F454737

General Info

Members Datasets Scaffolds Average Seq Length
495 266 990 104

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_11113646|Ga0207668_111136461
Length 120
Sequence MTRYEYRRYQALGNDYMIVEQRDYHVFTGKLPELVRLYADEGIAIQQEVLGGFIGAFTTDIGALSTYTSMWGYASHAEREGRRAALQGRADWQAFLGRIQPLIHTQQNRILVPTSFSPIA

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
79 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
80 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
171 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
172 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
173 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
174 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
175 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 8.69
Rhizosphere 88.48
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_11113646 3300025972 Bacteria 708
2 Ga0070658_10009377 3300005327 Bacteria 7865
3 Ga0070683_100043344 3300005329 Bacteria 4147
4 Ga0070683_100252478 3300005329 Bacteria 1677
5 Ga0070670_100072501 3300005331 Bacteria 2957
6 Ga0070670_100401787 3300005331 Bacteria 1210
7 Ga0070670_101888850 3300005331 Bacteria 550
8 Ga0068869_100008731 3300005334 Bacteria 6546
9 Ga0068869_100459544 3300005334 Bacteria 1056
10 Ga0070680_100306571 3300005336 Bacteria 1347
11 Ga0070680_100753299 3300005336 Bacteria 839
12 Ga0070682_100007962 3300005337 Bacteria 5963
13 Ga0070682_100132499 3300005337 Bacteria 1689
14 Ga0070682_100573372 3300005337 Bacteria 887
15 Ga0068868_100510629 3300005338 Bacteria 1054
16 Ga0070660_100043274 3300005339 Bacteria 3441
17 Ga0070689_100511611 3300005340 Bacteria 1030
18 Ga0070687_100027559 3300005343 Bacteria 2746
19 Ga0070661_100099165 3300005344 Bacteria 2164
20 Ga0070692_10023272 3300005345 Bacteria 3034
21 Ga0070692_10048849 3300005345 Bacteria 2193
22 Ga0070675_100032863 3300005354 Bacteria 4201
23 Ga0070675_100170758 3300005354 Bacteria 1875
24 Ga0070674_100266586 3300005356 Bacteria 1352
25 Ga0070674_101876321 3300005356 Unclassified 544
26 Ga0070673_100006406 3300005364 Bacteria 7652
27 Ga0070673_100211869 3300005364 Unclassified 1674
28 Ga0070688_100006778 3300005365 Bacteria 6142
29 Ga0070688_100994042 3300005365 Bacteria 666
30 Ga0070659_100052434 3300005366 Bacteria 3208
31 Ga0070659_100625921 3300005366 Bacteria 926
32 Ga0070659_101898763 3300005366 Bacteria 534
33 Ga0070667_101470170 3300005367 Bacteria 640
34 Ga0070703_10026831 3300005406 Bacteria 1714
35 Ga0070701_10038472 3300005438 Bacteria 2421
36 Ga0070705_100037690 3300005440 Bacteria 2729
37 Ga0070700_100045552 3300005441 Bacteria 2706
38 Ga0070700_100119103 3300005441 Bacteria 1766
39 Ga0070700_100843461 3300005441 Bacteria 741
40 Ga0070694_100228409 3300005444 Bacteria 1399
41 Ga0070708_100920966 3300005445 Bacteria 820
42 Ga0070663_100037341 3300005455 Bacteria 3381
43 Ga0070663_102112437 3300005455 Bacteria 508
44 Ga0070678_100151225 3300005456 Bacteria 1870
45 Ga0070678_100219115 3300005456 Bacteria 1581
46 Ga0070678_100372262 3300005456 Bacteria 1234
47 Ga0070678_100408933 3300005456 Bacteria 1180
48 Ga0070662_100164271 3300005457 Bacteria 1739
49 Ga0070662_100381345 3300005457 Bacteria 1160
50 Ga0070681_10435144 3300005458 Bacteria 1224
51 Ga0070681_10680622 3300005458 Bacteria 944
52 Ga0070681_10961412 3300005458 Bacteria 773
53 Ga0068867_100198682 3300005459 Bacteria 1604
54 Ga0068867_100575853 3300005459 Bacteria 978
55 Ga0070706_100142925 3300005467 Bacteria 2234
56 Ga0070698_100135059 3300005471 Bacteria 2421
57 Ga0070699_100375143 3300005518 Bacteria 1284
58 Ga0070679_100285719 3300005530 Bacteria 1602
59 Ga0070679_101148412 3300005530 Bacteria 722
60 Ga0070684_100024872 3300005535 Bacteria 5026
61 Ga0070684_100753005 3300005535 Bacteria 909
62 Ga0068853_100429217 3300005539 Bacteria 1240
63 Ga0070672_100340551 3300005543 Bacteria 1277
64 Ga0070695_100436012 3300005545 Bacteria 1001
65 Ga0070696_100335772 3300005546 Bacteria 1167
66 Ga0070693_101262475 3300005547 Bacteria 569
67 Ga0070664_100120645 3300005564 Bacteria 2295
68 Ga0070664_100186105 3300005564 Bacteria 1848
69 Ga0068857_100803080 3300005577 Bacteria 898
70 Ga0068857_100893574 3300005577 Bacteria 851
71 Ga0068854_100214676 3300005578 Bacteria 1519
72 Ga0068856_100047468 3300005614 Bacteria 4230
73 Ga0070702_100158678 3300005615 Bacteria 1460
74 Ga0070702_100256707 3300005615 Bacteria 1188
75 Ga0068852_100370177 3300005616 Bacteria 1403
76 Ga0068852_100377822 3300005616 Bacteria 1389
77 Ga0068864_100078582 3300005618 Bacteria 2888
78 Ga0068864_102363614 3300005618 Bacteria 538
79 Ga0068866_10174293 3300005718 Bacteria 1265
80 Ga0068866_11042381 3300005718 Bacteria 583
