F454823

General Info

Members Datasets Scaffolds Average Seq Length
496 247 992 245

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10018159|JGI25406J46586_100181592
Length 278
Sequence MALMRPGVDGLDGTPDEVVGDNRAMSALRAKCPDCRTLTAVAYDDVYECHSCGREFAAGLVRVPRAWGAGGDAMAEAAATAMPYPEALVVESDTLAGQSDAIAGGLPRRPLVLGGCCCSHVGAIRGLAARTDRLAVVWLDAHGDLNTPETSPSGNAWGMPLRMAIDEGSVRTDDVALVGARDLDPPEQQYVAEHGIDDDLARALDGVGAAYIALDVDVLAPGSVPCFMPAPGGPSVDDVASILADVARRTRVLGLGITGLAPGADPQVLARFAAAAGL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
139 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
140 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.48
Rhizosphere 89.72
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10018159 3300003203 Bacteria 2895
2 JGI25407J50210_10000027 3300003373 Bacteria 15777
3 JGI25407J50210_10003803 3300003373 Bacteria 3647
4 Ga0070683_100011736 3300005329 Bacteria 7586
5 Ga0070683_100100040 3300005329 Bacteria 2729
6 Ga0068869_100297750 3300005334 Bacteria 1302
7 Ga0070680_100363948 3300005336 Bacteria 1230
8 Ga0070682_100005680 3300005337 Bacteria 6955
9 Ga0068868_100037104 3300005338 Bacteria 3777
10 Ga0068868_100239643 3300005338 Bacteria 1523
11 Ga0070660_100000720 3300005339 Bacteria 21933
12 Ga0070660_100002517 3300005339 Bacteria 12559
13 Ga0070660_100161581 3300005339 Bacteria 1805
14 Ga0070661_100127007 3300005344 Bacteria 1913
15 Ga0070692_10005257 3300005345 Bacteria 5495
16 Ga0070692_10072335 3300005345 Bacteria 1840
17 Ga0070668_100070242 3300005347 Bacteria 2726
18 Ga0070675_100010660 3300005354 Bacteria 7186
19 Ga0070671_100080173 3300005355 Bacteria 2729
20 Ga0070671_100088839 3300005355 Bacteria 2586
21 Ga0070674_100024072 3300005356 Bacteria 3949
22 Ga0070674_100107883 3300005356 Bacteria 2039
23 Ga0070673_100208887 3300005364 Bacteria 1685
24 Ga0070673_100227993 3300005364 Bacteria 1615
25 Ga0070673_100524714 3300005364 Bacteria 1074
26 Ga0070688_100215875 3300005365 Bacteria 1349
27 Ga0070700_100320365 3300005441 Bacteria 1139
28 Ga0070694_100226905 3300005444 Bacteria 1403
29 Ga0070663_100030641 3300005455 Bacteria 3689
30 Ga0070663_100415296 3300005455 Bacteria 1103
31 Ga0070678_100032631 3300005456 Bacteria 3606
32 Ga0070662_100019687 3300005457 Bacteria 4585
33 Ga0070662_100093655 3300005457 Bacteria 2260
34 Ga0070681_10006125 3300005458 Bacteria 11675
35 Ga0070681_10021523 3300005458 Bacteria 6463
36 Ga0068867_100189886 3300005459 Bacteria 1639
37 Ga0068867_100218861 3300005459 Bacteria 1533
38 Ga0070685_10005718 3300005466 Bacteria 6315
39 Ga0070698_100384558 3300005471 Bacteria 1336
40 Ga0070698_100635972 3300005471 Bacteria 1008
41 Ga0070684_100097909 3300005535 Bacteria 2616
42 Ga0070684_100187403 3300005535 Unclassified 1882
43 Ga0070684_100314937 3300005535 Bacteria 1437
44 Ga0068853_100082527 3300005539 Bacteria 2815
45 Ga0070672_100009986 3300005543 Bacteria 6568
46 Ga0070686_100015935 3300005544 Bacteria 4365
47 Ga0070686_100081383 3300005544 Bacteria 2145
48 Ga0070696_100039838 3300005546 Bacteria 3244
49 Ga0070693_100091347 3300005547 Bacteria 1836
50 Ga0070665_100050795 3300005548 Bacteria 4161
51 Ga0070704_100034061 3300005549 Bacteria 3450
52 Ga0068855_100044561 3300005563 Bacteria 5250
53 Ga0068855_100066982 3300005563 Bacteria 4186
54 Ga0068855_100158392 3300005563 Bacteria 2571
55 Ga0068855_100194858 3300005563 Bacteria 2283
56 Ga0070664_100007972 3300005564 Bacteria 8555
57 Ga0070664_100040760 3300005564 Bacteria 3916
58 Ga0068857_100098174 3300005577 Bacteria 2627
59 Ga0068854_100315610 3300005578 Bacteria 1269
60 Ga0068856_100293475 3300005614 Bacteria 1643
61 Ga0068856_100396331 3300005614 Unclassified 1400
62 Ga0070702_100030136 3300005615 Bacteria 2955
63 Ga0070702_100076064 3300005615 Bacteria 1997
64 Ga0070702_100227278 3300005615 Bacteria 1251
65 Ga0068852_100004068 3300005616 Bacteria 10287
66 Ga0068852_100154181 3300005616 Bacteria 2138
67 Ga0068859_100671607 3300005617 Bacteria 1127
68 Ga0068864_100018779 3300005618 Bacteria 5778
69 Ga0068866_10246333 3300005718 Unclassified 1091
70 Ga0068861_100404763 3300005719 Bacteria 1212
71 Ga0068861_100459203 3300005719 Unclassified 1143
72 Ga0068870_10006451 3300005840 Bacteria 5172
73 Ga0068858_100141759 3300005842 Bacteria 2256
74 Ga0068862_100167164 3300005844 Bacteria 1967
75 Ga0081538_10000100 3300005981 Bacteria 83917
76 Ga0081538_10000820 3300005981 Bacteria 33705
77 Ga0081539_10000095 3300005985 Bacteria 204474
78 Ga0081539_10003675 3300005985 Bacteria 18388
79 Ga0075432_10010556 3300006058 Bacteria 3137
80 Ga0097621_100271345 3300006237 Bacteria 1491
81 Ga0068871_100328167 3300006358 Unclassified 1349
82 Ga0075431_100012238 3300006847 Bacteria 8662
