F454791

General Info

Members Datasets Scaffolds Average Seq Length
495 216 990 358

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0168919|Ga0501071_0168919_491_1555
Length 354
Sequence VSPDRDDVLRALERVIDPELRRPVTELDMVRDVEIDGGDVAVTIALTVAGCPLRSSFQDQVAEHVGGLPGVERVELRFDVMSPDEKAALSAKLRGGRPEKTISVDPATRVIAIASGKGGVGKSSLTVNLAAALAALGQEIGVVDADVYGHSIPHMLGVRQRPVVVDRMIVPPVRGSLKLISIGNFLDENAPVMWRGPMLHRALEQFLSDVHWGALDTLLVDMPPGTGDMAISLGQLLPRAEVLVVTTPQPLAQEVAARAAVMAQRTGQKLLGVVENMSGDAFGAGGGDALAQELGVPLLGTIPLDRALREAGDSGTPVVEADPGAASSRALVALAETIAATRQAAIRKPLTLLS

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
117 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
118 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
134 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
135 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 11.52
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0168919 3300049587 Bacteria 1637
2 JGI25407J50210_10000736 3300003373 Bacteria 6871
3 JGI25407J50210_10021428 3300003373 Bacteria 1680
4 Ga0070683_100006229 3300005329 Bacteria 10006
5 Ga0070683_100032616 3300005329 Bacteria 4744
6 Ga0070683_100032743 3300005329 Bacteria 4736
7 Ga0070683_100169010 3300005329 Bacteria 2075
8 Ga0070690_100054086 3300005330 Bacteria 2570
9 Ga0070680_100012973 3300005336 Bacteria 6482
10 Ga0070680_100027904 3300005336 Bacteria 4524
11 Ga0068868_100024229 3300005338 Bacteria 4602
12 Ga0070689_100115471 3300005340 Bacteria 2139
13 Ga0070661_100037116 3300005344 Bacteria 3544
14 Ga0070668_100138540 3300005347 Bacteria 1959
15 Ga0070675_100042374 3300005354 Bacteria 3719
16 Ga0070674_100004281 3300005356 Bacteria 8120
17 Ga0070674_100215122 3300005356 Unclassified 1492
18 Ga0070688_100003161 3300005365 Bacteria 8431
19 Ga0070659_100048557 3300005366 Bacteria 3334
20 Ga0070709_10055251 3300005434 Bacteria 2506
21 Ga0070714_100138560 3300005435 Bacteria 2181
22 Ga0070713_100024426 3300005436 Bacteria 4706
23 Ga0070705_100040227 3300005440 Bacteria 2657
24 Ga0070705_100143488 3300005440 Bacteria 1575
25 Ga0070705_100156054 3300005440 Bacteria 1520
26 Ga0070700_100058123 3300005441 Bacteria 2428
27 Ga0070694_100165529 3300005444 Bacteria 1625
28 Ga0070678_100007308 3300005456 Bacteria 6543
29 Ga0070678_100167699 3300005456 Bacteria 1785
30 Ga0070681_10004937 3300005458 Bacteria 12821
31 Ga0070681_10040670 3300005458 Bacteria 4657
32 Ga0068867_100016705 3300005459 Bacteria 5214
33 Ga0068867_100183780 3300005459 Bacteria 1664
34 Ga0070685_10004668 3300005466 Bacteria 6933
35 Ga0070706_100228121 3300005467 Bacteria 1739
36 Ga0070698_100011372 3300005471 Bacteria 9446
37 Ga0070699_100033456 3300005518 Bacteria 4441
38 Ga0070699_100034298 3300005518 Bacteria 4386
39 Ga0070679_100002009 3300005530 Bacteria 18258
40 Ga0070679_100055148 3300005530 Bacteria 3958
41 Ga0070684_100000360 3300005535 Bacteria 31368
42 Ga0070684_100031567 3300005535 Bacteria 4511
43 Ga0070684_100153765 3300005535 Bacteria 2085
44 Ga0070697_100067224 3300005536 Bacteria 2932
45 Ga0070672_100121850 3300005543 Bacteria 2135
46 Ga0070686_100010482 3300005544 Bacteria 5228
47 Ga0070695_100068682 3300005545 Bacteria 2314
48 Ga0070696_100007721 3300005546 Bacteria 7183
49 Ga0070665_100062473 3300005548 Bacteria 3734
50 Ga0070704_100024237 3300005549 Bacteria 3979
51 Ga0070704_100038908 3300005549 Bacteria 3262
52 Ga0070704_100203297 3300005549 Bacteria 1600
53 Ga0070664_100023530 3300005564 Bacteria 5089
54 Ga0070664_100028374 3300005564 Bacteria 4655
55 Ga0070664_100089400 3300005564 Bacteria 2665
56 Ga0070664_100165943 3300005564 Bacteria 1956
57 Ga0070664_100172783 3300005564 Bacteria 1917
58 Ga0068857_100003359 3300005577 Bacteria 13322
59 Ga0068857_100008688 3300005577 Bacteria 8790
60 Ga0068857_100012313 3300005577 Bacteria 7443
61 Ga0068857_100435237 3300005577 Bacteria 1225
62 Ga0068856_100003184 3300005614 Bacteria 16712
63 Ga0068856_100082995 3300005614 Bacteria 3181
64 Ga0068856_100096270 3300005614 Bacteria 2948
65 Ga0070702_100009862 3300005615 Bacteria 4687
66 Ga0070702_100017420 3300005615 Bacteria 3706
67 Ga0070702_100135030 3300005615 Bacteria 1564
68 Ga0068864_100115647 3300005618 Bacteria 2393
69 Ga0068864_100166965 3300005618 Bacteria 2004
70 Ga0068866_10086423 3300005718 Bacteria 1697
71 Ga0068861_100204902 3300005719 Bacteria 1658
72 Ga0068861_100247096 3300005719 Bacteria 1520
73 Ga0068851_10047524 3300005834 Bacteria 2174
74 Ga0068870_10004534 3300005840 Bacteria 5985
75 Ga0081455_10002318 3300005937 Bacteria 22707
76 Ga0081455_10024078 3300005937 Bacteria 5648
77 Ga0081455_10024712 3300005937 Bacteria 5557
78 Ga0081455_10031458 3300005937 Bacteria 4801
79 Ga0081455_10051109 3300005937 Bacteria 3548
80 Ga0081538_10000094 3300005981 Bacteria 86715
81 Ga0081538_10000218 3300005981 Bacteria 64601
82 Ga0081538_10004358 3300005981 Bacteria 13076
83 Ga0081538_10032617 3300005981 Bacteria 3485
84 Ga0081538_10060440 3300005981 Bacteria 2179
85 Ga0081539_10000095 3300005985 Bacteria 204474
86 Ga0081539_10002896 3300005985 Bacteria 22735
87 Ga0075364_10178534 3300006051 Bacteria 1436
88 Ga0070715_10006093 3300006163 Bacteria 4075