81 Ga0068861_100082588 3300005719 Bacteria 2519
82 Ga0068861_102139310 3300005719 Unclassified 560
83 Ga0068870_10156407 3300005840 Bacteria 1348
84 Ga0068870_10200335 3300005840 Bacteria 1210
85 Ga0068870_10656659 3300005840 Bacteria 719
86 Ga0068870_11472633 3300005840 Bacteria 500
87 Ga0068858_100318310 3300005842 Bacteria 1486
88 Ga0068860_100042966 3300005843 Bacteria 4313
89 Ga0068862_100911638 3300005844 Bacteria 865
90 Ga0068862_101485683 3300005844 Bacteria 683
91 Ga0081455_10238896 3300005937 Bacteria 1336
92 Ga0081455_10885234 3300005937 Bacteria 556
93 Ga0081539_10000216 3300005985 Bacteria 134976
94 Ga0070717_11239289 3300006028 Bacteria 679
95 Ga0075365_11228286 3300006038 Bacteria 527
96 Ga0075432_10304047 3300006058 Bacteria 663
97 Ga0070715_10011414 3300006163 Bacteria 3200
98 Ga0070716_101380673 3300006173 Bacteria 572
99 Ga0070712_101033727 3300006175 Bacteria 712
100 Ga0097621_100233931 3300006237 Bacteria 1605
101 Ga0068871_101842067 3300006358 Bacteria 575
102 Ga0075431_101859979 3300006847 Bacteria 558
103 Ga0068865_100043199 3300006881 Bacteria 3078
104 Ga0075436_101079219 3300006914 Bacteria 604
105 Ga0111539_10151687 3300009094 Bacteria 2712
106 Ga0111539_10680368 3300009094 Bacteria 1198
107 Ga0105245_10026579 3300009098 Bacteria 5096
108 Ga0105245_10616630 3300009098 Bacteria 1113
109 Ga0105245_11515901 3300009098 Bacteria 721
110 Ga0105247_10775672 3300009101 Bacteria 729
111 Ga0114129_10078325 3300009147 Bacteria 4597
112 Ga0114129_10123892 3300009147 Bacteria 3554
113 Ga0114129_10267120 3300009147 Bacteria 2290
114 Ga0114129_12673424 3300009147 Bacteria 595
115 Ga0105243_10027580 3300009148 Bacteria 4352
116 Ga0105243_10173062 3300009148 Bacteria 1872
117 Ga0105243_10188980 3300009148 Bacteria 1797
118 Ga0105243_10374698 3300009148 Bacteria 1314
119 Ga0105243_10604048 3300009148 Bacteria 1057
120 Ga0105242_10298810 3300009176 Bacteria 1469
121 Ga0105242_10424865 3300009176 Bacteria 1246
122 Ga0105242_10805562 3300009176 Bacteria 930
123 Ga0105248_10601953 3300009177 Bacteria 1240
124 Ga0105248_10889442 3300009177 Bacteria 1005
125 Ga0105248_12156434 3300009177 Bacteria 634
126 Ga0105238_10669258 3300009551 Bacteria 1049
127 Ga0105249_10437258 3300009553 Bacteria 1345
128 Ga0105249_11511704 3300009553 Bacteria 744
129 Ga0105239_10082820 3300010375 Bacteria 3533
130 Ga0105246_10013501 3300011119 Bacteria 5121
131 Ga0105246_10117234 3300011119 Bacteria 1967
132 Ga0105246_11239228 3300011119 Bacteria 688
133 Ga0105246_11359862 3300011119 Bacteria 661
134 Ga0157337_1011374 3300012483 Bacteria 702
135 Ga0157343_1005418 3300012488 Bacteria 828
136 Ga0157327_1045129 3300012512 Bacteria 607
137 Ga0157373_10591112 3300013100 Bacteria 807
138 Ga0157371_10149953 3300013102 Bacteria 1663
139 Ga0157374_12063999 3300013296 Bacteria 597
140 Ga0157378_11488618 3300013297 Bacteria 721
141 Ga0163162_10348033 3300013306 Bacteria 1615
142 Ga0163162_12410331 3300013306 Bacteria 605
143 Ga0157372_10021960 3300013307 Bacteria 6899
144 Ga0157372_10044898 3300013307 Bacteria 4898
145 Ga0157375_10124782 3300013308 Bacteria 2688
146 Ga0157375_10898245 3300013308 Bacteria 1030
147 Ga0163163_10044385 3300014325 Bacteria 4360
148 Ga0163163_10422921 3300014325 Bacteria 1391
149 Ga0163163_10592405 3300014325 Bacteria 1172
150 Ga0163163_11409905 3300014325 Bacteria 758
151 Ga0157380_10013084 3300014326 Bacteria 6038
152 Ga0157380_10054594 3300014326 Bacteria 3171
153 Ga0157380_12825726 3300014326 Bacteria 552
154 Ga0157380_13308918 3300014326 Bacteria 515
155 Ga0157377_10233235 3300014745 Bacteria 1184
156 Ga0157377_10486053 3300014745 Bacteria 860
157 Ga0157379_10119906 3300014968 Bacteria 2366
158 Ga0157379_10177685 3300014968 Bacteria 1923
159 Ga0157376_10026662 3300014969 Bacteria 4569
160 Ga0157376_10615057 3300014969 Bacteria 1083
161 Ga0157376_10631676 3300014969 Bacteria 1069
162 Ga0182006_1289640 3300015261 Unclassified 537
163 Ga0163161_10209286 3300017792 Bacteria 1506
164 Ga0163161_11945077 3300017792 Bacteria 523
165 Ga0206353_10419071 3300020082 Bacteria 1043
166 Ga0207656_10021782 3300025321 Bacteria 2564
167 Ga0207696_1099232 3300025711 Bacteria 794
168 Ga0207642_10037023 3300025899 Bacteria 2099
169 Ga0207642_10552671 3300025899 Bacteria 711
170 Ga0207688_10003332 3300025901 Bacteria 8784
171 Ga0207688_10554841 3300025901 Bacteria 722
172 Ga0207647_10064579 3300025904 Bacteria 2224
173 Ga0207685_10035293 3300025905 Bacteria 1824
174 Ga0207645_10288182 3300025907 Bacteria 1092
175 Ga0207643_10006524 3300025908 Bacteria 6252
176 Ga0207643_10175419 3300025908 Bacteria 1295
177 Ga0207707_10150888 3300025912 Bacteria 2032
