 Ga0068858_100097162
608 Ga0068860_100103415
609 Ga0068860_100230981
610 Ga0068862_100062887
611 Ga0068862_100098981
612 Ga0068862_100310674
613 Ga0068862_100546195
614 Ga0081455_10162994
615 Ga0081539_10008783
616 Ga0081539_10016975
617 Ga0075365_10020234
618 Ga0075365_10028203
619 Ga0075368_10012184
620 Ga0075364_10007225
621 Ga0075364_10009647
622 Ga0075364_10018474
623 Ga0075362_10001350
624 Ga0075367_10004758
625 Ga0075367_10018837
626 Ga0075367_10081552
627 Ga0075367_10116364
628 Ga0075367_10135986
629 Ga0075366_10015731
630 Ga0075366_10018037
631 Ga0075366_10030957
632 Ga0075366_10037311
633 Ga0075366_10053305
634 Ga0075366_10078263
635 Ga0097621_100042247
636 Ga0097621_100067045
637 Ga0075370_10003032
638 Ga0075370_10084352
639 Ga0068871_100167695
640 Ga0075428_100000012
641 Ga0075428_100003939
642 Ga0075428_100004162
643 Ga0075428_100008394
644 Ga0075428_100060855
645 Ga0075428_100060966
646 Ga0075428_100130432
647 Ga0075428_100152856
648 Ga0075428_100207654
649 Ga0075428_100223067
650 Ga0075428_100272095
651 Ga0075428_100366212
652 Ga0075430_100001739
653 Ga0075430_100014186
654 Ga0075430_100062010
655 Ga0075430_100075803
656 Ga0075430_100092357
657 Ga0075431_100002793
658 Ga0075431_100006284
659 Ga0075431_100006717
660 Ga0075431_100061575
661 Ga0075431_100129911
662 Ga0075431_100165766
663 Ga0075431_100193516
664 Ga0075431_100196028
665 Ga0075431_100342678
666 Ga0075431_100558244
667 Ga0075433_10002424
668 Ga0075433_10011107
669 Ga0075433_10190057
670 Ga0075433_10199381
671 Ga0075433_10493179
672 Ga0075434_100010668
673 Ga0075434_100011102
674 Ga0075434_100039333
675 Ga0075434_100055213
676 Ga0075434_100258687
677 Ga0075434_100280462
678 Ga0075429_100000657
679 Ga0075429_100005185
680 Ga0075429_100008364
681 Ga0075429_100067637
682 Ga0075429_100186025
683 Ga0075429_100198683
684 Ga0075429_100251078
685 Ga0075429_100419567
686 Ga0075429_100460899
687 Ga0097620_100149860
688 Ga0097620_100162065
689 Ga0097620_100346298
690 Ga0111539_10000001
691 Ga0111539_10000439
692 Ga0111539_10000713
693 Ga0111539_10000731
694 Ga0111539_10001326
695 Ga0111539_10003382
696 Ga0111539_10006618
697 Ga0111539_10024455
698 Ga0111539_10026577
699 Ga0111539_10031190
700 Ga0111539_10051799
701 Ga0111539_10054101
702 Ga0111539_10067496
703 Ga0111539_10072881
704 Ga0111539_10109852
705 Ga0111539_10166494
706 Ga0111539_10188675
707 Ga0111539_10198990
708 Ga0111539_10240923
709 Ga0111539_10372329
710 Ga0111539_10394526
711 Ga0111539_10759460
712 Ga0114129_10001521
713 Ga0114129_10002134
714 Ga0114129_10025633
715 Ga0114129_10028486
716 Ga0114129_10029808
717 Ga0114129_10030675
718 Ga0114129_10034860
719 Ga0114129_10044441
720 Ga0114129_10062636
721 Ga0114129_10062647
722 Ga0114129_10093906
723 Ga0114129_10218733
724 Ga0114129_10250239
725 Ga0114129_10263407
726 Ga0114129_10345374
727 Ga0114129_10374417
728 Ga0114129_10439236
729 Ga0114129_10492173
730 Ga0114129_10653770
731 Ga0105243_10026380
732 Ga0105242_10010758
733 Ga0105248_10024322
734 Ga0105248_10116709
735 Ga0105248_10220050
736 Ga0105248_10255970
737 Ga0105249_10196639
738 Ga0105239_10722006
739 Ga0105246_10023809
740 Ga0105246_10043148
741 Ga0157370_10246029
742 Ga0157374_10077161
743 Ga0163162_10189937
744 Ga0163162_10328186
745 Ga0157375_10237383
746 Ga0157375_10310433
747 Ga0157375_10381086
748 Ga0157375_10566565
749 Ga0157375_10571963
750 Ga0163163_10047793
751 Ga0163163_10096165
752 Ga0157380_10005202
753 Ga0157380_10006269
754 Ga0157380_10008180
755 Ga0157380_10009995
756 Ga0157380_10072356
757 Ga0157380_10073090
758 Ga0157380_10130626