89 Ga0075362_10088876 3300006177 Bacteria 1432
90 Ga0097621_100089899 3300006237 Bacteria 2568
91 Ga0075428_100001324 3300006844 Bacteria 26239
92 Ga0075428_100004717 3300006844 Bacteria 15086
93 Ga0075430_100031658 3300006846 Bacteria 4488
94 Ga0075430_100135528 3300006846 Bacteria 2052
95 Ga0075431_100005174 3300006847 Bacteria 12846
96 Ga0075431_100106619 3300006847 Bacteria 2891
97 Ga0075433_10061978 3300006852 Bacteria 3276
98 Ga0075434_100272224 3300006871 Bacteria 1713
99 Ga0075429_100140550 3300006880 Bacteria 2113
100 Ga0075429_100188981 3300006880 Bacteria 1805
101 Ga0068865_100020082 3300006881 Bacteria 4331
102 Ga0068865_100033813 3300006881 Bacteria 3425
103 Ga0075436_100006711 3300006914 Bacteria 7879
104 Ga0111539_10001300 3300009094 Bacteria 33359
105 Ga0111539_10001945 3300009094 Bacteria 27545
106 Ga0111539_10155380 3300009094 Bacteria 2677
107 Ga0111539_10691050 3300009094 Bacteria 1188
108 Ga0105245_10032907 3300009098 Bacteria 4592
109 Ga0105245_10121845 3300009098 Bacteria 2437
110 Ga0114129_10018887 3300009147 Bacteria 9820
111 Ga0114129_10038055 3300009147 Bacteria 6787
112 Ga0114129_10116038 3300009147 Bacteria 3689
113 Ga0114129_10239467 3300009147 Bacteria 2439
114 Ga0114129_10286094 3300009147 Bacteria 2201
115 Ga0114129_10334874 3300009147 Bacteria 2009
116 Ga0105243_10015332 3300009148 Bacteria 5797
117 Ga0105243_10030420 3300009148 Bacteria 4156
118 Ga0105243_10041587 3300009148 Bacteria 3595
119 Ga0105243_10450787 3300009148 Bacteria 1207
120 Ga0105241_10200627 3300009174 Bacteria 1666
121 Ga0105242_10095712 3300009176 Bacteria 2507
122 Ga0105248_10078427 3300009177 Bacteria 3712
123 Ga0105238_10162793 3300009551 Bacteria 2207
124 Ga0105249_10057843 3300009553 Bacteria 3553
125 Ga0105239_10102079 3300010375 Bacteria 3174
126 Ga0105239_10698570 3300010375 Bacteria 1160
127 Ga0105246_10011732 3300011119 Bacteria 5445
128 Ga0105246_10012047 3300011119 Bacteria 5387
129 Ga0105246_10127585 3300011119 Bacteria 1895
130 Ga0157369_10037142 3300013105 Bacteria 5334
131 Ga0163162_10281448 3300013306 Bacteria 1795
132 Ga0157372_10014334 3300013307 Bacteria 8476
133 Ga0157375_10028487 3300013308 Bacteria 5235
134 Ga0157375_10071042 3300013308 Bacteria 3493
135 Ga0157375_10182276 3300013308 Bacteria 2252
136 Ga0157375_10628810 3300013308 Bacteria 1231
137 Ga0163163_10005098 3300014325 Bacteria 11324
138 Ga0157377_10005680 3300014745 Bacteria 5879
139 Ga0207688_10010938 3300025901 Bacteria 4939
140 Ga0207688_10021001 3300025901 Bacteria 3565
141 Ga0207688_10053611 3300025901 Bacteria 2262
142 Ga0207685_10074541 3300025905 Bacteria 1386
143 Ga0207699_10060515 3300025906 Bacteria 2274
144 Ga0207699_10185700 3300025906 Bacteria 1400
145 Ga0207643_10006922 3300025908 Bacteria 6080
146 Ga0207643_10068371 3300025908 Bacteria 2040
147 Ga0207707_10002607 3300025912 Bacteria 16140
148 Ga0207693_10001016 3300025915 Bacteria 25132
149 Ga0207693_10001814 3300025915 Bacteria 18729
150 Ga0207693_10115694 3300025915 Bacteria 2105
151 Ga0207693_10161379 3300025915 Bacteria 1764
152 Ga0207660_10006413 3300025917 Bacteria 7626
153 Ga0207662_10089379 3300025918 Bacteria 1892
154 Ga0207657_10218213 3300025919 Bacteria 1529
155 Ga0207649_10043608 3300025920 Bacteria 2744
156 Ga0207652_10004016 3300025921 Bacteria 12013
157 Ga0207652_10019380 3300025921 Bacteria 5594
158 Ga0207646_10282087 3300025922 Bacteria 1501
159 Ga0207659_10078616 3300025926 Bacteria 2431
160 Ga0207687_10056789 3300025927 Bacteria 2747
161 Ga0207687_10073077 3300025927 Bacteria 2455
162 Ga0207687_10131912 3300025927 Bacteria 1885
163 Ga0207690_10087308 3300025932 Bacteria 2194
164 Ga0207706_10024655 3300025933 Bacteria 5391
165 Ga0207709_10023679 3300025935 Bacteria 3497
166 Ga0207709_10081071 3300025935 Bacteria 2091
167 Ga0207709_10084180 3300025935 Bacteria 2058
168 Ga0207669_10018436 3300025937 Bacteria 3608
169 Ga0207669_10029484 3300025937 Bacteria 3036
170 Ga0207669_10185677 3300025937 Bacteria 1495
171 Ga0207704_10050773 3300025938 Bacteria 2504
172 Ga0207665_10027074 3300025939 Bacteria 3787
173 Ga0207665_10209084 3300025939 Bacteria 1424
174 Ga0207691_10211812 3300025940 Bacteria 1683
175 Ga0207689_10172637 3300025942 Bacteria 1782
176 Ga0207661_10002116 3300025944 Bacteria 13667
177 Ga0207661_10006549 3300025944 Bacteria 8233
178 Ga0207661_10291995 3300025944 Bacteria 1459
179 Ga0207661_10318800 3300025944 Bacteria 1397
180 Ga0207679_10020097 3300025945 Bacteria 4502
181 Ga0207679_10048168 3300025945 Bacteria 3101
182 Ga0207679_10086935 3300025945 Bacteria 2406
183 Ga0207712_10055449 3300025961 Bacteria 2788
184 Ga0207677_10328165 3300026023 Bacteria 1274
185 Ga0207678_10272129 3300026067 Bacteria 1453
186 Ga0207708_10046319 3300026075 Bacteria 3311
187 Ga0207702_10009370 3300026078 Bacteria 8222
188 Ga0207648_10014881 3300026089 Bacteria 7173
189 Ga0207648_10059204 3300026089 Bacteria 3340
190 Ga0207674_10000820 3300026116 Bacteria 40413
191 Ga0207674_10009523 3300026116 Bacteria 11087
192 Ga0207674_10011850 3300026116 Bacteria 9775
193 Ga0207674_10067511 3300026116 Bacteria 3600
194 Ga0207674_10101853 3300026116 Bacteria 2852
195 Ga0207674_10260172 3300026116 Bacteria 1683