178 Ga0207707_11635130 3300025912 Bacteria 506
179 Ga0207671_10575221 3300025914 Bacteria 898
180 Ga0207693_11240233 3300025915 Bacteria 560
181 Ga0207660_10025146 3300025917 Bacteria 4040
182 Ga0207660_10591969 3300025917 Bacteria 903
183 Ga0207662_10089328 3300025918 Bacteria 1893
184 Ga0207662_10527709 3300025918 Bacteria 815
185 Ga0207657_10023042 3300025919 Bacteria 5808
186 Ga0207657_10125319 3300025919 Bacteria 2110
187 Ga0207652_10111831 3300025921 Bacteria 2423
188 Ga0207646_10260643 3300025922 Bacteria 1567
189 Ga0207681_10697738 3300025923 Bacteria 844
190 Ga0207694_10058454 3300025924 Bacteria 2999
191 Ga0207694_10955379 3300025924 Bacteria 725
192 Ga0207650_10394545 3300025925 Bacteria 1144
193 Ga0207659_10121940 3300025926 Bacteria 1999
194 Ga0207659_10707566 3300025926 Bacteria 863
195 Ga0207687_10023072 3300025927 Bacteria 4145
196 Ga0207687_10032441 3300025927 Bacteria 3537
197 Ga0207687_10075339 3300025927 Bacteria 2422
198 Ga0207700_11345452 3300025928 Bacteria 636
199 Ga0207644_10862353 3300025931 Bacteria 758
200 Ga0207644_11412420 3300025931 Bacteria 585
201 Ga0207690_10145754 3300025932 Bacteria 1750
202 Ga0207690_10151127 3300025932 Bacteria 1721
203 Ga0207690_10531197 3300025932 Bacteria 954
204 Ga0207690_10935297 3300025932 Bacteria 720
205 Ga0207690_11180904 3300025932 Bacteria 639
206 Ga0207686_11277039 3300025934 Bacteria 602
207 Ga0207709_10066632 3300025935 Bacteria 2269
208 Ga0207709_10102866 3300025935 Bacteria 1892
209 Ga0207709_10183777 3300025935 Bacteria 1479
210 Ga0207669_10124765 3300025937 Bacteria 1756
211 Ga0207669_10419776 3300025937 Bacteria 1053
212 Ga0207669_10497567 3300025937 Bacteria 975
213 Ga0207669_10747919 3300025937 Bacteria 807
214 Ga0207704_10028989 3300025938 Bacteria 3080
215 Ga0207665_10848079 3300025939 Bacteria 723
216 Ga0207691_10053238 3300025940 Bacteria 3696
217 Ga0207691_10963944 3300025940 Bacteria 712
218 Ga0207661_10705151 3300025944 Bacteria 928
219 Ga0207661_11281938 3300025944 Bacteria 673
220 Ga0207679_10507100 3300025945 Bacteria 1077
221 Ga0207667_10283820 3300025949 Bacteria 1692
222 Ga0207651_10198949 3300025960 Bacteria 1604
223 Ga0207651_11740218 3300025960 Bacteria 561
224 Ga0207712_10179601 3300025961 Bacteria 1661
225 Ga0207668_11407158 3300025972 Bacteria 629
226 Ga0207668_11571270 3300025972 Bacteria 594
227 Ga0207658_10889539 3300025986 Unclassified 811
228 Ga0207677_10881083 3300026023 Bacteria 806
229 Ga0207677_12199897 3300026023 Unclassified 513
230 Ga0207703_10369687 3300026035 Bacteria 1324
231 Ga0207639_10059511 3300026041 Bacteria 2943
232 Ga0207678_10320066 3300026067 Bacteria 1334
233 Ga0207678_10342816 3300026067 Bacteria 1288
234 Ga0207708_10040443 3300026075 Bacteria 3555
235 Ga0207702_10748987 3300026078 Bacteria 964
236 Ga0207641_10193538 3300026088 Bacteria 1871
237 Ga0207648_10131723 3300026089 Bacteria 2201
238 Ga0207676_10126437 3300026095 Bacteria 2166
239 Ga0207674_10111587 3300026116 Bacteria 2709
240 Ga0207675_100119315 3300026118 Bacteria 2495
241 Ga0207675_101802933 3300026118 Unclassified 631
242 Ga0207683_10032727 3300026121 Bacteria 4517
243 Ga0207683_10174968 3300026121 Bacteria 1945
244 Ga0207683_10832206 3300026121 Bacteria 857
245 Ga0207698_10143672 3300026142 Bacteria 2060
246 Ga0207698_12680604 3300026142 Bacteria 507
247 Ga0207428_10102511 3300027907 Bacteria 2210
248 Ga0207428_10886600 3300027907 Bacteria 631
249 Ga0268265_10117202 3300028380 Bacteria 2187
250 Ga0268265_10336551 3300028380 Bacteria 1373
251 Ga0268265_11959557 3300028380 Bacteria 593
252 Ga0268264_10373382 3300028381 Bacteria 1364
253 Ga0268264_11882797 3300028381 Bacteria 608
254 Ga0307406_11432925 3300031901 Bacteria 606
255 Ga0307416_101438437 3300032002 Bacteria 795
256 Ga0307415_100035946 3300032126 Bacteria 3241
257 Ga0373958_0003560 3300034819 Bacteria 2255
258 Ga0373939_0303987 3300035114 Bacteria 637
259 Ga0373941_0026333 3300035115 Bacteria 1688
260 Ga0373943_0271410 3300035170 Bacteria 957
261 Ga0373946_0342451 3300035171 Unclassified 746
262 Ga0373962_0043679 3300035242 Bacteria 1271
263 Ga0373947_0024036 3300035725 Bacteria 3548
264 Ga0395898_0693994 3300037466 Bacteria 960
265 Ga0395905_0054435 3300037471 Bacteria 3745
266 Ga0395901_0264420 3300038443 Bacteria 1790
267 Ga0395901_1467045 3300038443 Bacteria 639
268 Ga0436365_0739705 3300039437 Bacteria 527
269 Ga0451789_0094943 3300041443 Bacteria 928
270 Ga0451791_0507057 3300041451 Bacteria 556
271 Ga0451793_0419537 3300041452 Bacteria 2015
272 Ga0451795_0888621 3300041456 Bacteria 1499
273 Ga0451800_1135245 3300041459 Bacteria 1767
274 Ga0451800_1291560 3300041459 Bacteria 601