83 Ga0075433_10041181 3300006852 Bacteria 4001
84 Ga0075433_10066469 3300006852 Bacteria 3164
85 Ga0075434_100006907 3300006871 Bacteria 10459
86 Ga0075434_100162866 3300006871 Bacteria 2250
87 Ga0068865_100024843 3300006881 Bacteria 3935
88 Ga0075436_100014823 3300006914 Bacteria 5341
89 Ga0075436_100124608 3300006914 Bacteria 1805
90 Ga0097620_100671642 3300006931 Bacteria 1127
91 Ga0075435_100054657 3300007076 Bacteria 3223
92 Ga0075435_100114669 3300007076 Bacteria 2243
93 Ga0105240_10397617 3300009093 Bacteria 1553
94 Ga0111539_10051397 3300009094 Bacteria 4909
95 Ga0111539_10237661 3300009094 Bacteria 2121
96 Ga0105245_10007510 3300009098 Bacteria 9553
97 Ga0105245_10046716 3300009098 Bacteria 3869
98 Ga0105245_10052374 3300009098 Bacteria 3661
99 Ga0105247_10082887 3300009101 Bacteria 2024
100 Ga0114129_10113160 3300009147 Bacteria 3742
101 Ga0105243_10048965 3300009148 Bacteria 3333
102 Ga0105242_10015277 3300009176 Bacteria 5962
103 Ga0105242_10017968 3300009176 Bacteria 5524
104 Ga0105242_10651242 3300009176 Unclassified 1024
105 Ga0105238_10023331 3300009551 Bacteria 6307
106 Ga0105238_10421458 3300009551 Bacteria 1330
107 Ga0105239_10012112 3300010375 Bacteria 9616
108 Ga0105239_10023060 3300010375 Bacteria 6862
109 Ga0105239_10880437 3300010375 Unclassified 1027
110 Ga0105246_10230163 3300011119 Bacteria 1459
111 Ga0157370_10219818 3300013104 Bacteria 1760
112 Ga0157369_10002737 3300013105 Bacteria 21049
113 Ga0157369_10328575 3300013105 Bacteria 1589
114 Ga0157374_10004867 3300013296 Bacteria 11269
115 Ga0163162_10364107 3300013306 Unclassified 1579
116 Ga0157375_10010072 3300013308 Bacteria 8313
117 Ga0157375_10100681 3300013308 Bacteria 2971
118 Ga0157375_10152581 3300013308 Bacteria 2447
119 Ga0157375_10561539 3300013308 Unclassified 1302
120 Ga0163163_10205325 3300014325 Bacteria 2019
121 Ga0157380_10043434 3300014326 Bacteria 3520
122 Ga0157377_10001694 3300014745 Bacteria 9608
123 Ga0157377_10010196 3300014745 Bacteria 4639
124 Ga0157377_10033714 3300014745 Bacteria 2797
125 Ga0157379_10036230 3300014968 Bacteria 4399
126 Ga0206353_10423363 3300020082 Bacteria 10620
127 Ga0207688_10010965 3300025901 Bacteria 4932
128 Ga0207688_10024260 3300025901 Bacteria 3325
129 Ga0207688_10025955 3300025901 Bacteria 3220
130 Ga0207688_10067601 3300025901 Bacteria 2022
131 Ga0207688_10131693 3300025901 Unclassified 1466
132 Ga0207647_10154892 3300025904 Bacteria 1338
133 Ga0207643_10103463 3300025908 Bacteria 1672
134 Ga0207643_10207037 3300025908 Bacteria 1196
135 Ga0207707_10074720 3300025912 Bacteria 2956
136 Ga0207707_10211294 3300025912 Bacteria 1690
137 Ga0207657_10006020 3300025919 Bacteria 12619
138 Ga0207657_10017031 3300025919 Bacteria 6990
139 Ga0207649_10111933 3300025920 Bacteria 1825
140 Ga0207652_10028324 3300025921 Bacteria 4674
141 Ga0207694_10118599 3300025924 Bacteria 2111
142 Ga0207650_10124900 3300025925 Bacteria 2008
143 Ga0207659_10594922 3300025926 Bacteria 943
144 Ga0207687_10014806 3300025927 Bacteria 5108
145 Ga0207687_10021242 3300025927 Bacteria 4311
146 Ga0207687_10300613 3300025927 Bacteria 1293
147 Ga0207700_10414035 3300025928 Bacteria 1183
148 Ga0207706_10013222 3300025933 Bacteria 7509
149 Ga0207706_10071564 3300025933 Bacteria 3050
150 Ga0207706_10184075 3300025933 Bacteria 1834
151 Ga0207686_10021897 3300025934 Bacteria 3674
152 Ga0207686_10249806 3300025934 Bacteria 1295
153 Ga0207709_10011887 3300025935 Bacteria 4801
154 Ga0207709_10013259 3300025935 Bacteria 4547
155 Ga0207670_10020653 3300025936 Bacteria 4051
156 Ga0207669_10013110 3300025937 Bacteria 4104
157 Ga0207691_10004877 3300025940 Bacteria 12969
158 Ga0207689_10033325 3300025942 Bacteria 4281
159 Ga0207661_10013058 3300025944 Bacteria 6061
160 Ga0207661_10019477 3300025944 Bacteria 5060
161 Ga0207661_10088939 3300025944 Bacteria 2568
162 Ga0207661_10322583 3300025944 Bacteria 1389
163 Ga0207679_10180952 3300025945 Bacteria 1744
164 Ga0207679_10295049 3300025945 Bacteria 1395
165 Ga0207667_10156120 3300025949 Bacteria 2348
166 Ga0207667_10294102 3300025949 Bacteria 1659
167 Ga0207712_10109063 3300025961 Bacteria 2073
168 Ga0207640_10057075 3300025981 Bacteria 2566
169 Ga0207640_10503305 3300025981 Bacteria 1009
170 Ga0207677_10008162 3300026023 Bacteria 5831
171 Ga0207677_10035148 3300026023 Bacteria 3251
172 Ga0207677_10198082 3300026023 Bacteria 1594
173 Ga0207703_10053556 3300026035 Bacteria 3279
174 Ga0207639_10055436 3300026041 Bacteria 3034
175 Ga0207639_10056218 3300026041 Bacteria 3015
176 Ga0207678_10012670 3300026067 Bacteria 7410
177 Ga0207678_10061527 3300026067 Bacteria 3229
178 Ga0207708_10135648 3300026075 Bacteria 1927
179 Ga0207702_10098545 3300026078 Bacteria 2575