196 Ga0207675_100009908 3300026118 Bacteria 8917
197 Ga0207683_10009561 3300026121 Bacteria 8265
198 Ga0207683_10127055 3300026121 Bacteria 2291
199 Ga0207683_10128408 3300026121 Bacteria 2279
200 Ga0207428_10006662 3300027907 Bacteria 10608
201 Ga0207428_10007828 3300027907 Bacteria 9723
202 Ga0207428_10013651 3300027907 Bacteria 7086
203 Ga0268266_10029338 3300028379 Bacteria 4677
204 Ga0307406_10025882 3300031901 Bacteria 3517
205 Ga0307416_100003519 3300032002 Bacteria 9221
206 Ga0307416_100195307 3300032002 Bacteria 1914
207 Ga0307416_100318957 3300032002 Bacteria 1555
208 Ga0307415_100000519 3300032126 Bacteria 16814
209 Ga0373950_0010565 3300034818 Bacteria 1494
210 Ga0373958_0004975 3300034819 Bacteria 1995
211 Ga0373959_0007232 3300034820 Bacteria 1862
212 Ga0373938_0015406 3300034957 Bacteria 1480
213 Ga0373951_0001201 3300035091 Bacteria 6846
214 Ga0373939_0044365 3300035114 Bacteria 1353
215 Ga0373942_0018555 3300035207 Bacteria 1728
216 Ga0373931_0003088 3300035691 Bacteria 7448
217 Ga0395899_0002207 3300037312 Bacteria 15963
218 Ga0395899_0003223 3300037312 Bacteria 12940
219 Ga0395899_0005084 3300037312 Bacteria 10237
220 Ga0395899_0006551 3300037312 Bacteria 9025
221 Ga0395899_0007539 3300037312 Bacteria 8408
222 Ga0395899_0044580 3300037312 Bacteria 3305
223 Ga0395899_0060485 3300037312 Bacteria 2791
224 Ga0395899_0065241 3300037312 Bacteria 2676
225 Ga0395899_0095016 3300037312 Bacteria 2156
226 Ga0395899_0126622 3300037312 Bacteria 1826
227 Ga0395899_0171365 3300037312 Bacteria 1528
228 Ga0395900_0000929 3300037418 Bacteria 38304
229 Ga0395900_0005079 3300037418 Bacteria 13808
230 Ga0395900_0019403 3300037418 Bacteria 6933
231 Ga0395900_0046390 3300037418 Bacteria 4474
232 Ga0395900_0047342 3300037418 Bacteria 4427
233 Ga0395900_0052766 3300037418 Bacteria 4185
234 Ga0395900_0075291 3300037418 Bacteria 3470
235 Ga0395900_0081927 3300037418 Bacteria 3315
236 Ga0395900_0107256 3300037418 Bacteria 2869
237 Ga0395900_0153765 3300037418 Bacteria 2350
238 Ga0395900_0193850 3300037418 Bacteria 2059
239 Ga0395900_0236553 3300037418 Bacteria 1834
240 Ga0395898_0002345 3300037466 Bacteria 22578
241 Ga0395898_0004400 3300037466 Bacteria 15409
242 Ga0395898_0016670 3300037466 Bacteria 7510
243 Ga0395898_0020271 3300037466 Bacteria 6753
244 Ga0395898_0023325 3300037466 Bacteria 6254
245 Ga0395898_0032890 3300037466 Bacteria 5177
246 Ga0395898_0042047 3300037466 Bacteria 4511
247 Ga0395898_0049310 3300037466 Bacteria 4125
248 Ga0395898_0064669 3300037466 Bacteria 3548
249 Ga0395898_0066212 3300037466 Bacteria 3501
250 Ga0395898_0068720 3300037466 Bacteria 3428
251 Ga0395898_0172036 3300037466 Bacteria 2070
252 Ga0395905_0007192 3300037471 Bacteria 11113
253 Ga0395905_0021305 3300037471 Bacteria 6131
254 Ga0395905_0024654 3300037471 Bacteria 5675
255 Ga0395905_0054482 3300037471 Bacteria 3743
256 Ga0395905_0066502 3300037471 Bacteria 3375
257 Ga0395905_0089600 3300037471 Bacteria 2883
258 Ga0395905_0258709 3300037471 Bacteria 1625
259 Ga0395901_0006433 3300038443 Bacteria 11902
260 Ga0395901_0012793 3300038443 Bacteria 8510
261 Ga0395901_0022538 3300038443 Bacteria 6455
262 Ga0395901_0025728 3300038443 Bacteria 6041
263 Ga0395901_0032482 3300038443 Bacteria 5385
264 Ga0395901_0035441 3300038443 Bacteria 5155
265 Ga0395901_0040531 3300038443 Bacteria 4824
266 Ga0395901_0046481 3300038443 Bacteria 4509
267 Ga0395901_0125578 3300038443 Bacteria 2696
268 Ga0395901_0164948 3300038443 Bacteria 2326
269 Ga0395901_0169297 3300038443 Bacteria 2292
270 Ga0395901_0236778 3300038443 Bacteria 1905
271 Ga0395901_0276319 3300038443 Bacteria 1746
272 Ga0395901_0388211 3300038443 Bacteria 1436
273 Ga0439439_0005418 3300041406 Bacteria 2912
274 Ga0439433_0001128 3300041999 Bacteria 5455
275 Ga0439448_0002556 3300042005 Bacteria 4958
276 Ga0439457_017826 3300042014 Bacteria 1576
277 Ga0439462_0003970 3300042015 Bacteria 3584
278 Ga0450915_000090 3300042119 Bacteria 2054
279 Ga0450888_000809 3300042126 Bacteria 2995
280 Ga0439440_0012345 3300042993 Bacteria 1816
281 Ga0466964_0000660 3300044706 Bacteria 11023
282 Ga0466960_0010796 3300044901 Bacteria 3803
283 Ga0495603_0072391 3300046455 Bacteria 2025
284 Ga0495629_0062821 3300046459 Bacteria 2593
285 Ga0495582_0003878 3300046473 Bacteria 8421
286 Ga0495584_0021058 3300046491 Bacteria 3311
287 Ga0495607_0095370 3300046501 Unclassified 1603
288 Ga0495620_0061314 3300046515 Bacteria 1565
289 Ga0495628_0038960 3300046516 Bacteria 3803
290 Ga0495644_0053800 3300046523 Bacteria 1512
291 Ga0495665_0116666 3300046531 Bacteria 1398
292 Ga0495586_0023494 3300046535 Bacteria 3293
293 Ga0495598_0047074 3300046537 Bacteria 1284
294 Ga0495634_0035135 3300046642 Bacteria 3435
295 Ga0495635_0158569 3300046663 Bacteria 1540
296 Ga0495661_0095193 3300046665 Bacteria 1687
297 Ga0495613_0089687 3300046689 Bacteria 2227
298 Ga0495671_0066883 3300046692 Bacteria 1768
299 Ga0495589_0058258 3300046794 Bacteria 1899
300 Ga0495581_0000487 3300047315 Bacteria 20216
301 Ga0495636_0031994 3300047318 Bacteria 2157
302 Ga0495676_0123140 3300047321 Bacteria 1883
303 Ga0495685_021162 3300047447 Bacteria 2237