275 Ga0451802_0660182 3300041460 Bacteria 755
276 Ga0451802_1535929 3300041460 Bacteria 2386
277 Ga0451804_0432326 3300041463 Bacteria 1749
278 Ga0451807_2366474 3300041486 Bacteria 876
279 Ga0451835_0211301 3300041492 Bacteria 1240
280 Ga0451835_0617972 3300041492 Bacteria 4077
281 Ga0451837_0063534 3300041494 Bacteria 751
282 Ga0451839_0934818 3300041496 Bacteria 556
283 Ga0451847_0947387 3300041503 Bacteria 1412
284 Ga0451849_0501746 3300041505 Bacteria 1322
285 Ga0451851_0333989 3300041507 Bacteria 1312
286 Ga0451853_0326843 3300041512 Bacteria 762
287 Ga0451853_2636525 3300041512 Bacteria 510
288 Ga0451853_3106679 3300041512 Bacteria 777
289 Ga0439450_179553 3300042008 Bacteria 562
290 Ga0450915_017973 3300042119 Bacteria 548
291 Ga0495603_0014008 3300046455 Bacteria 4849
292 Ga0495603_0029595 3300046455 Bacteria 3302
293 Ga0495603_0805595 3300046455 Bacteria 536
294 Ga0495590_0088286 3300046457 Bacteria 1096
295 Ga0495629_0724107 3300046459 Bacteria 660
296 Ga0495651_0328696 3300046462 Bacteria 1017
297 Ga0495582_0424584 3300046473 Bacteria 767
298 Ga0495639_0540311 3300046475 Bacteria 597
299 Ga0495664_0136566 3300046477 Bacteria 1486
300 Ga0495584_0036379 3300046491 Bacteria 2488
301 Ga0495594_0185181 3300046499 Bacteria 1186
302 Ga0495596_0104163 3300046500 Bacteria 1102
303 Ga0495596_0152840 3300046500 Bacteria 896
304 Ga0495608_0754782 3300046511 Bacteria 576
305 Ga0495620_0089948 3300046515 Bacteria 1233
306 Ga0495630_0233963 3300046517 Bacteria 1404
307 Ga0495630_0263635 3300046517 Bacteria 1316
308 Ga0495644_0040981 3300046523 Unclassified 1745
309 Ga0495663_0245403 3300046525 Bacteria 635
310 Ga0495640_0294381 3300046533 Bacteria 1009
311 Ga0495587_0202392 3300046536 Bacteria 1123
312 Ga0495656_0794406 3300046615 Bacteria 511
313 Ga0495611_0267051 3300046648 Bacteria 792
314 Ga0495588_0122703 3300046674 Bacteria 1370
315 Ga0495657_0109535 3300046675 Bacteria 1751
316 Ga0495613_0058078 3300046689 Bacteria 2840
317 Ga0495670_0332224 3300046691 Bacteria 817
318 Ga0495671_0327149 3300046692 Unclassified 736
319 Ga0495589_0238230 3300046794 Bacteria 852
320 Ga0495589_0241401 3300046794 Bacteria 846
321 Ga0495600_0235411 3300046809 Bacteria 1168
322 Ga0495581_0912992 3300047315 Archaea 501
323 Ga0495674_0108438 3300047319 Bacteria 2356
324 Ga0495674_0222024 3300047319 Bacteria 1562
325 Ga0495676_0306146 3300047321 Bacteria 1071
326 Ga0495677_0227815 3300047445 Bacteria 727
327 Ga0495602_0210375 3300048088 Bacteria 1477
328 Ga0496100_0056962 3300048903 Bacteria 2558
329 Ga0496100_0418306 3300048903 Bacteria 1023
330 Ga0496101_0003698 3300048904 Bacteria 9538
331 Ga0496101_1146193 3300048904 Bacteria 610
332 Ga0496102_0102871 3300048905 Bacteria 2656
333 Ga0496102_0836900 3300048905 Bacteria 842
334 Ga0496102_1710500 3300048905 Bacteria 547
335 Ga0496103_0033062 3300048906 Bacteria 3159
336 Ga0496104_0038165 3300048907 Bacteria 4494
337 Ga0496104_0186500 3300048907 Bacteria 1985
338 Ga0496104_1128772 3300048907 Bacteria 687
339 Ga0496105_0606550 3300048908 Unclassified 849
340 Ga0496105_0728937 3300048908 Bacteria 759
341 Ga0496105_0947775 3300048908 Bacteria 646
342 Ga0496106_0018253 3300048909 Bacteria 5187
343 Ga0496106_0056235 3300048909 Bacteria 2974
344 Ga0496107_0021191 3300048910 Bacteria 4594
345 Ga0496108_0036217 3300048911 Bacteria 4105
346 Ga0496108_0509251 3300048911 Bacteria 1051
347 Ga0496108_1091318 3300048911 Bacteria 679
348 Ga0496109_0581594 3300048912 Bacteria 1055
349 Ga0496109_1423224 3300048912 Bacteria 629
350 Ga0496110_0665256 3300048913 Bacteria 942
351 Ga0496110_0927759 3300048913 Bacteria 777
352 Ga0496111_0002530 3300048914 Bacteria 11030
353 Ga0496111_0812717 3300048914 Bacteria 676
354 Ga0496112_0145784 3300048915 Bacteria 2336
355 Ga0496112_0386726 3300048915 Bacteria 1340
356 Ga0496112_0938013 3300048915 Bacteria 787
357 Ga0496113_0054646 3300048916 Bacteria 2990
358 Ga0496114_0020290 3300048917 Bacteria 5392
359 Ga0496114_0056269 3300048917 Bacteria 3282
360 Ga0496114_0785620 3300048917 Bacteria 830
361 Ga0496126_0057079 3300048929 Bacteria 3527
362 Ga0501031_0242164 3300049568 Bacteria 1172
363 Ga0501032_0093403 3300049569 Bacteria 1995
364 Ga0501032_0716792 3300049569 Bacteria 634
365 Ga0501033_0017749 3300049570 Bacteria 5375
366 Ga0501033_0197889 3300049570 Bacteria 1436
367 Ga0501036_0030924 3300049572 Bacteria 4524
368 Ga0501036_0128727 3300049572 Bacteria 2137
369 Ga0501036_0258743 3300049572 Bacteria 1458
370 Ga0501036_0640949 3300049572 Bacteria 880
371 Ga0501036_1750370 3300049572 Bacteria 500
372 Ga0501037_0013579 3300049573 Bacteria 5999
373 Ga0501037_1152990 3300049573 Bacteria 501