180 Ga0207648_10022151 3300026089 Bacteria 5708
181 Ga0207648_10201052 3300026089 Bacteria 1767
182 Ga0207675_100015032 3300026118 Bacteria 7222
183 Ga0207683_10050345 3300026121 Bacteria 3649
184 Ga0207683_10104957 3300026121 Bacteria 2525
185 Ga0207698_10020177 3300026142 Bacteria 4582
186 Ga0207428_10007743 3300027907 Bacteria 9772
187 Ga0265318_10015047 3300028577 Bacteria 3230
188 Ga0265318_10039816 3300028577 Bacteria 1792
189 Ga0265340_10020266 3300031247 Bacteria 3420
190 Ga0307407_10053321 3300031903 Bacteria 2326
191 Ga0307409_100247377 3300031995 Bacteria 1628
192 Ga0373958_0005388 3300034819 Bacteria 1943
193 Ga0373926_0140714 3300035083 Archaea 916
194 Ga0373944_0001142 3300035089 Bacteria 6615
195 Ga0373949_0025109 3300035090 Bacteria 1389
196 Ga0373936_0009991 3300035113 Bacteria 3583
197 Ga0373936_0011467 3300035113 Bacteria 3355
198 Ga0373945_0004461 3300035116 Bacteria 4450
199 Ga0373943_0001097 3300035170 Bacteria 12064
200 Ga0373943_0005693 3300035170 Bacteria 5590
201 Ga0373946_0003443 3300035171 Bacteria 5618
202 Ga0373946_0036187 3300035171 Bacteria 2000
203 Ga0373931_0077168 3300035691 Bacteria 1831
204 Ga0373935_0001485 3300035692 Bacteria 13029
205 Ga0373947_0000716 3300035725 Bacteria 19733
206 Ga0373947_0072519 3300035725 Bacteria 2114
207 Ga0373925_0004218 3300037068 Bacteria 10914
208 Ga0373925_0014559 3300037068 Bacteria 5684
209 Ga0395899_0217714 3300037312 Unclassified 1324
210 Ga0395899_0227573 3300037312 Bacteria 1289
211 Ga0395900_0058692 3300037418 Bacteria 3961
212 Ga0395900_0080811 3300037418 Bacteria 3340
213 Ga0395900_0387054 3300037418 Archaea 1365
214 Ga0395900_0388388 3300037418 Bacteria 1362
215 Ga0395898_0000824 3300037466 Bacteria 51781
216 Ga0395898_0048684 3300037466 Bacteria 4155
217 Ga0395898_0064691 3300037466 Bacteria 3547
218 Ga0395898_0234214 3300037466 Unclassified 1751
219 Ga0395898_0374278 3300037466 Bacteria 1358
220 Ga0395905_0016484 3300037471 Bacteria 7025
221 Ga0395905_0025583 3300037471 Bacteria 5566
222 Ga0395905_0119549 3300037471 Unclassified 2476
223 Ga0395905_0659723 3300037471 Bacteria 948
224 Ga0395905_0724619 3300037471 Bacteria 897
225 Ga0395901_0001584 3300038443 Bacteria 23533
226 Ga0395901_0007695 3300038443 Bacteria 10870
227 Ga0395901_0046502 3300038443 Bacteria 4508
228 Ga0395901_0080146 3300038443 Bacteria 3408
229 Ga0395901_0172503 3300038443 Bacteria 2269
230 Ga0395901_0324709 3300038443 Bacteria 1592
231 Ga0451793_0517103 3300041452 Bacteria 3786
232 Ga0451802_0282035 3300041460 Bacteria 2961
233 Ga0451835_0239164 3300041492 Bacteria 2220
234 Ga0451839_0591998 3300041496 Bacteria 1730
235 Ga0451851_0673288 3300041507 Bacteria 2872
236 Ga0451853_2179165 3300041512 Bacteria 1665
237 Ga0450916_001900 3300042530 Bacteria 2148
238 Ga0466966_0056855 3300044684 Bacteria 2474
239 Ga0466963_0157331 3300044694 Bacteria 1580
240 Ga0466963_0298369 3300044694 Bacteria 1133
241 Ga0466963_0860382 3300044694 Bacteria 639
242 Ga0466968_0238753 3300044735 Unclassified 860
243 Ga0466959_0035624 3300045049 Bacteria 3679
244 Ga0466967_0030659 3300045976 Bacteria 4515
245 Ga0466967_0037354 3300045976 Bacteria 4155
246 Ga0466967_0049548 3300045976 Bacteria 3673
247 Ga0466967_0054326 3300045976 Bacteria 3524
248 Ga0466967_0662760 3300045976 Bacteria 1032
249 Ga0495592_0014829 3300046454 Bacteria 5917
250 Ga0495592_0129477 3300046454 Bacteria 1767
251 Ga0495603_0136402 3300046455 Bacteria 1428
252 Ga0495603_0140087 3300046455 Unclassified 1407
253 Ga0495629_0022886 3300046459 Bacteria 4453
254 Ga0495629_0060283 3300046459 Bacteria 2652
255 Ga0495641_0004541 3300046461 Bacteria 9752
256 Ga0495641_0022779 3300046461 Bacteria 3127
257 Ga0495641_0053903 3300046461 Bacteria 1828
258 Ga0495651_0014865 3300046462 Bacteria 6019
259 Ga0495653_0069588 3300046463 Archaea 2636
260 Ga0495653_0097240 3300046463 Archaea 2139
261 Ga0495582_0000276 3300046473 Bacteria 28706
262 Ga0495605_0033673 3300046474 Bacteria 2599
263 Ga0495639_0000416 3300046475 Bacteria 20358
264 Ga0495662_0016830 3300046476 Bacteria 3538
265 Ga0495662_0044269 3300046476 Archaea 2149
266 Ga0495664_0024484 3300046477 Bacteria 3509
267 Ga0495664_0397245 3300046477 Bacteria 828
268 Ga0495608_0018765 3300046511 Bacteria 4766
269 Ga0495608_0095101 3300046511 Archaea 1925
270 Ga0495618_0019225 3300046514 Bacteria 4201
271 Ga0495628_0115820 3300046516 Bacteria 2058
272 Ga0495628_0146150 3300046516 Bacteria 1802
273 Ga0495630_0001315 3300046517 Bacteria 17081
274 Ga0495630_0010880 3300046517 Bacteria 6570
275 Ga0495630_0360099 3300046517 Bacteria 1113
276 Ga0495652_0044204 3300046529 Bacteria 3837
277 Ga0495665_0006870 3300046531 Bacteria 6141
278 Ga0495640_0004359 3300046533 Bacteria 11296