304 Ga0496100_0002277 3300048903 Bacteria 9700
305 Ga0496100_0259028 3300048903 Bacteria 1289
306 Ga0496101_0032339 3300048904 Bacteria 3682
307 Ga0496101_0036581 3300048904 Bacteria 3477
308 Ga0496101_0066706 3300048904 Bacteria 2626
309 Ga0496101_0124814 3300048904 Bacteria 1950
310 Ga0496102_0253080 3300048905 Bacteria 1661
311 Ga0496102_0261487 3300048905 Bacteria 1632
312 Ga0496103_0042385 3300048906 Bacteria 2800
313 Ga0496103_0140690 3300048906 Bacteria 1543
314 Ga0496104_0000332 3300048907 Bacteria 42258
315 Ga0496104_0012048 3300048907 Bacteria 7761
316 Ga0496104_0026915 3300048907 Bacteria 5316
317 Ga0496104_0111219 3300048907 Bacteria 2626
318 Ga0496104_0159283 3300048907 Bacteria 2165
319 Ga0496105_0003459 3300048908 Bacteria 11682
320 Ga0496105_0027716 3300048908 Bacteria 4630
321 Ga0496105_0062552 3300048908 Bacteria 3072
322 Ga0496105_0078136 3300048908 Bacteria 2733
323 Ga0496106_0008501 3300048909 Bacteria 7593
324 Ga0496106_0153742 3300048909 Bacteria 1816
325 Ga0496107_0010805 3300048910 Bacteria 6351
326 Ga0496107_0030412 3300048910 Bacteria 3849
327 Ga0496107_0088908 3300048910 Bacteria 2255
328 Ga0496108_0009092 3300048911 Bacteria 8046
329 Ga0496108_0013138 3300048911 Bacteria 6749
330 Ga0496108_0021717 3300048911 Bacteria 5278
331 Ga0496108_0045643 3300048911 Bacteria 3660
332 Ga0496108_0111126 3300048911 Bacteria 2344
333 Ga0496108_0183882 3300048911 Bacteria 1810
334 Ga0496109_0000288 3300048912 Bacteria 47831
335 Ga0496109_0006052 3300048912 Bacteria 10162
336 Ga0496109_0008352 3300048912 Bacteria 8797
337 Ga0496109_0209214 3300048912 Bacteria 1834
338 Ga0496109_0360040 3300048912 Bacteria 1374
339 Ga0496110_0000069 3300048913 Bacteria 51597
340 Ga0496110_0013159 3300048913 Bacteria 6831
341 Ga0496110_0014066 3300048913 Bacteria 6633
342 Ga0496110_0023263 3300048913 Bacteria 5268
343 Ga0496110_0024397 3300048913 Bacteria 5154
344 Ga0496110_0033219 3300048913 Bacteria 4461
345 Ga0496110_0040397 3300048913 Bacteria 4066
346 Ga0496110_0053561 3300048913 Bacteria 3548
347 Ga0496110_0065318 3300048913 Bacteria 3216
348 Ga0496111_0000084 3300048914 Bacteria 39267
349 Ga0496111_0002857 3300048914 Bacteria 10543
350 Ga0496111_0010433 3300048914 Bacteria 6233
351 Ga0496111_0107186 3300048914 Bacteria 2057
352 Ga0496111_0121476 3300048914 Bacteria 1929
353 Ga0496111_0215054 3300048914 Bacteria 1428
354 Ga0496112_0016344 3300048915 Bacteria 6949
355 Ga0496112_0202164 3300048915 Bacteria 1946
356 Ga0496113_0002375 3300048916 Bacteria 10915
357 Ga0496113_0010153 3300048916 Bacteria 6214
358 Ga0496113_0019776 3300048916 Bacteria 4719
359 Ga0496114_0044911 3300048917 Bacteria 3668
360 Ga0496115_0018282 3300048918 Bacteria 5378
361 Ga0501031_0025428 3300049568 Bacteria 3860
362 Ga0501031_0028121 3300049568 Bacteria 3665
363 Ga0501031_0080121 3300049568 Bacteria 2128
364 Ga0501032_0003181 3300049569 Bacteria 12640
365 Ga0501032_0010209 3300049569 Bacteria 6778
366 Ga0501032_0077610 3300049569 Bacteria 2211
367 Ga0501033_0020848 3300049570 Bacteria 4948
368 Ga0501033_0030377 3300049570 Bacteria 4061
369 Ga0501034_0036000 3300049571 Bacteria 5018
370 Ga0501036_0012451 3300049572 Bacteria 7050
371 Ga0501036_0168945 3300049572 Bacteria 1843
372 Ga0501036_0217996 3300049572 Bacteria 1602
373 Ga0501036_0291411 3300049572 Bacteria 1365
374 Ga0501037_0007860 3300049573 Bacteria 7813
375 Ga0501037_0021569 3300049573 Bacteria 4762
376 Ga0501038_0019264 3300049574 Bacteria 6155
377 Ga0501038_0071507 3300049574 Bacteria 2942
378 Ga0501038_0279959 3300049574 Bacteria 1313
379 Ga0501039_0003065 3300049575 Bacteria 12496
380 Ga0501039_0005295 3300049575 Bacteria 9757
381 Ga0501039_0110530 3300049575 Bacteria 2148
382 Ga0501040_0045546 3300049576 Bacteria 2992
383 Ga0501041_0037441 3300049577 Bacteria 2940
384 Ga0501041_0086173 3300049577 Bacteria 1937
385 Ga0501041_0137043 3300049577 Bacteria 1525
386 Ga0501042_0009613 3300049578 Bacteria 6454
387 Ga0501042_0021374 3300049578 Bacteria 4510
388 Ga0501042_0043951 3300049578 Bacteria 3182
389 Ga0501042_0049245 3300049578 Bacteria 3005
390 Ga0501042_0108217 3300049578 Bacteria 2001
391 Ga0501043_0003877 3300049579 Bacteria 12285
392 Ga0501043_0014662 3300049579 Bacteria 6135
393 Ga0501046_0007566 3300049580 Bacteria 9526
394 Ga0501046_0017152 3300049580 Bacteria 6051
395 Ga0501046_0032938 3300049580 Bacteria 4192
396 Ga0501047_0090367 3300049581 Bacteria 2939
397 Ga0501048_0007018 3300049582 Bacteria 8558
398 Ga0501048_0011299 3300049582 Bacteria 6657
399 Ga0501048_0028942 3300049582 Bacteria 4020
400 Ga0501048_0167739 3300049582 Bacteria 1554
401 Ga0501067_0000374 3300049583 Bacteria 24367
402 Ga0501067_0005504 3300049583 Bacteria 7022
403 Ga0501067_0022116 3300049583 Bacteria 3519
404 Ga0501067_0048317 3300049583 Bacteria 2360
405 Ga0501068_0001319 3300049584 Bacteria 13159
406 Ga0501068_0040404 3300049584 Bacteria 2800
407 Ga0501069_0003652 3300049585 Bacteria 7917
408 Ga0501069_0120375 3300049585 Bacteria 1499
409 Ga0501069_0174027 3300049585 Bacteria 1243
410 Ga0501070_0058493 3300049586 Bacteria 3195
411 Ga0501070_0084055 3300049586 Bacteria 2635