374 Ga0501038_0011021 3300049574 Bacteria 8253
375 Ga0501038_0333155 3300049574 Bacteria 1185
376 Ga0501038_0561797 3300049574 Bacteria 867
377 Ga0501038_1195076 3300049574 Bacteria 552
378 Ga0501039_0046007 3300049575 Bacteria 3371
379 Ga0501039_0048431 3300049575 Bacteria 3285
380 Ga0501039_0251789 3300049575 Bacteria 1389
381 Ga0501039_0296519 3300049575 Bacteria 1271
382 Ga0501039_0763017 3300049575 Bacteria 755
383 Ga0501039_0825361 3300049575 Bacteria 723
384 Ga0501040_0014561 3300049576 Bacteria 5185
385 Ga0501040_0241692 3300049576 Bacteria 1287
386 Ga0501040_0307665 3300049576 Bacteria 1133
387 Ga0501040_0653078 3300049576 Bacteria 760
388 Ga0501041_0061202 3300049577 Bacteria 2304
389 Ga0501041_0091817 3300049577 Bacteria 1874
390 Ga0501041_0481106 3300049577 Bacteria 789
391 Ga0501041_0857608 3300049577 Bacteria 583
392 Ga0501041_0889175 3300049577 Bacteria 572
393 Ga0501042_0027518 3300049578 Bacteria 3998
394 Ga0501042_0224876 3300049578 Bacteria 1354
395 Ga0501042_0281633 3300049578 Bacteria 1201
396 Ga0501042_0431183 3300049578 Bacteria 955
397 Ga0501043_0016829 3300049579 Bacteria 5731
398 Ga0501043_0265066 3300049579 Bacteria 1320
399 Ga0501043_0531407 3300049579 Bacteria 876
400 Ga0501043_0910177 3300049579 Bacteria 630
401 Ga0501046_0018952 3300049580 Bacteria 5713
402 Ga0501046_0028067 3300049580 Bacteria 4587
403 Ga0501048_0003223 3300049582 Bacteria 12431
404 Ga0501048_0083023 3300049582 Bacteria 2259
405 Ga0501048_0092959 3300049582 Bacteria 2128
406 Ga0501048_0407807 3300049582 Bacteria 972
407 Ga0501067_0067106 3300049583 Bacteria 1985
408 Ga0501067_0110522 3300049583 Bacteria 1528
409 Ga0501067_0273615 3300049583 Bacteria 940
410 Ga0501068_0027008 3300049584 Bacteria 3387
411 Ga0501068_0055972 3300049584 Bacteria 2390
412 Ga0501068_0179077 3300049584 Bacteria 1340
413 Ga0501068_0301861 3300049584 Bacteria 1025
414 Ga0501069_0094815 3300049585 Bacteria 1689
415 Ga0501069_0143887 3300049585 Bacteria 1368
416 Ga0501069_0258935 3300049585 Bacteria 1015
417 Ga0501069_0356774 3300049585 Bacteria 862
418 Ga0501070_0095726 3300049586 Bacteria 2456
419 Ga0501070_0152179 3300049586 Bacteria 1909
420 Ga0501070_0937275 3300049586 Bacteria 674
421 Ga0501071_0034851 3300049587 Bacteria 3583
422 Ga0501071_0037540 3300049587 Bacteria 3460
423 Ga0501071_0048184 3300049587 Bacteria 3063
424 Ga0501071_1168908 3300049587 Bacteria 594
425 Ga0501072_0016481 3300049588 Bacteria 5675
426 Ga0501072_0193333 3300049588 Bacteria 1622
427 Ga0501072_0228864 3300049588 Bacteria 1481
428 Ga0501072_0618931 3300049588 Bacteria 853
429 Ga0501072_1592035 3300049588 Bacteria 503
430 Ga0501073_0207654 3300049589 Bacteria 1353
431 Ga0501073_0430729 3300049589 Bacteria 912
432 Ga0501074_0020939 3300049590 Bacteria 4748
433 Ga0501075_0003693 3300049591 Bacteria 10274
434 Ga0501075_0010737 3300049591 Bacteria 6448
435 Ga0501075_0026668 3300049591 Bacteria 4256
436 Ga0501075_0043469 3300049591 Bacteria 3370
437 Ga0501075_0135278 3300049591 Bacteria 1878
438 Ga0501075_0427612 3300049591 Bacteria 1010
439 Ga0501076_0003365 3300049592 Bacteria 11225
440 Ga0501076_0018410 3300049592 Bacteria 5324
441 Ga0501076_0270986 3300049592 Bacteria 1390
442 Ga0501076_0527721 3300049592 Unclassified 973
443 Ga0501076_0752085 3300049592 Bacteria 804
444 Ga0501077_0007572 3300049593 Bacteria 6699
445 Ga0501077_0008087 3300049593 Bacteria 6500
446 Ga0501077_0493071 3300049593 Bacteria 785
447 Ga0501079_0021114 3300049741 Bacteria 4978
448 Ga0501079_0063196 3300049741 Bacteria 2856
449 Ga0501079_0093698 3300049741 Bacteria 2327
450 Ga0501079_0623091 3300049741 Bacteria 849
451 Ga0501079_0647838 3300049741 Bacteria 832
452 Ga0501079_0991863 3300049741 Bacteria 662
453 Ga0501080_0041953 3300049742 Bacteria 4262
454 Ga0501080_0045076 3300049742 Bacteria 4105
455 Ga0501080_1195154 3300049742 Bacteria 654
456 Ga0501081_0005952 3300049743 Bacteria 7893
457 Ga0501081_0006798 3300049743 Bacteria 7438
458 Ga0501081_0051104 3300049743 Bacteria 2850
459 Ga0501081_0255311 3300049743 Bacteria 1280
460 Ga0501083_0050840 3300049744 Bacteria 2788
461 Ga0501083_0051662 3300049744 Bacteria 2764
462 Ga0501083_0298923 3300049744 Bacteria 1047
463 Ga0501035_0094338 3300049822 Bacteria 2632
464 Ga0501035_0201514 3300049822 Bacteria 1706
465 Ga0501035_0459719 3300049822 Bacteria 1052
466 Ga0501044_0088931 3300049823 Bacteria 3118
467 Ga0501045_0004152 3300049824 Bacteria 10008
468 Ga0501045_0010173 3300049824 Bacteria 6583
469 Ga0501045_0764361 3300049824 Bacteria 712
470 Ga0501045_0938317 3300049824 Bacteria 635
471 Ga0501045_1054971 3300049824 Bacteria 595