279 Ga0495640_0025119 3300046533 Bacteria 4327
280 Ga0495640_0036365 3300046533 Bacteria 3479
281 Ga0495645_0083597 3300046543 Bacteria 2288
282 Ga0495667_0001711 3300046559 Bacteria 14566
283 Ga0495667_0027735 3300046559 Bacteria 3813
284 Ga0495667_0190966 3300046559 Archaea 1312
285 Ga0495634_0039736 3300046642 Bacteria 3202
286 Ga0495634_0241141 3300046642 Bacteria 1109
287 Ga0495635_0003672 3300046663 Bacteria 10640
288 Ga0495635_0053470 3300046663 Archaea 2782
289 Ga0495657_0201374 3300046675 Archaea 1213
290 Ga0495599_0051805 3300046678 Bacteria 2572
291 Ga0495647_0033891 3300046681 Archaea 1910
292 Ga0495658_0002918 3300046683 Bacteria 8581
293 Ga0495658_0029456 3300046683 Bacteria 2973
294 Ga0495658_0087743 3300046683 Bacteria 1837
295 Ga0495613_0030231 3300046689 Bacteria 4023
296 Ga0495613_0062130 3300046689 Bacteria 2734
297 Ga0495613_0319341 3300046689 Archaea 1072
298 Ga0495624_0004610 3300046690 Bacteria 10051
299 Ga0495600_0007224 3300046809 Bacteria 6779
300 Ga0495600_0139527 3300046809 Bacteria 1573
301 Ga0495581_0007163 3300047315 Bacteria 6457
302 Ga0495604_0022360 3300047317 Bacteria 5049
303 Ga0495674_0002208 3300047319 Bacteria 19139
304 Ga0495676_0011130 3300047321 Bacteria 8129
305 Ga0495676_0196329 3300047321 Bacteria 1405
306 Ga0495680_0008719 3300047322 Bacteria 9189
307 Ga0495680_0031251 3300047322 Bacteria 4336
308 Ga0495680_0073763 3300047322 Bacteria 2592
309 Ga0495675_0064223 3300047444 Bacteria 2322
310 Ga0495675_0164468 3300047444 Archaea 1365
311 Ga0495684_0020683 3300047471 Bacteria 5070
312 Ga0495684_0027345 3300047471 Bacteria 4379
313 Ga0495684_0051531 3300047471 Bacteria 3141
314 Ga0495602_0107641 3300048088 Bacteria 2272
315 Ga0495602_0132129 3300048088 Bacteria 1989
316 Ga0495614_0010048 3300048089 Bacteria 4178
317 Ga0496100_0095490 3300048903 Bacteria 2038
318 Ga0496100_0101888 3300048903 Bacteria 1980
319 Ga0496100_0313067 3300048903 Unclassified 1177
320 Ga0496100_0405444 3300048903 Unclassified 1039
321 Ga0496101_0005250 3300048904 Bacteria 8243
322 Ga0496101_0036572 3300048904 Bacteria 3478
323 Ga0496101_0054031 3300048904 Bacteria 2900
324 Ga0496101_0115515 3300048904 Bacteria 2024
325 Ga0496101_0271167 3300048904 Bacteria 1325
326 Ga0496102_0108064 3300048905 Bacteria 2591
327 Ga0496102_0109739 3300048905 Bacteria 2571
328 Ga0496103_0030574 3300048906 Bacteria 3278
329 Ga0496104_0108109 3300048907 Bacteria 2665
330 Ga0496104_0168091 3300048907 Bacteria 2103
331 Ga0496105_0003601 3300048908 Bacteria 11503
332 Ga0496105_0085851 3300048908 Bacteria 2601
333 Ga0496105_0098957 3300048908 Bacteria 2408
334 Ga0496105_0152894 3300048908 Bacteria 1896
335 Ga0496106_0011679 3300048909 Bacteria 6487
336 Ga0496106_0293610 3300048909 Bacteria 1303
337 Ga0496107_0012425 3300048910 Bacteria 5945
338 Ga0496107_0074484 3300048910 Bacteria 2470
339 Ga0496108_0024857 3300048911 Bacteria 4932
340 Ga0496108_0159622 3300048911 Bacteria 1948
341 Ga0496108_0182600 3300048911 Bacteria 1817
342 Ga0496109_0009128 3300048912 Bacteria 8443
343 Ga0496109_0066034 3300048912 Bacteria 3312
344 Ga0496109_0108126 3300048912 Bacteria 2584
345 Ga0496109_0416126 3300048912 Unclassified 1270
346 Ga0496109_0677222 3300048912 Bacteria 969
347 Ga0496110_0012799 3300048913 Bacteria 6909
348 Ga0496110_0299995 3300048913 Unclassified 1463
349 Ga0496110_0305485 3300048913 Bacteria 1449
350 Ga0496110_0459997 3300048913 Unclassified 1159
351 Ga0496111_0132595 3300048914 Bacteria 1844
352 Ga0496112_0380918 3300048915 Bacteria 1352
353 Ga0496113_0050959 3300048916 Bacteria 3088
354 Ga0496114_0001985 3300048917 Bacteria 15563
355 Ga0496114_0003682 3300048917 Bacteria 11789
356 Ga0496114_0044458 3300048917 Bacteria 3685
357 Ga0496114_0278127 3300048917 Bacteria 1475
358 Ga0496114_0347346 3300048917 Unclassified 1312
359 Ga0496115_0051618 3300048918 Bacteria 3297
360 Ga0496115_0145352 3300048918 Bacteria 1957
361 Ga0496115_0172275 3300048918 Bacteria 1790
362 Ga0501031_0003101 3300049568 Bacteria 10644
363 Ga0501031_0006768 3300049568 Bacteria 7477
364 Ga0501031_0012610 3300049568 Bacteria 5520
365 Ga0501032_0016364 3300049569 Bacteria 5218
366 Ga0501032_0053647 3300049569 Bacteria 2714
367 Ga0501032_0093345 3300049569 Bacteria 1996
368 Ga0501032_0174155 3300049569 Bacteria 1410
369 Ga0501033_0012235 3300049570 Bacteria 6550
370 Ga0501033_0028901 3300049570 Bacteria 4166
371 Ga0501033_0162280 3300049570 Unclassified 1608
372 Ga0501033_0193467 3300049570 Bacteria 1455
373 Ga0501036_0002934 3300049572 Bacteria 13537
374 Ga0501036_0004106 3300049572 Bacteria 11716
375 Ga0501036_0080084 3300049572 Bacteria 2761
376 Ga0501036_0080334 3300049572 Bacteria 2757