759 Ga0157380_10195093
760 Ga0157380_10266849
761 Ga0157380_10291419
762 Ga0157380_10298093
763 Ga0157377_10059723
764 Ga0157377_10079255
765 Ga0157376_10231167
766 Ga0163161_10007729
767 Ga0163161_10041346
768 Ga0163161_10180164
769 Ga0163161_10327614
770 Ga0207682_10009744
771 Ga0207682_10039960
772 Ga0207682_10156768
773 Ga0207642_10161844
774 Ga0207688_10014944
775 Ga0207688_10104177
776 Ga0207688_10252128
777 Ga0207680_10032894
778 Ga0207680_10060798
779 Ga0207680_10196336
780 Ga0207645_10018025
781 Ga0207643_10000115
782 Ga0207643_10039045
783 Ga0207643_10039322
784 Ga0207684_10002869
785 Ga0207684_10132918
786 Ga0207660_10207872
787 Ga0207662_10068374
788 Ga0207662_10249758
789 Ga0207649_10029933
790 Ga0207646_10005513
791 Ga0207646_10059675
792 Ga0207646_10145572
793 Ga0207681_10029766
794 Ga0207681_10089511
795 Ga0207681_10102206
796 Ga0207681_10187561
797 Ga0207681_10302160
798 Ga0207650_10051217
799 Ga0207650_10062791
800 Ga0207650_10096545
801 Ga0207659_10000370
802 Ga0207659_10005708
803 Ga0207659_10039476
804 Ga0207659_10142468
805 Ga0207659_10324395
806 Ga0207659_10357278
807 Ga0207644_10006714
808 Ga0207644_10052370
809 Ga0207690_10043718
810 Ga0207690_10081172
811 Ga0207686_10012088
812 Ga0207709_10005646
813 Ga0207670_10047116
814 Ga0207670_10064780
815 Ga0207669_10005488
816 Ga0207711_10072943
817 Ga0207711_10083599
818 Ga0207711_10122324
819 Ga0207711_10148623
820 Ga0207711_10163464
821 Ga0207689_10000842
822 Ga0207679_10001161
823 Ga0207679_10035266
824 Ga0207679_10035329
825 Ga0207679_10336473
826 Ga0207651_10001204
827 Ga0207651_10008232
828 Ga0207712_10119930
829 Ga0207668_10068287
830 Ga0207658_10067858
831 Ga0207658_10211679
832 Ga0207658_10218662
833 Ga0207677_10142300
834 Ga0207677_10227745
835 Ga0207703_10008996
836 Ga0207678_10068584
837 Ga0207678_10221468
838 Ga0207708_10012556
839 Ga0207708_10021475
840 Ga0207708_10068375
841 Ga0207708_10147842
842 Ga0207648_10000566
843 Ga0207648_10040116
844 Ga0207648_10121552
845 Ga0207648_10180559
846 Ga0207676_10057556
847 Ga0207676_10230061
848 Ga0207674_10086422
849 Ga0207674_10094963
850 Ga0207674_10171059
851 Ga0207674_10337386
852 Ga0207675_100034599
853 Ga0207675_100241073
854 Ga0207675_100253611
855 Ga0207675_100356725
856 Ga0207675_100534093
857 Ga0207683_10001378
858 Ga0207683_10015547
859 Ga0207683_10145770
860 Ga0207683_10175598
861 Ga0207683_10382036
862 Ga0207428_10000002
863 Ga0207428_10005821
864 Ga0207428_10009838
865 Ga0207428_10012554
866 Ga0207428_10023233
867 Ga0207428_10059338
868 Ga0207428_10141765
869 Ga0207428_10236874
870 Ga0268266_10187434
871 Ga0268266_10434587
872 Ga0268265_10096170
873 Ga0268265_10320754
874 Ga0268265_10357037
875 Ga0268265_10419431
876 Ga0268265_10503984
877 Ga0268265_10579467
878 Ga0307408_100014706
879 Ga0307408_100144262
880 Ga0307408_100287589
881 Ga0307408_100332654
882 Ga0307405_10092308
883 Ga0307405_10096899
884 Ga0307413_10149801
885 Ga0307410_10085778
886 Ga0307412_10175872
887 Ga0307416_100009234
888 Ga0307416_100139170
889 Ga0307415_100042855
890 Ga0373941_0094624
891 Ga0436360_1224326
892 Ga0451807_2498113
893 Ga0451853_2360472
894 Ga0451577_0030716
895 Ga0451576_0114301
896 Ga0451576_0485709
897 Ga0495643_0011707
898 Ga0495656_0010286
899 Ga0495659_0006085
900 Ga0495636_0144765
901 Ga0496102_0134371
902 Ga0496107_0129982
903 Ga0496110_0653787
904 Ga0501071_0340938
905 Ga0501076_0046708
906 Ga0501243_012281
907 Ga0501079_0128991
908 Ga0501080_0484025
909 nmdc:mga03683_3694_c1
910 nmdc:mga00v17_165780_c1
911 nmdc:mga00v17_2564_c1
912 nmdc:mga00v17_93747_c1