412 Ga0501071_0026758 3300049587 Bacteria 4052
413 Ga0501071_0029238 3300049587 Bacteria 3888
414 Ga0501071_0180712 3300049587 Bacteria 1580
415 Ga0501071_0195932 3300049587 Bacteria 1516
416 Ga0501072_0003758 3300049588 Bacteria 11459
417 Ga0501072_0023380 3300049588 Bacteria 4800
418 Ga0501072_0132813 3300049588 Bacteria 1985
419 Ga0501072_0186877 3300049588 Bacteria 1653
420 Ga0501073_0005696 3300049589 Bacteria 9320
421 Ga0501073_0026544 3300049589 Bacteria 4148
422 Ga0501073_0080029 3300049589 Bacteria 2274
423 Ga0501074_0024485 3300049590 Bacteria 4388
424 Ga0501074_0100629 3300049590 Bacteria 2069
425 Ga0501074_0128489 3300049590 Bacteria 1813
426 Ga0501075_0031042 3300049591 Bacteria 3963
427 Ga0501075_0032845 3300049591 Bacteria 3858
428 Ga0501075_0087322 3300049591 Bacteria 2363
429 Ga0501075_0117276 3300049591 Bacteria 2023
430 Ga0501076_0003503 3300049592 Bacteria 11030
431 Ga0501076_0066301 3300049592 Bacteria 2881
432 Ga0501076_0079578 3300049592 Bacteria 2630
433 Ga0501076_0097553 3300049592 Bacteria 2367
434 Ga0501076_0112732 3300049592 Bacteria 2200
435 Ga0501077_0012259 3300049593 Bacteria 5368
436 Ga0501077_0016277 3300049593 Bacteria 4684
437 Ga0501077_0041630 3300049593 Bacteria 2923
438 Ga0501077_0101987 3300049593 Bacteria 1818
439 Ga0501077_0155771 3300049593 Bacteria 1450
440 Ga0501077_0163304 3300049593 Bacteria 1414
441 Ga0501079_0019124 3300049741 Bacteria 5232
442 Ga0501079_0021580 3300049741 Bacteria 4926
443 Ga0501079_0119297 3300049741 Bacteria 2051
444 Ga0501079_0207479 3300049741 Bacteria 1530
445 Ga0501080_0058879 3300049742 Bacteria 3575
446 Ga0501080_0109414 3300049742 Bacteria 2561
447 Ga0501080_0156811 3300049742 Bacteria 2102
448 Ga0501080_0231367 3300049742 Bacteria 1689
449 Ga0501081_0019831 3300049743 Bacteria 4479
450 Ga0501081_0037814 3300049743 Bacteria 3294
451 Ga0501081_0076953 3300049743 Bacteria 2330
452 Ga0501081_0142320 3300049743 Bacteria 1719
453 Ga0501081_0250258 3300049743 Bacteria 1294
454 Ga0501083_0024863 3300049744 Bacteria 4148
455 Ga0501083_0068399 3300049744 Bacteria 2363
456 Ga0501035_0017021 3300049822 Bacteria 6699
457 Ga0501035_0083411 3300049822 Bacteria 2820
458 Ga0501044_0045481 3300049823 Bacteria 4547
459 Ga0501044_0094413 3300049823 Bacteria 3016
460 Ga0501044_0263510 3300049823 Bacteria 1661
461 Ga0501045_0023318 3300049824 Bacteria 4435
462 Ga0501045_0060568 3300049824 Bacteria 2775
463 Ga0501045_0088986 3300049824 Bacteria 2280
464 Ga0501045_0095514 3300049824 Bacteria 2199
465 nmdc:mga05p37_275055_c1 3300050507 Bacteria 2011
466 nmdc:mga05p37_502720_c1 3300050507 Bacteria 1391
467 nmdc:mga05p37_76460_c1 3300050507 Bacteria 4122
468 nmdc:mga05p37_9283_c1 3300050507 Bacteria 11630
469 nmdc:mga0qj67_30113_c1 3300050509 Bacteria 4221
470 nmdc:mga0qj67_85776_c1 3300050509 Bacteria 2526
471 nmdc:mga06r32_150036_c1 3300050510 Bacteria 2309
472 nmdc:mga06r32_175762_c1 3300050510 Bacteria 2125
473 nmdc:mga08y16_186461_c1 3300050511 Bacteria 2153
474 nmdc:mga08y16_237757_c1 3300050511 Bacteria 1883
475 nmdc:mga08y16_24920_c1 3300050511 Bacteria 6310
476 nmdc:mga08y16_442685_c1 3300050511 Bacteria 1326
477 nmdc:mga08y16_86892_c1 3300050511 Bacteria 3258
478 nmdc:mga0rr50_214982_c1 3300050513 Bacteria 1585
479 nmdc:mga08x19_251739_c1 3300050514 Bacteria 1220
480 nmdc:mga08x19_84004_c1 3300050514 Bacteria 2094
481 Ga0495619_0021967 3300053085 Bacteria 4079
482 Ga0501084_0006463 3300054114 Bacteria 9638
483 Ga0501084_0033242 3300054114 Bacteria 4314
484 Ga0501084_0050465 3300054114 Bacteria 3483
485 Ga0501084_0050851 3300054114 Bacteria 3467
486 Ga0501084_0177116 3300054114 Bacteria 1800
487 Ga0501082_0005543 3300060353 Bacteria 10959
488 Ga0501082_0068120 3300060353 Bacteria 3065
489 Ga0501082_0193156 3300060353 Bacteria 1770
490 Ga0501082_0281184 3300060353 Bacteria 1448
491 Ga0530510_0030574 3300061734 Bacteria 3868
492 Ga0530510_0045407 3300061734 Bacteria 3174
493 Ga0530510_0113343 3300061734 Bacteria 1987
494 Ga0530510_0186448 3300061734 Bacteria 1539
495 Ga0530510_0233794 3300061734 Bacteria 1367
496 Ga0501071_0168919
497 JGI25407J50210_10000736
498 JGI25407J50210_10021428
499 Ga0070683_100006229
500 Ga0070683_100032616
501 Ga0070683_100032743
502 Ga0070683_100169010
503 Ga0070690_100054086
504 Ga0070680_100012973
505 Ga0070680_100027904
506 Ga0068868_100024229
507 Ga0070689_100115471
508 Ga0070661_100037116
509 Ga0070668_100138540
510 Ga0070675_100042374
511 Ga0070674_100004281
512 Ga0070674_100215122
513 Ga0070688_100003161
514 Ga0070659_100048557
515 Ga0070709_10055251
516 Ga0070714_100138560
517 Ga0070713_100024426
518 Ga0070705_100040227
519 Ga0070705_100143488
520 Ga0070705_100156054
521 Ga0070700_100058123
522 Ga0070694_100165529
523 Ga0070678_100007308
524 Ga0070678_100167699
525 Ga0070681_10004937
526 Ga0070681_10040670
527 Ga0068867_100016705
528 Ga0068867_100183780
529 Ga0070685_10004668
530 Ga0070706_100228121
531 Ga0070698_100011372
532 Ga0070699_100033456
533 Ga0070699_100034298
534 Ga0070679_100002009
535 Ga0070679_100055148
536 Ga0070684_100000360
537 Ga0070684_100031567
538 Ga0070684_100153765
539 Ga0070697_100067224
540 Ga0070672_100121850
541 Ga0070686_100010482