377 Ga0501037_0011701 3300049573 Bacteria 6459
378 Ga0501037_0056230 3300049573 Bacteria 2874
379 Ga0501038_0000446 3300049574 Bacteria 36005
380 Ga0501038_0015708 3300049574 Bacteria 6880
381 Ga0501038_0220211 3300049574 Bacteria 1514
382 Ga0501039_0008269 3300049575 Bacteria 7930
383 Ga0501039_0056472 3300049575 Bacteria 3041
384 Ga0501039_0138491 3300049575 Bacteria 1911
385 Ga0501040_0024153 3300049576 Bacteria 4078
386 Ga0501040_0072948 3300049576 Bacteria 2371
387 Ga0501040_0142839 3300049576 Bacteria 1686
388 Ga0501041_0002296 3300049577 Bacteria 10820
389 Ga0501041_0004264 3300049577 Bacteria 8278
390 Ga0501041_0015977 3300049577 Bacteria 4460
391 Ga0501042_0004021 3300049578 Bacteria 9315
392 Ga0501042_0061030 3300049578 Bacteria 2693
393 Ga0501043_0006223 3300049579 Bacteria 9587
394 Ga0501043_0119734 3300049579 Bacteria 2064
395 Ga0501043_0269351 3300049579 Bacteria 1308
396 Ga0501046_0004564 3300049580 Bacteria 12535
397 Ga0501046_0006055 3300049580 Bacteria 10759
398 Ga0501048_0003885 3300049582 Bacteria 11368
399 Ga0501048_0014225 3300049582 Bacteria 5893
400 Ga0501048_0024784 3300049582 Bacteria 4376
401 Ga0501067_0003760 3300049583 Bacteria 8364
402 Ga0501068_0012167 3300049584 Bacteria 4866
403 Ga0501068_0049880 3300049584 Bacteria 2529
404 Ga0501068_0103658 3300049584 Bacteria 1764
405 Ga0501069_0003370 3300049585 Bacteria 8209
406 Ga0501069_0007738 3300049585 Bacteria 5639
407 Ga0501069_0030128 3300049585 Bacteria 2979
408 Ga0501069_0098215 3300049585 Unclassified 1661
409 Ga0501069_0155678 3300049585 Bacteria 1314
410 Ga0501070_0000256 3300049586 Bacteria 50155
411 Ga0501070_0088669 3300049586 Bacteria 2560
412 Ga0501070_0134295 3300049586 Bacteria 2043
413 Ga0501070_0289425 3300049586 Bacteria 1335
414 Ga0501070_0312490 3300049586 Bacteria 1279
415 Ga0501071_0003757 3300049587 Bacteria 9531
416 Ga0501071_0005713 3300049587 Bacteria 8022
417 Ga0501071_0007264 3300049587 Bacteria 7252
418 Ga0501071_0014473 3300049587 Bacteria 5395
419 Ga0501071_0073455 3300049587 Bacteria 2495
420 Ga0501072_0003882 3300049588 Bacteria 11301
421 Ga0501072_0011211 3300049588 Bacteria 6841
422 Ga0501072_0012429 3300049588 Bacteria 6504
423 Ga0501072_0022857 3300049588 Bacteria 4852
424 Ga0501072_0249581 3300049588 Unclassified 1413
425 Ga0501073_0009788 3300049589 Bacteria 7056
426 Ga0501073_0014762 3300049589 Bacteria 5673
427 Ga0501073_0022769 3300049589 Bacteria 4507
428 Ga0501074_0011671 3300049590 Bacteria 6385
429 Ga0501074_0026917 3300049590 Bacteria 4168
430 Ga0501074_0040075 3300049590 Bacteria 3392
431 Ga0501075_0002256 3300049591 Bacteria 12770
432 Ga0501075_0056732 3300049591 Bacteria 2949
433 Ga0501075_0245608 3300049591 Bacteria 1364
434 Ga0501076_0001348 3300049592 Bacteria 16417
435 Ga0501076_0010235 3300049592 Bacteria 6952
436 Ga0501076_0013642 3300049592 Bacteria 6096
437 Ga0501076_0056972 3300049592 Bacteria 3102
438 Ga0501076_0094306 3300049592 Bacteria 2410
439 Ga0501077_0006353 3300049593 Bacteria 7242
440 Ga0501077_0015852 3300049593 Bacteria 4747
441 Ga0501077_0050792 3300049593 Bacteria 2635
442 Ga0501079_0046761 3300049741 Bacteria 3339
443 Ga0501079_0088723 3300049741 Bacteria 2394
444 Ga0501080_0001199 3300049742 Bacteria 21483
445 Ga0501080_0009698 3300049742 Bacteria 8792
446 Ga0501080_0012671 3300049742 Bacteria 7732
447 Ga0501080_0256382 3300049742 Unclassified 1594
448 Ga0501081_0006008 3300049743 Bacteria 7860
449 Ga0501081_0071468 3300049743 Bacteria 2419
450 Ga0501081_0142262 3300049743 Bacteria 1719
451 Ga0501081_0180350 3300049743 Bacteria 1527
452 Ga0501081_0259221 3300049743 Bacteria 1270
453 Ga0501083_0046974 3300049744 Bacteria 2919
454 Ga0501083_0102248 3300049744 Bacteria 1889
455 Ga0501035_0015690 3300049822 Bacteria 6992
456 Ga0501035_0036231 3300049822 Bacteria 4472
457 Ga0501035_0253151 3300049822 Bacteria 1495
458 Ga0501044_0073211 3300049823 Bacteria 3483
459 Ga0501044_0113538 3300049823 Bacteria 2716
460 Ga0501044_0133694 3300049823 Bacteria 2473
461 Ga0501044_0156849 3300049823 Bacteria 2255
462 Ga0501045_0006752 3300049824 Bacteria 7947
463 Ga0501045_0062632 3300049824 Bacteria 2729
464 Ga0501045_0063490 3300049824 Bacteria 2710
465 Ga0501045_0145705 3300049824 Bacteria 1761
466 nmdc:mga05p37_220889_c1 3300050507 Unclassified 2287
467 nmdc:mga06r32_20126_c1 3300050510 Bacteria 6139
468 nmdc:mga08y16_365110_c1 3300050511 Bacteria 1482
469 nmdc:mga08y16_398177_c1 3300050511 Unclassified 1410
470 nmdc:mga0n895_36046_c1 3300050512 Bacteria 4774
471 nmdc:mga0n895_9121_c1 3300050512 Bacteria 8658
472 nmdc:mga0rr50_13244_c1 3300050513 Bacteria 5362
473 nmdc:mga0rr50_28630_c1 3300050513 Bacteria 3919
474 nmdc:mga08x19_4610_c1 3300050514 Bacteria 8184