472 nmdc:mga0yw44_315863_c1 3300050492 Bacteria 1048
473 nmdc:mga05p37_22746_c1 3300050507 Bacteria 7604
474 nmdc:mga05p37_93085_c1 3300050507 Bacteria 3714
475 nmdc:mga06r32_1413291_c1 3300050510 Bacteria 637
476 nmdc:mga08y16_29514_c1 3300050511 Bacteria 5778
477 nmdc:mga08y16_408035_c1 3300050511 Bacteria 1390
478 nmdc:mga0a205_322059_c1 3300050515 Bacteria 1417
479 nmdc:mga0a205_513939_c1 3300050515 Bacteria 1054
480 Ga0495612_0568284 3300053078 Bacteria 523
481 Ga0495619_0035949 3300053085 Bacteria 3224
482 Ga0501084_0002668 3300054114 Bacteria 14354
483 Ga0501084_0016447 3300054114 Bacteria 6143
484 Ga0501084_0261434 3300054114 Bacteria 1461
485 Ga0501084_1220390 3300054114 Bacteria 631
486 Ga0501084_1794456 3300054114 Bacteria 512
487 Ga0501082_0005365 3300060353 Bacteria 11122
488 Ga0501082_0009202 3300060353 Bacteria 8514
489 Ga0501082_0543760 3300060353 Bacteria 1016
490 Ga0501082_0753398 3300060353 Unclassified 852
491 Ga0501082_1923862 3300060353 Bacteria 516
492 Ga0530510_0010463 3300061734 Bacteria 6505
493 Ga0530510_0069879 3300061734 Bacteria 2548
494 Ga0530510_0378202 3300061734 Bacteria 1066
495 Ga0530510_0418508 3300061734 Bacteria 1011
496 Ga0207668_11113646
497 Ga0070658_10009377
498 Ga0070683_100043344
499 Ga0070683_100252478
500 Ga0070670_100072501
501 Ga0070670_100401787
502 Ga0070670_101888850
503 Ga0068869_100008731
504 Ga0068869_100459544
505 Ga0070680_100306571
506 Ga0070680_100753299
507 Ga0070682_100007962
508 Ga0070682_100132499
509 Ga0070682_100573372
510 Ga0068868_100510629
511 Ga0070660_100043274
512 Ga0070689_100511611
513 Ga0070687_100027559
514 Ga0070661_100099165
515 Ga0070692_10023272
516 Ga0070692_10048849
517 Ga0070675_100032863
518 Ga0070675_100170758
519 Ga0070674_100266586
520 Ga0070674_101876321
521 Ga0070673_100006406
522 Ga0070673_100211869
523 Ga0070688_100006778
524 Ga0070688_100994042
525 Ga0070659_100052434
526 Ga0070659_100625921
527 Ga0070659_101898763
528 Ga0070667_101470170
529 Ga0070703_10026831
530 Ga0070701_10038472
531 Ga0070705_100037690
532 Ga0070700_100045552
533 Ga0070700_100119103
534 Ga0070700_100843461
535 Ga0070694_100228409
536 Ga0070708_100920966
537 Ga0070663_100037341
538 Ga0070663_102112437
539 Ga0070678_100151225
540 Ga0070678_100219115
541 Ga0070678_100372262
542 Ga0070678_100408933
543 Ga0070662_100164271
544 Ga0070662_100381345
545 Ga0070681_10435144
546 Ga0070681_10680622
547 Ga0070681_10961412
548 Ga0068867_100198682
549 Ga0068867_100575853
550 Ga0070706_100142925
551 Ga0070698_100135059
552 Ga0070699_100375143
553 Ga0070679_100285719
554 Ga0070679_101148412
555 Ga0070684_100024872
556 Ga0070684_100753005
557 Ga0068853_100429217
558 Ga0070672_100340551
559 Ga0070695_100436012
560 Ga0070696_100335772
561 Ga0070693_101262475
562 Ga0070664_100120645
563 Ga0070664_100186105
564 Ga0068857_100803080
565 Ga0068857_100893574
566 Ga0068854_100214676
567 Ga0068856_100047468
568 Ga0070702_100158678
569 Ga0070702_100256707
570 Ga0068852_100370177
571 Ga0068852_100377822
572 Ga0068864_100078582
573 Ga0068864_102363614
574 Ga0068866_10174293
575 Ga0068866_11042381
576 Ga0068861_100082588
577 Ga0068861_102139310
578 Ga0068870_10156407
579 Ga0068870_10200335
580 Ga0068870_10656659
581 Ga0068870_11472633
582 Ga0068858_100318310
583 Ga0068860_100042966
584 Ga0068862_100911638
585 Ga0068862_101485683
586 Ga0081455_10238896
587 Ga0081455_10885234
588 Ga0081539_10000216
589 Ga0070717_11239289
590 Ga0075365_11228286
591 Ga0075432_10304047
592 Ga0070715_10011414
593 Ga0070716_101380673
594 Ga0070712_101033727
595 Ga0097621_100233931
596 Ga0068871_101842067
597 Ga0075431_101859979
598 Ga0068865_100043199
599 Ga0075436_101079219
600 Ga0111539_10151687
601 Ga0111539_10680368
602 Ga0105245_10026579
603 Ga0105245_10616630
604 Ga0105245_11515901
605 Ga0105247_10775672
606 Ga0114129_10078325
607 Ga0114129_10123892
608 Ga0114129_10267120
609 Ga0114129_12673424
610 Ga0105243_10027580
611 Ga0105243_10173062
612 Ga0105243_10188980
613 Ga0105243_10374698
614 Ga0105243_10604048
615 Ga0105242_10298810
616 Ga0105242_10424865
617 Ga0105242_10805562
618 Ga0105248_10601953
619 Ga0105248_10889442
620 Ga0105248_12156434
621 Ga0105238_10669258
622 Ga0105249_10437258
623 Ga0105249_11511704
624 Ga0105239_10082820
625 Ga0105246_10013501
626 Ga0105246_10117234
627 Ga0105246_11239228
628 Ga0105246_11359862
629 Ga0157337_1011374
630 Ga0157343_1005418
631 Ga0157327_1045129
632 Ga0157373_10591112
633 Ga0157371_10149953
634 Ga0157374_12063999
635 Ga0157378_11488618
636 Ga0163162_10348033
637 Ga0163162_12410331
638 Ga0157372_10021960
639 Ga0157372_10044898
640 Ga0157375_10124782
641 Ga0157375_10898245
642 Ga0163163_10044385