542 Ga0070695_100068682
543 Ga0070696_100007721
544 Ga0070665_100062473
545 Ga0070704_100024237
546 Ga0070704_100038908
547 Ga0070704_100203297
548 Ga0070664_100023530
549 Ga0070664_100028374
550 Ga0070664_100089400
551 Ga0070664_100165943
552 Ga0070664_100172783
553 Ga0068857_100003359
554 Ga0068857_100008688
555 Ga0068857_100012313
556 Ga0068857_100435237
557 Ga0068856_100003184
558 Ga0068856_100082995
559 Ga0068856_100096270
560 Ga0070702_100009862
561 Ga0070702_100017420
562 Ga0070702_100135030
563 Ga0068864_100115647
564 Ga0068864_100166965
565 Ga0068866_10086423
566 Ga0068861_100204902
567 Ga0068861_100247096
568 Ga0068851_10047524
569 Ga0068870_10004534
570 Ga0081455_10002318
571 Ga0081455_10024078
572 Ga0081455_10024712
573 Ga0081455_10031458
574 Ga0081455_10051109
575 Ga0081538_10000094
576 Ga0081538_10000218
577 Ga0081538_10004358
578 Ga0081538_10032617
579 Ga0081538_10060440
580 Ga0081539_10000095
581 Ga0081539_10002896
582 Ga0075364_10178534
583 Ga0070715_10006093
584 Ga0075362_10088876
585 Ga0097621_100089899
586 Ga0075428_100001324
587 Ga0075428_100004717
588 Ga0075430_100031658
589 Ga0075430_100135528
590 Ga0075431_100005174
591 Ga0075431_100106619
592 Ga0075433_10061978
593 Ga0075434_100272224
594 Ga0075429_100140550
595 Ga0075429_100188981
596 Ga0068865_100020082
597 Ga0068865_100033813
598 Ga0075436_100006711
599 Ga0111539_10001300
600 Ga0111539_10001945
601 Ga0111539_10155380
602 Ga0111539_10691050
603 Ga0105245_10032907
604 Ga0105245_10121845
605 Ga0114129_10018887
606 Ga0114129_10038055
607 Ga0114129_10116038
608 Ga0114129_10239467
609 Ga0114129_10286094
610 Ga0114129_10334874
611 Ga0105243_10015332
612 Ga0105243_10030420
613 Ga0105243_10041587
614 Ga0105243_10450787
615 Ga0105241_10200627
616 Ga0105242_10095712
617 Ga0105248_10078427
618 Ga0105238_10162793
619 Ga0105249_10057843
620 Ga0105239_10102079
621 Ga0105239_10698570
622 Ga0105246_10011732
623 Ga0105246_10012047
624 Ga0105246_10127585
625 Ga0157369_10037142
626 Ga0163162_10281448
627 Ga0157372_10014334
628 Ga0157375_10028487
629 Ga0157375_10071042
630 Ga0157375_10182276
631 Ga0157375_10628810
632 Ga0163163_10005098
633 Ga0157377_10005680
634 Ga0207688_10010938
635 Ga0207688_10021001
636 Ga0207688_10053611
637 Ga0207685_10074541
638 Ga0207699_10060515
639 Ga0207699_10185700
640 Ga0207643_10006922
641 Ga0207643_10068371
642 Ga0207707_10002607
643 Ga0207693_10001016
644 Ga0207693_10001814
645 Ga0207693_10115694
646 Ga0207693_10161379
647 Ga0207660_10006413
648 Ga0207662_10089379
649 Ga0207657_10218213
650 Ga0207649_10043608
651 Ga0207652_10004016
652 Ga0207652_10019380
653 Ga0207646_10282087
654 Ga0207659_10078616
655 Ga0207687_10056789
656 Ga0207687_10073077
657 Ga0207687_10131912
658 Ga0207690_10087308
659 Ga0207706_10024655
660 Ga0207709_10023679
661 Ga0207709_10081071
662 Ga0207709_10084180
663 Ga0207669_10018436
664 Ga0207669_10029484
665 Ga0207669_10185677
666 Ga0207704_10050773
667 Ga0207665_10027074
668 Ga0207665_10209084
669 Ga0207691_10211812
670 Ga0207689_10172637
671 Ga0207661_10002116
672 Ga0207661_10006549
673 Ga0207661_10291995
674 Ga0207661_10318800
675 Ga0207679_10020097
676 Ga0207679_10048168
677 Ga0207679_10086935
678 Ga0207712_10055449
679 Ga0207677_10328165
680 Ga0207678_10272129
681 Ga0207708_10046319
682 Ga0207702_10009370
683 Ga0207648_10014881
684 Ga0207648_10059204
685 Ga0207674_10000820
686 Ga0207674_10009523
687 Ga0207674_10011850
688 Ga0207674_10067511
689 Ga0207674_10101853
690 Ga0207674_10260172
691 Ga0207675_100009908
692 Ga0207683_10009561
693 Ga0207683_10127055
694 Ga0207683_10128408
695 Ga0207428_10006662
696 Ga0207428_10007828
697 Ga0207428_10013651
698 Ga0268266_10029338
699 Ga0307406_10025882
700 Ga0307416_100003519
701 Ga0307416_100195307
702 Ga0307416_100318957
703 Ga0307415_100000519
704 Ga0373950_0010565
705 Ga0373958_0004975
706 Ga0373959_0007232
707 Ga0373938_0015406
708 Ga0373951_0001201
709 Ga0373939_0044365
710 Ga0373942_0018555
711 Ga0373931_0003088
712 Ga0395899_0002207
713 Ga0395899_0003223
714 Ga0395899_0005084
715 Ga0395899_0006551
716 Ga0395899_0007539
717 Ga0395899_0044580
718 Ga0395899_0060485
719 Ga0395899_0065241
720 Ga0395899_0095016
721 Ga0395899_0126622
722 Ga0395899_0171365
723 Ga0395900_0000929
724 Ga0395900_0005079
725 Ga0395900_0019403
726 Ga0395900_0046390
727 Ga0395900_0047342
728 Ga0395900_0052766
729 Ga0395900_0075291
730 Ga0395900_0081927
731 Ga0395900_0107256
732 Ga0395900_0153765
733 Ga0395900_0193850
734 Ga0395900_0236553
735 Ga0395898_0002345
736 Ga0395898_0004400
737 Ga0395898_0016670
738 Ga0395898_0020271
739 Ga0395898_0023325
740 Ga0395898_0032890
741 Ga0395898_0042047
742 Ga0395898_0049310
743 Ga0395898_0064669
744 Ga0395898_0066212
745 Ga0395898_0068720
746 Ga0395898_0172036
747 Ga0395905_0007192
748 Ga0395905_0021305
749 Ga0395905_0024654
750 Ga0395905_0054482
751 Ga0395905_0066502
752 Ga0395905_0089600
753 Ga0395905_0258709
754 Ga0395901_0006433
755 Ga0395901_0012793
756 Ga0395901_0022538
757 Ga0395901_0025728
758 Ga0395901_0032482
759 Ga0395901_0035441
760 Ga0395901_0040531
761 Ga0395901_0046481
762 Ga0395901_0125578
763 Ga0395901_0164948
764 Ga0395901_0169297