475 nmdc:mga0a205_180789_c1 3300050515 Unclassified 2003
476 nmdc:mga0a205_5385_c1 3300050515 Bacteria 9949
477 Ga0495601_0285468 3300053077 Archaea 1076
478 Ga0495612_0065602 3300053078 Bacteria 1508
479 Ga0495595_0041012 3300053084 Bacteria 2116
480 Ga0495595_0221026 3300053084 Archaea 945
481 Ga0495619_0003843 3300053085 Bacteria 9668
482 Ga0495619_0005855 3300053085 Bacteria 7790
483 Ga0495619_0072775 3300053085 Bacteria 2302
484 Ga0501084_0004599 3300054114 Bacteria 11278
485 Ga0501084_0010402 3300054114 Bacteria 7692
486 Ga0501084_0015465 3300054114 Bacteria 6328
487 Ga0501084_0022033 3300054114 Bacteria 5314
488 Ga0501084_1063805 3300054114 Bacteria 679
489 Ga0590075_005055 3300059424 Bacteria 3117
490 Ga0501082_0003737 3300060353 Bacteria 13299
491 Ga0501082_0010001 3300060353 Bacteria 8178
492 Ga0501082_0017983 3300060353 Bacteria 6088
493 Ga0530510_0003882 3300061734 Bacteria 10307
494 Ga0530510_0004406 3300061734 Bacteria 9750
495 Ga0530510_0015694 3300061734 Bacteria 5353
496 Ga0530510_0022704 3300061734 Bacteria 4470
497 JGI25406J46586_10018159
498 JGI25407J50210_10000027
499 JGI25407J50210_10003803
500 Ga0070683_100011736
501 Ga0070683_100100040
502 Ga0068869_100297750
503 Ga0070680_100363948
504 Ga0070682_100005680
505 Ga0068868_100037104
506 Ga0068868_100239643
507 Ga0070660_100000720
508 Ga0070660_100002517
509 Ga0070660_100161581
510 Ga0070661_100127007
511 Ga0070692_10005257
512 Ga0070692_10072335
513 Ga0070668_100070242
514 Ga0070675_100010660
515 Ga0070671_100080173
516 Ga0070671_100088839
517 Ga0070674_100024072
518 Ga0070674_100107883
519 Ga0070673_100208887
520 Ga0070673_100227993
521 Ga0070673_100524714
522 Ga0070688_100215875
523 Ga0070700_100320365
524 Ga0070694_100226905
525 Ga0070663_100030641
526 Ga0070663_100415296
527 Ga0070678_100032631
528 Ga0070662_100019687
529 Ga0070662_100093655
530 Ga0070681_10006125
531 Ga0070681_10021523
532 Ga0068867_100189886
533 Ga0068867_100218861
534 Ga0070685_10005718
535 Ga0070698_100384558
536 Ga0070698_100635972
537 Ga0070684_100097909
538 Ga0070684_100187403
539 Ga0070684_100314937
540 Ga0068853_100082527
541 Ga0070672_100009986
542 Ga0070686_100015935
543 Ga0070686_100081383
544 Ga0070696_100039838
545 Ga0070693_100091347
546 Ga0070665_100050795
547 Ga0070704_100034061
548 Ga0068855_100044561
549 Ga0068855_100066982
550 Ga0068855_100158392
551 Ga0068855_100194858
552 Ga0070664_100007972
553 Ga0070664_100040760
554 Ga0068857_100098174
555 Ga0068854_100315610
556 Ga0068856_100293475
557 Ga0068856_100396331
558 Ga0070702_100030136
559 Ga0070702_100076064
560 Ga0070702_100227278
561 Ga0068852_100004068
562 Ga0068852_100154181
563 Ga0068859_100671607
564 Ga0068864_100018779
565 Ga0068866_10246333
566 Ga0068861_100404763
567 Ga0068861_100459203
568 Ga0068870_10006451
569 Ga0068858_100141759
570 Ga0068862_100167164
571 Ga0081538_10000100
572 Ga0081538_10000820
573 Ga0081539_10000095
574 Ga0081539_10003675
575 Ga0075432_10010556
576 Ga0097621_100271345
577 Ga0068871_100328167
578 Ga0075431_100012238
579 Ga0075433_10041181
580 Ga0075433_10066469
581 Ga0075434_100006907
582 Ga0075434_100162866
583 Ga0068865_100024843
584 Ga0075436_100014823
585 Ga0075436_100124608
586 Ga0097620_100671642
587 Ga0075435_100054657
588 Ga0075435_100114669
589 Ga0105240_10397617
590 Ga0111539_10051397
591 Ga0111539_10237661
592 Ga0105245_10007510
593 Ga0105245_10046716
594 Ga0105245_10052374
595 Ga0105247_10082887
596 Ga0114129_10113160
597 Ga0105243_10048965
598 Ga0105242_10015277
599 Ga0105242_10017968
600 Ga0105242_10651242
601 Ga0105238_10023331
602 Ga0105238_10421458
603 Ga0105239_10012112
604 Ga0105239_10023060
605 Ga0105239_10880437
606 Ga0105246_10230163
607 Ga0157370_10219818
608 Ga0157369_10002737
609 Ga0157369_10328575
610 Ga0157374_10004867
611 Ga0163162_10364107
612 Ga0157375_10010072
613 Ga0157375_10100681
614 Ga0157375_10152581
615 Ga0157375_10561539
616 Ga0163163_10205325
617 Ga0157380_10043434
618 Ga0157377_10001694
619 Ga0157377_10010196
620 Ga0157377_10033714
621 Ga0157379_10036230
622 Ga0206353_10423363
623 Ga0207688_10010965
624 Ga0207688_10024260
625 Ga0207688_10025955
626 Ga0207688_10067601
627 Ga0207688_10131693
628 Ga0207647_10154892
629 Ga0207643_10103463
630 Ga0207643_10207037
631 Ga0207707_10074720
632 Ga0207707_10211294
633 Ga0207657_10006020
634 Ga0207657_10017031
635 Ga0207649_10111933
636 Ga0207652_10028324
637 Ga0207694_10118599
638 Ga0207650_10124900
639 Ga0207659_10594922
640 Ga0207687_10014806
641 Ga0207687_10021242
642 Ga0207687_10300613
643 Ga0207700_10414035
644 Ga0207706_10013222
645 Ga0207706_10071564
646 Ga0207706_10184075
647 Ga0207686_10021897
648 Ga0207686_10249806
649 Ga0207709_10011887
650 Ga0207709_10013259