643 Ga0163163_10422921
644 Ga0163163_10592405
645 Ga0163163_11409905
646 Ga0157380_10013084
647 Ga0157380_10054594
648 Ga0157380_12825726
649 Ga0157380_13308918
650 Ga0157377_10233235
651 Ga0157377_10486053
652 Ga0157379_10119906
653 Ga0157379_10177685
654 Ga0157376_10026662
655 Ga0157376_10615057
656 Ga0157376_10631676
657 Ga0182006_1289640
658 Ga0163161_10209286
659 Ga0163161_11945077
660 Ga0206353_10419071
661 Ga0207656_10021782
662 Ga0207696_1099232
663 Ga0207642_10037023
664 Ga0207642_10552671
665 Ga0207688_10003332
666 Ga0207688_10554841
667 Ga0207647_10064579
668 Ga0207685_10035293
669 Ga0207645_10288182
670 Ga0207643_10006524
671 Ga0207643_10175419
672 Ga0207707_10150888
673 Ga0207707_11635130
674 Ga0207671_10575221
675 Ga0207693_11240233
676 Ga0207660_10025146
677 Ga0207660_10591969
678 Ga0207662_10089328
679 Ga0207662_10527709
680 Ga0207657_10023042
681 Ga0207657_10125319
682 Ga0207652_10111831
683 Ga0207646_10260643
684 Ga0207681_10697738
685 Ga0207694_10058454
686 Ga0207694_10955379
687 Ga0207650_10394545
688 Ga0207659_10121940
689 Ga0207659_10707566
690 Ga0207687_10023072
691 Ga0207687_10032441
692 Ga0207687_10075339
693 Ga0207700_11345452
694 Ga0207644_10862353
695 Ga0207644_11412420
696 Ga0207690_10145754
697 Ga0207690_10151127
698 Ga0207690_10531197
699 Ga0207690_10935297
700 Ga0207690_11180904
701 Ga0207686_11277039
702 Ga0207709_10066632
703 Ga0207709_10102866
704 Ga0207709_10183777
705 Ga0207669_10124765
706 Ga0207669_10419776
707 Ga0207669_10497567
708 Ga0207669_10747919
709 Ga0207704_10028989
710 Ga0207665_10848079
711 Ga0207691_10053238
712 Ga0207691_10963944
713 Ga0207661_10705151
714 Ga0207661_11281938
715 Ga0207679_10507100
716 Ga0207667_10283820
717 Ga0207651_10198949
718 Ga0207651_11740218
719 Ga0207712_10179601
720 Ga0207668_11407158
721 Ga0207668_11571270
722 Ga0207658_10889539
723 Ga0207677_10881083
724 Ga0207677_12199897
725 Ga0207703_10369687
726 Ga0207639_10059511
727 Ga0207678_10320066
728 Ga0207678_10342816
729 Ga0207708_10040443
730 Ga0207702_10748987
731 Ga0207641_10193538
732 Ga0207648_10131723
733 Ga0207676_10126437
734 Ga0207674_10111587
735 Ga0207675_100119315
736 Ga0207675_101802933
737 Ga0207683_10032727
738 Ga0207683_10174968
739 Ga0207683_10832206
740 Ga0207698_10143672
741 Ga0207698_12680604
742 Ga0207428_10102511
743 Ga0207428_10886600
744 Ga0268265_10117202
745 Ga0268265_10336551
746 Ga0268265_11959557
747 Ga0268264_10373382
748 Ga0268264_11882797
749 Ga0307406_11432925
750 Ga0307416_101438437
751 Ga0307415_100035946
752 Ga0373958_0003560
753 Ga0373939_0303987
754 Ga0373941_0026333
755 Ga0373943_0271410
756 Ga0373946_0342451
757 Ga0373962_0043679
758 Ga0373947_0024036
759 Ga0395898_0693994
760 Ga0395905_0054435
761 Ga0395901_0264420
762 Ga0395901_1467045
763 Ga0436365_0739705
764 Ga0451789_0094943
765 Ga0451791_0507057
766 Ga0451793_0419537
767 Ga0451795_0888621
768 Ga0451800_1135245
769 Ga0451800_1291560
770 Ga0451802_0660182
771 Ga0451802_1535929
772 Ga0451804_0432326
773 Ga0451807_2366474
774 Ga0451835_0211301
775 Ga0451835_0617972
776 Ga0451837_0063534
777 Ga0451839_0934818
778 Ga0451847_0947387
779 Ga0451849_0501746
780 Ga0451851_0333989
781 Ga0451853_0326843
782 Ga0451853_2636525
783 Ga0451853_3106679
784 Ga0439450_179553
785 Ga0450915_017973
786 Ga0495603_0014008
787 Ga0495603_0029595
788 Ga0495603_0805595
789 Ga0495590_0088286
790 Ga0495629_0724107
791 Ga0495651_0328696
792 Ga0495582_0424584
793 Ga0495639_0540311
794 Ga0495664_0136566
795 Ga0495584_0036379
796 Ga0495594_0185181
797 Ga0495596_0104163
798 Ga0495596_0152840
799 Ga0495608_0754782
800 Ga0495620_0089948
801 Ga0495630_0233963
802 Ga0495630_0263635
803 Ga0495644_0040981
804 Ga0495663_0245403
805 Ga0495640_0294381
806 Ga0495587_0202392
807 Ga0495656_0794406
808 Ga0495611_0267051
809 Ga0495588_0122703
810 Ga0495657_0109535
811 Ga0495613_0058078
812 Ga0495670_0332224
813 Ga0495671_0327149
814 Ga0495589_0238230
815 Ga0495589_0241401
816 Ga0495600_0235411
817 Ga0495581_0912992
818 Ga0495674_0108438
819 Ga0495674_0222024
820 Ga0495676_0306146
821 Ga0495677_0227815
822 Ga0495602_0210375
823 Ga0496100_0056962
824 Ga0496100_0418306
825 Ga0496101_0003698
826 Ga0496101_1146193
827 Ga0496102_0102871
828 Ga0496102_0836900
829 Ga0496102_1710500
830 Ga0496103_0033062
831 Ga0496104_0038165
832 Ga0496104_0186500
833 Ga0496104_1128772
834 Ga0496105_0606550
835 Ga0496105_0728937
836 Ga0496105_0947775
837 Ga0496106_0018253
838 Ga0496106_0056235
839 Ga0496107_0021191
840 Ga0496108_0036217
841 Ga0496108_0509251
842 Ga0496108_1091318
843 Ga0496109_0581594
844 Ga0496109_1423224
845 Ga0496110_0665256
846 Ga0496110_0927759
847 Ga0496111_0002530