913 nmdc:mga00v17_943_c2
914 nmdc:mga0yw44_123460_c1
915 nmdc:mga0k408_148269_c1
916 nmdc:mga0k408_30739_c1
917 nmdc:mga0k408_31408_c1
918 nmdc:mga0k408_702_c1
919 nmdc:mga06z11_21454_c1
920 nmdc:mga06z11_49490_c1
921 nmdc:mga06z11_61993_c1
922 nmdc:mga06z11_6257_c1
923 nmdc:mga07m45_3738_c1
924 nmdc:mga07m45_98100_c1
925 nmdc:mga05p37_150026_c1
926 nmdc:mga05p37_192247_c1
927 nmdc:mga05p37_204142_c1
928 nmdc:mga05p37_417374_c1
929 nmdc:mga05p37_419751_c1
930 nmdc:mga05p37_44017_c1
931 nmdc:mga05p37_47380_c1
932 nmdc:mga05p37_475201_c1
933 nmdc:mga05p37_62014_c1
934 nmdc:mga05p37_686565_c1
935 nmdc:mga05p37_7742_c1
936 nmdc:mga05p37_82458_c1
937 nmdc:mga05p37_8841_c1
938 nmdc:mga05p37_91641_c1
939 nmdc:mga09592_10891_c1
940 nmdc:mga09592_118403_c1
941 nmdc:mga09592_166024_c1
942 nmdc:mga09592_262724_c1
943 nmdc:mga09592_4818_c1
944 nmdc:mga09592_614852_c1
945 nmdc:mga09592_85229_c1
946 nmdc:mga09592_9097_c1
947 nmdc:mga09592_94194_c1
948 nmdc:mga0qj67_1134_c1
949 nmdc:mga0qj67_27866_c1
950 nmdc:mga0qj67_7760_c1
951 nmdc:mga0qj67_83287_c1
952 nmdc:mga0qj67_9237_c1
953 nmdc:mga06r32_113341_c1
954 nmdc:mga06r32_122653_c1
955 nmdc:mga06r32_149462_c1
956 nmdc:mga06r32_4451_c1
957 nmdc:mga06r32_487227_c1
958 nmdc:mga06r32_555014_c1
959 nmdc:mga06r32_5980_c1
960 nmdc:mga06r32_64555_c1
961 nmdc:mga06r32_96427_c1
962 nmdc:mga08y16_120252_c1
963 nmdc:mga08y16_122773_c1
964 nmdc:mga08y16_132744_c1
965 nmdc:mga08y16_166561_c1
966 nmdc:mga08y16_189260_c1
967 nmdc:mga08y16_20654_c1
968 nmdc:mga08y16_21272_c1
969 nmdc:mga08y16_27334_c1
970 nmdc:mga08y16_28138_c1
971 nmdc:mga08y16_283483_c1
972 nmdc:mga08y16_32768_c1
973 nmdc:mga08y16_348658_c1
974 nmdc:mga08y16_36065_c1
975 nmdc:mga08y16_3_c1
976 nmdc:mga08y16_467985_c1
977 nmdc:mga08y16_5126_c1
978 nmdc:mga08y16_69620_c1
979 nmdc:mga08y16_71270_c1
980 nmdc:mga08y16_932_c1
981 nmdc:mga0n895_11532_c1
982 nmdc:mga0n895_136193_c1
983 nmdc:mga0n895_31290_c1
984 nmdc:mga0n895_38644_c1
985 nmdc:mga0rr50_144325_c1
986 nmdc:mga0a205_105220_c1
987 nmdc:mga0a205_16692_c1
988 nmdc:mga0a205_204701_c1
989 nmdc:mga0a205_245445_c1
990 nmdc:mga0a205_36869_c1
991 nmdc:mga0a205_45719_c1
992 Ga0501084_0187371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

46

247

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1win-assembly1.cif.gz_A solution structure of the band 7 domain of the mouse flotillin 2 protein 0.7948 87 224
7wh3-assembly1.cif.gz_A solution structure of human stomatin spfh domain in a phosphate buffer 0.7918 87 218
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.7843 93 217
2rpb-assembly1.cif.gz_A the solution structure of membrane protein 0.7624 87 218
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.7581 93 217
ID Description Score Start End Superfamily
af_A4IAQ8_67_201_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8684 88 229 3.30.479.30
af_Q4CPV3_34_164_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8612 87 228 3.30.479.30
af_A0A1D8PTU3_111_221_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8577 87 218 3.30.479.30
af_O35129_80_184_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8555 87 210 3.30.479.30
af_O49460_91_184_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8538 106 215 3.30.479.30
ID Description Score Start End GO Terms
AF-A0A354EAW8-F1-model_v4 deleted 0.9219 21 218
AF-A0A6V8MCK5-F1-model_v4 deleted 0.8796 94 225
AF-A0A641W2U5-F1-model_v4 deleted 0.8594 21 132
AF-A0A354EAW8-F1-model_v4 deleted 0.8555 21 218
AF-A0A433VJH7-F1-model_v4 Band 7 domain-containing protein 0.8524 87 225 GO:0005886

Map