651 Ga0207670_10020653
652 Ga0207669_10013110
653 Ga0207691_10004877
654 Ga0207689_10033325
655 Ga0207661_10013058
656 Ga0207661_10019477
657 Ga0207661_10088939
658 Ga0207661_10322583
659 Ga0207679_10180952
660 Ga0207679_10295049
661 Ga0207667_10156120
662 Ga0207667_10294102
663 Ga0207712_10109063
664 Ga0207640_10057075
665 Ga0207640_10503305
666 Ga0207677_10008162
667 Ga0207677_10035148
668 Ga0207677_10198082
669 Ga0207703_10053556
670 Ga0207639_10055436
671 Ga0207639_10056218
672 Ga0207678_10012670
673 Ga0207678_10061527
674 Ga0207708_10135648
675 Ga0207702_10098545
676 Ga0207648_10022151
677 Ga0207648_10201052
678 Ga0207675_100015032
679 Ga0207683_10050345
680 Ga0207683_10104957
681 Ga0207698_10020177
682 Ga0207428_10007743
683 Ga0265318_10015047
684 Ga0265318_10039816
685 Ga0265340_10020266
686 Ga0307407_10053321
687 Ga0307409_100247377
688 Ga0373958_0005388
689 Ga0373926_0140714
690 Ga0373944_0001142
691 Ga0373949_0025109
692 Ga0373936_0009991
693 Ga0373936_0011467
694 Ga0373945_0004461
695 Ga0373943_0001097
696 Ga0373943_0005693
697 Ga0373946_0003443
698 Ga0373946_0036187
699 Ga0373931_0077168
700 Ga0373935_0001485
701 Ga0373947_0000716
702 Ga0373947_0072519
703 Ga0373925_0004218
704 Ga0373925_0014559
705 Ga0395899_0217714
706 Ga0395899_0227573
707 Ga0395900_0058692
708 Ga0395900_0080811
709 Ga0395900_0387054
710 Ga0395900_0388388
711 Ga0395898_0000824
712 Ga0395898_0048684
713 Ga0395898_0064691
714 Ga0395898_0234214
715 Ga0395898_0374278
716 Ga0395905_0016484
717 Ga0395905_0025583
718 Ga0395905_0119549
719 Ga0395905_0659723
720 Ga0395905_0724619
721 Ga0395901_0001584
722 Ga0395901_0007695
723 Ga0395901_0046502
724 Ga0395901_0080146
725 Ga0395901_0172503
726 Ga0395901_0324709
727 Ga0451793_0517103
728 Ga0451802_0282035
729 Ga0451835_0239164
730 Ga0451839_0591998
731 Ga0451851_0673288
732 Ga0451853_2179165
733 Ga0450916_001900
734 Ga0466966_0056855
735 Ga0466963_0157331
736 Ga0466963_0298369
737 Ga0466963_0860382
738 Ga0466968_0238753
739 Ga0466959_0035624
740 Ga0466967_0030659
741 Ga0466967_0037354
742 Ga0466967_0049548
743 Ga0466967_0054326
744 Ga0466967_0662760
745 Ga0495592_0014829
746 Ga0495592_0129477
747 Ga0495603_0136402
748 Ga0495603_0140087
749 Ga0495629_0022886
750 Ga0495629_0060283
751 Ga0495641_0004541
752 Ga0495641_0022779
753 Ga0495641_0053903
754 Ga0495651_0014865
755 Ga0495653_0069588
756 Ga0495653_0097240
757 Ga0495582_0000276
758 Ga0495605_0033673
759 Ga0495639_0000416
760 Ga0495662_0016830
761 Ga0495662_0044269
762 Ga0495664_0024484
763 Ga0495664_0397245
764 Ga0495608_0018765
765 Ga0495608_0095101
766 Ga0495618_0019225
767 Ga0495628_0115820
768 Ga0495628_0146150
769 Ga0495630_0001315
770 Ga0495630_0010880
771 Ga0495630_0360099
772 Ga0495652_0044204
773 Ga0495665_0006870
774 Ga0495640_0004359
775 Ga0495640_0025119
776 Ga0495640_0036365
777 Ga0495645_0083597
778 Ga0495667_0001711
779 Ga0495667_0027735
780 Ga0495667_0190966
781 Ga0495634_0039736
782 Ga0495634_0241141
783 Ga0495635_0003672
784 Ga0495635_0053470
785 Ga0495657_0201374
786 Ga0495599_0051805
787 Ga0495647_0033891
788 Ga0495658_0002918
789 Ga0495658_0029456
790 Ga0495658_0087743
791 Ga0495613_0030231
792 Ga0495613_0062130
793 Ga0495613_0319341
794 Ga0495624_0004610
795 Ga0495600_0007224
796 Ga0495600_0139527
797 Ga0495581_0007163
798 Ga0495604_0022360
799 Ga0495674_0002208
800 Ga0495676_0011130
801 Ga0495676_0196329
802 Ga0495680_0008719
803 Ga0495680_0031251
804 Ga0495680_0073763
805 Ga0495675_0064223
806 Ga0495675_0164468
807 Ga0495684_0020683
808 Ga0495684_0027345
809 Ga0495684_0051531
810 Ga0495602_0107641
811 Ga0495602_0132129
812 Ga0495614_0010048
813 Ga0496100_0095490
814 Ga0496100_0101888
815 Ga0496100_0313067
816 Ga0496100_0405444
817 Ga0496101_0005250
818 Ga0496101_0036572
819 Ga0496101_0054031
820 Ga0496101_0115515
821 Ga0496101_0271167
822 Ga0496102_0108064
823 Ga0496102_0109739
824 Ga0496103_0030574
825 Ga0496104_0108109
826 Ga0496104_0168091
827 Ga0496105_0003601
828 Ga0496105_0085851
829 Ga0496105_0098957
830 Ga0496105_0152894
831 Ga0496106_0011679
832 Ga0496106_0293610
833 Ga0496107_0012425
834 Ga0496107_0074484
835 Ga0496108_0024857
836 Ga0496108_0159622
837 Ga0496108_0182600
838 Ga0496109_0009128
839 Ga0496109_0066034
840 Ga0496109_0108126
841 Ga0496109_0416126
842 Ga0496109_0677222
843 Ga0496110_0012799
844 Ga0496110_0299995
845 Ga0496110_0305485
846 Ga0496110_0459997
847 Ga0496111_0132595
848 Ga0496112_0380918
849 Ga0496113_0050959
850 Ga0496114_0001985
851 Ga0496114_0003682
852 Ga0496114_0044458
853 Ga0496114_0278127
854 Ga0496114_0347346
855 Ga0496115_0051618
856 Ga0496115_0145352
857 Ga0496115_0172275
858 Ga0501031_0003101
859 Ga0501031_0006768
860 Ga0501031_0012610