765 Ga0395901_0236778
766 Ga0395901_0276319
767 Ga0395901_0388211
768 Ga0439439_0005418
769 Ga0439433_0001128
770 Ga0439448_0002556
771 Ga0439457_017826
772 Ga0439462_0003970
773 Ga0450915_000090
774 Ga0450888_000809
775 Ga0439440_0012345
776 Ga0466964_0000660
777 Ga0466960_0010796
778 Ga0495603_0072391
779 Ga0495629_0062821
780 Ga0495582_0003878
781 Ga0495584_0021058
782 Ga0495607_0095370
783 Ga0495620_0061314
784 Ga0495628_0038960
785 Ga0495644_0053800
786 Ga0495665_0116666
787 Ga0495586_0023494
788 Ga0495598_0047074
789 Ga0495634_0035135
790 Ga0495635_0158569
791 Ga0495661_0095193
792 Ga0495613_0089687
793 Ga0495671_0066883
794 Ga0495589_0058258
795 Ga0495581_0000487
796 Ga0495636_0031994
797 Ga0495676_0123140
798 Ga0495685_021162
799 Ga0496100_0002277
800 Ga0496100_0259028
801 Ga0496101_0032339
802 Ga0496101_0036581
803 Ga0496101_0066706
804 Ga0496101_0124814
805 Ga0496102_0253080
806 Ga0496102_0261487
807 Ga0496103_0042385
808 Ga0496103_0140690
809 Ga0496104_0000332
810 Ga0496104_0012048
811 Ga0496104_0026915
812 Ga0496104_0111219
813 Ga0496104_0159283
814 Ga0496105_0003459
815 Ga0496105_0027716
816 Ga0496105_0062552
817 Ga0496105_0078136
818 Ga0496106_0008501
819 Ga0496106_0153742
820 Ga0496107_0010805
821 Ga0496107_0030412
822 Ga0496107_0088908
823 Ga0496108_0009092
824 Ga0496108_0013138
825 Ga0496108_0021717
826 Ga0496108_0045643
827 Ga0496108_0111126
828 Ga0496108_0183882
829 Ga0496109_0000288
830 Ga0496109_0006052
831 Ga0496109_0008352
832 Ga0496109_0209214
833 Ga0496109_0360040
834 Ga0496110_0000069
835 Ga0496110_0013159
836 Ga0496110_0014066
837 Ga0496110_0023263
838 Ga0496110_0024397
839 Ga0496110_0033219
840 Ga0496110_0040397
841 Ga0496110_0053561
842 Ga0496110_0065318
843 Ga0496111_0000084
844 Ga0496111_0002857
845 Ga0496111_0010433
846 Ga0496111_0107186
847 Ga0496111_0121476
848 Ga0496111_0215054
849 Ga0496112_0016344
850 Ga0496112_0202164
851 Ga0496113_0002375
852 Ga0496113_0010153
853 Ga0496113_0019776
854 Ga0496114_0044911
855 Ga0496115_0018282
856 Ga0501031_0025428
857 Ga0501031_0028121
858 Ga0501031_0080121
859 Ga0501032_0003181
860 Ga0501032_0010209
861 Ga0501032_0077610
862 Ga0501033_0020848
863 Ga0501033_0030377
864 Ga0501034_0036000
865 Ga0501036_0012451
866 Ga0501036_0168945
867 Ga0501036_0217996
868 Ga0501036_0291411
869 Ga0501037_0007860
870 Ga0501037_0021569
871 Ga0501038_0019264
872 Ga0501038_0071507
873 Ga0501038_0279959
874 Ga0501039_0003065
875 Ga0501039_0005295
876 Ga0501039_0110530
877 Ga0501040_0045546
878 Ga0501041_0037441
879 Ga0501041_0086173
880 Ga0501041_0137043
881 Ga0501042_0009613
882 Ga0501042_0021374
883 Ga0501042_0043951
884 Ga0501042_0049245
885 Ga0501042_0108217
886 Ga0501043_0003877
887 Ga0501043_0014662
888 Ga0501046_0007566
889 Ga0501046_0017152
890 Ga0501046_0032938
891 Ga0501047_0090367
892 Ga0501048_0007018
893 Ga0501048_0011299
894 Ga0501048_0028942
895 Ga0501048_0167739
896 Ga0501067_0000374
897 Ga0501067_0005504
898 Ga0501067_0022116
899 Ga0501067_0048317
900 Ga0501068_0001319
901 Ga0501068_0040404
902 Ga0501069_0003652
903 Ga0501069_0120375
904 Ga0501069_0174027
905 Ga0501070_0058493
906 Ga0501070_0084055
907 Ga0501071_0026758
908 Ga0501071_0029238
909 Ga0501071_0180712
910 Ga0501071_0195932
911 Ga0501072_0003758
912 Ga0501072_0023380
913 Ga0501072_0132813
914 Ga0501072_0186877
915 Ga0501073_0005696
916 Ga0501073_0026544
917 Ga0501073_0080029
918 Ga0501074_0024485
919 Ga0501074_0100629
920 Ga0501074_0128489
921 Ga0501075_0031042
922 Ga0501075_0032845
923 Ga0501075_0087322
924 Ga0501075_0117276
925 Ga0501076_0003503
926 Ga0501076_0066301
927 Ga0501076_0079578
928 Ga0501076_0097553
929 Ga0501076_0112732
930 Ga0501077_0012259
931 Ga0501077_0016277
932 Ga0501077_0041630
933 Ga0501077_0101987
934 Ga0501077_0155771
935 Ga0501077_0163304
936 Ga0501079_0019124
937 Ga0501079_0021580
938 Ga0501079_0119297
939 Ga0501079_0207479
940 Ga0501080_0058879
941 Ga0501080_0109414
942 Ga0501080_0156811
943 Ga0501080_0231367
944 Ga0501081_0019831
945 Ga0501081_0037814
946 Ga0501081_0076953
947 Ga0501081_0142320
948 Ga0501081_0250258
949 Ga0501083_0024863
950 Ga0501083_0068399
951 Ga0501035_0017021
952 Ga0501035_0083411
953 Ga0501044_0045481
954 Ga0501044_0094413
955 Ga0501044_0263510
956 Ga0501045_0023318
957 Ga0501045_0060568
958 Ga0501045_0088986
959 Ga0501045_0095514
960 nmdc:mga05p37_275055_c1
961 nmdc:mga05p37_502720_c1
962 nmdc:mga05p37_76460_c1
963 nmdc:mga05p37_9283_c1
964 nmdc:mga0qj67_30113_c1
965 nmdc:mga0qj67_85776_c1
966 nmdc:mga06r32_150036_c1
967 nmdc:mga06r32_175762_c1
968 nmdc:mga08y16_186461_c1
969 nmdc:mga08y16_237757_c1
970 nmdc:mga08y16_24920_c1
971 nmdc:mga08y16_442685_c1
972 nmdc:mga08y16_86892_c1
973 nmdc:mga0rr50_214982_c1
974 nmdc:mga08x19_251739_c1
975 nmdc:mga08x19_84004_c1
976 Ga0495619_0021967
977 Ga0501084_0006463
978 Ga0501084_0033242
979 Ga0501084_0050465
980 Ga0501084_0050851
981 Ga0501084_0177116
982 Ga0501082_0005543
983 Ga0501082_0068120
984 Ga0501082_0193156
985 Ga0501082_0281184
986 Ga0530510_0030574
987 Ga0530510_0045407
988 Ga0530510_0113343
989 Ga0530510_0186448
990 Ga0530510_0233794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