848 Ga0496111_0812717
849 Ga0496112_0145784
850 Ga0496112_0386726
851 Ga0496112_0938013
852 Ga0496113_0054646
853 Ga0496114_0020290
854 Ga0496114_0056269
855 Ga0496114_0785620
856 Ga0496126_0057079
857 Ga0501031_0242164
858 Ga0501032_0093403
859 Ga0501032_0716792
860 Ga0501033_0017749
861 Ga0501033_0197889
862 Ga0501036_0030924
863 Ga0501036_0128727
864 Ga0501036_0258743
865 Ga0501036_0640949
866 Ga0501036_1750370
867 Ga0501037_0013579
868 Ga0501037_1152990
869 Ga0501038_0011021
870 Ga0501038_0333155
871 Ga0501038_0561797
872 Ga0501038_1195076
873 Ga0501039_0046007
874 Ga0501039_0048431
875 Ga0501039_0251789
876 Ga0501039_0296519
877 Ga0501039_0763017
878 Ga0501039_0825361
879 Ga0501040_0014561
880 Ga0501040_0241692
881 Ga0501040_0307665
882 Ga0501040_0653078
883 Ga0501041_0061202
884 Ga0501041_0091817
885 Ga0501041_0481106
886 Ga0501041_0857608
887 Ga0501041_0889175
888 Ga0501042_0027518
889 Ga0501042_0224876
890 Ga0501042_0281633
891 Ga0501042_0431183
892 Ga0501043_0016829
893 Ga0501043_0265066
894 Ga0501043_0531407
895 Ga0501043_0910177
896 Ga0501046_0018952
897 Ga0501046_0028067
898 Ga0501048_0003223
899 Ga0501048_0083023
900 Ga0501048_0092959
901 Ga0501048_0407807
902 Ga0501067_0067106
903 Ga0501067_0110522
904 Ga0501067_0273615
905 Ga0501068_0027008
906 Ga0501068_0055972
907 Ga0501068_0179077
908 Ga0501068_0301861
909 Ga0501069_0094815
910 Ga0501069_0143887
911 Ga0501069_0258935
912 Ga0501069_0356774
913 Ga0501070_0095726
914 Ga0501070_0152179
915 Ga0501070_0937275
916 Ga0501071_0034851
917 Ga0501071_0037540
918 Ga0501071_0048184
919 Ga0501071_1168908
920 Ga0501072_0016481
921 Ga0501072_0193333
922 Ga0501072_0228864
923 Ga0501072_0618931
924 Ga0501072_1592035
925 Ga0501073_0207654
926 Ga0501073_0430729
927 Ga0501074_0020939
928 Ga0501075_0003693
929 Ga0501075_0010737
930 Ga0501075_0026668
931 Ga0501075_0043469
932 Ga0501075_0135278
933 Ga0501075_0427612
934 Ga0501076_0003365
935 Ga0501076_0018410
936 Ga0501076_0270986
937 Ga0501076_0527721
938 Ga0501076_0752085
939 Ga0501077_0007572
940 Ga0501077_0008087
941 Ga0501077_0493071
942 Ga0501079_0021114
943 Ga0501079_0063196
944 Ga0501079_0093698
945 Ga0501079_0623091
946 Ga0501079_0647838
947 Ga0501079_0991863
948 Ga0501080_0041953
949 Ga0501080_0045076
950 Ga0501080_1195154
951 Ga0501081_0005952
952 Ga0501081_0006798
953 Ga0501081_0051104
954 Ga0501081_0255311
955 Ga0501083_0050840
956 Ga0501083_0051662
957 Ga0501083_0298923
958 Ga0501035_0094338
959 Ga0501035_0201514
960 Ga0501035_0459719
961 Ga0501044_0088931
962 Ga0501045_0004152
963 Ga0501045_0010173
964 Ga0501045_0764361
965 Ga0501045_0938317
966 Ga0501045_1054971
967 nmdc:mga0yw44_315863_c1
968 nmdc:mga05p37_22746_c1
969 nmdc:mga05p37_93085_c1
970 nmdc:mga06r32_1413291_c1
971 nmdc:mga08y16_29514_c1
972 nmdc:mga08y16_408035_c1
973 nmdc:mga0a205_322059_c1
974 nmdc:mga0a205_513939_c1
975 Ga0495612_0568284
976 Ga0495619_0035949
977 Ga0501084_0002668
978 Ga0501084_0016447
979 Ga0501084_0261434
980 Ga0501084_1220390
981 Ga0501084_1794456
982 Ga0501082_0005365
983 Ga0501082_0009202
984 Ga0501082_0543760
985 Ga0501082_0753398
986 Ga0501082_1923862
987 Ga0530510_0010463
988 Ga0530510_0069879
989 Ga0530510_0378202
990 Ga0530510_0418508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07978

NIPSNAP

NIPSNAP

19

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ap6-assembly1.cif.gz_A x-ray crystal structure of protein atu4242 from agrobacterium tumefaciens. northeast strucutral genomics consortium target atr43. 0.9686 1 104
1vqs-assembly1.cif.gz_B crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 a resolution 0.9669 1 104
5kak-assembly1.cif.gz_E crystal structure of an uncharacterized nipsnap-like domain protein from burkholderia xenovorans 0.9658 2 102
1vqy-assembly1.cif.gz_C crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution 0.9641 2 104
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.964 1 103
ID Description Score Start End Superfamily
5kakE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9658 2 102 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.964 1 103 3.30.70.100
1vqyA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9635 1 104 3.30.70.100
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9589 1 102 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.955 1 103 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538I135-F1-model_v4 NIPSNAP family protein 0.9892 2 104
AF-A0A7V9TB44-F1-model_v4 NIPSNAP family protein 0.9874 1 104
AF-A0A7K1R400-F1-model_v4 deleted 0.9799 1 104
AF-A0A7K2BLD9-F1-model_v4 deleted 0.9792 1 89
AF-A0A1Q3YCC1-F1-model_v4 NIPSNAP family protein 0.9788 6 102

Map