861 Ga0501032_0016364
862 Ga0501032_0053647
863 Ga0501032_0093345
864 Ga0501032_0174155
865 Ga0501033_0012235
866 Ga0501033_0028901
867 Ga0501033_0162280
868 Ga0501033_0193467
869 Ga0501036_0002934
870 Ga0501036_0004106
871 Ga0501036_0080084
872 Ga0501036_0080334
873 Ga0501037_0011701
874 Ga0501037_0056230
875 Ga0501038_0000446
876 Ga0501038_0015708
877 Ga0501038_0220211
878 Ga0501039_0008269
879 Ga0501039_0056472
880 Ga0501039_0138491
881 Ga0501040_0024153
882 Ga0501040_0072948
883 Ga0501040_0142839
884 Ga0501041_0002296
885 Ga0501041_0004264
886 Ga0501041_0015977
887 Ga0501042_0004021
888 Ga0501042_0061030
889 Ga0501043_0006223
890 Ga0501043_0119734
891 Ga0501043_0269351
892 Ga0501046_0004564
893 Ga0501046_0006055
894 Ga0501048_0003885
895 Ga0501048_0014225
896 Ga0501048_0024784
897 Ga0501067_0003760
898 Ga0501068_0012167
899 Ga0501068_0049880
900 Ga0501068_0103658
901 Ga0501069_0003370
902 Ga0501069_0007738
903 Ga0501069_0030128
904 Ga0501069_0098215
905 Ga0501069_0155678
906 Ga0501070_0000256
907 Ga0501070_0088669
908 Ga0501070_0134295
909 Ga0501070_0289425
910 Ga0501070_0312490
911 Ga0501071_0003757
912 Ga0501071_0005713
913 Ga0501071_0007264
914 Ga0501071_0014473
915 Ga0501071_0073455
916 Ga0501072_0003882
917 Ga0501072_0011211
918 Ga0501072_0012429
919 Ga0501072_0022857
920 Ga0501072_0249581
921 Ga0501073_0009788
922 Ga0501073_0014762
923 Ga0501073_0022769
924 Ga0501074_0011671
925 Ga0501074_0026917
926 Ga0501074_0040075
927 Ga0501075_0002256
928 Ga0501075_0056732
929 Ga0501075_0245608
930 Ga0501076_0001348
931 Ga0501076_0010235
932 Ga0501076_0013642
933 Ga0501076_0056972
934 Ga0501076_0094306
935 Ga0501077_0006353
936 Ga0501077_0015852
937 Ga0501077_0050792
938 Ga0501079_0046761
939 Ga0501079_0088723
940 Ga0501080_0001199
941 Ga0501080_0009698
942 Ga0501080_0012671
943 Ga0501080_0256382
944 Ga0501081_0006008
945 Ga0501081_0071468
946 Ga0501081_0142262
947 Ga0501081_0180350
948 Ga0501081_0259221
949 Ga0501083_0046974
950 Ga0501083_0102248
951 Ga0501035_0015690
952 Ga0501035_0036231
953 Ga0501035_0253151
954 Ga0501044_0073211
955 Ga0501044_0113538
956 Ga0501044_0133694
957 Ga0501044_0156849
958 Ga0501045_0006752
959 Ga0501045_0062632
960 Ga0501045_0063490
961 Ga0501045_0145705
962 nmdc:mga05p37_220889_c1
963 nmdc:mga06r32_20126_c1
964 nmdc:mga08y16_365110_c1
965 nmdc:mga08y16_398177_c1
966 nmdc:mga0n895_36046_c1
967 nmdc:mga0n895_9121_c1
968 nmdc:mga0rr50_13244_c1
969 nmdc:mga0rr50_28630_c1
970 nmdc:mga08x19_4610_c1
971 nmdc:mga0a205_180789_c1
972 nmdc:mga0a205_5385_c1
973 Ga0495601_0285468
974 Ga0495612_0065602
975 Ga0495595_0041012
976 Ga0495595_0221026
977 Ga0495619_0003843
978 Ga0495619_0005855
979 Ga0495619_0072775
980 Ga0501084_0004599
981 Ga0501084_0010402
982 Ga0501084_0015465
983 Ga0501084_0022033
984 Ga0501084_1063805
985 Ga0590075_005055
986 Ga0501082_0003737
987 Ga0501082_0010001
988 Ga0501082_0017983
989 Ga0530510_0003882
990 Ga0530510_0004406
991 Ga0530510_0015694
992 Ga0530510_0022704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

71

277

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nfp-assembly1.cif.gz_E 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. subtilis str. 168 0.8399 58 276
2eiv-assembly6.cif.gz_M crystal structure of the arginase from thermus thermophilus 0.8249 58 276
6nfp-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. subtilis str. 168 0.8223 59 276
6nfp-assembly1.cif.gz_F 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. subtilis str. 168 0.8221 59 276
5zef-assembly1.cif.gz_A crystal structure of entamoeba histolytica arginase in complex with l- norvaline at 2.01 a 0.8218 58 278
ID Description Score Start End Superfamily
af_Q8I384_22_411_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8782 95 276 3.40.800.10
6nfpA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8223 59 276 3.40.800.10
af_A0A1X7RC97_10_314_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8213 59 276 3.40.800.10
3sl0A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.799 58 276 3.40.800.10
4iu1A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.7763 58 276 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A7Y6CVX1-F1-model_v4 Arginase family protein 0.9686 25 278 GO:0004053
GO:0005737
GO:0019547
GO:0030145
AF-A0A538L3Q3-F1-model_v4 Arginase family protein 0.9637 25 163 GO:0004053
GO:0005737
GO:0019547
GO:0030145
AF-A0A7W1JYT6-F1-model_v4 Arginase family protein 0.9636 62 278 GO:0004053
GO:0005737
GO:0019547
GO:0030145
AF-A0A538DB73-F1-model_v4 Arginase family protein 0.9593 25 206 GO:0004053
GO:0005737
GO:0019547
GO:0030145
AF-A0A7Y6CVX1-F1-model_v4 Arginase family protein 0.9502 25 278 GO:0004053
GO:0005737
GO:0019547
GO:0030145

Map