5

76

0.98

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

106

339

0.97

PF13614

AAA_31

AAA domain

108

161

0.93

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

111

318

0.88

PF09140

MipZ

ATPase MipZ

109

248

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5auq-assembly3.cif.gz_G crystal structure of atpase-type hypb in the nucleotide free state 0.8981 110 345
5auq-assembly2.cif.gz_E crystal structure of atpase-type hypb in the nucleotide free state 0.8808 108 345
5auq-assembly1.cif.gz_A crystal structure of atpase-type hypb in the nucleotide free state 0.8727 110 345
5auq-assembly2.cif.gz_B crystal structure of atpase-type hypb in the nucleotide free state 0.8712 108 345
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8695 3 78
ID Description Score Start End Superfamily
af_P9WJN7_3_100_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9606 6 93 3.30.300.130
af_Q57731_34_290_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9126 109 349 3.40.50.300
af_P9WJN7_114_362_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9106 107 345 3.40.50.300
af_Q2FW86_86_295_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9067 107 311 3.40.50.300
af_Q93459_54_311_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9023 107 348 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A136KJ32-F1-model_v4 Putative 1,2-phenylacetyl-CoA epoxidase, subunit D 0.9674 10 78
AF-A0A537TM20-F1-model_v4 DUF59 domain-containing protein 0.9667 1 92
AF-A0A538EI59-F1-model_v4 Metal-sulfur cluster assembly factor 0.9467 2 77
AF-A0A537TM20-F1-model_v4 DUF59 domain-containing protein 0.9467 1 92
AF-A0A662P2V9-F1-model_v4 Iron-sulfur cluster carrier protein 0.9362 109 347 GO:0005524
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663

Map