F454699
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 495 | 302 | 467 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_101148197|Ga0070664_1011481972 |
| Length | 117 |
| Sequence | MNELIVSLGIGVLTASGVWLLLRPRTFQVAIGLTLLAYAVNLFIFSMGRLRTGAAPVVTAAAADPSAYADPLPQALVLTAIVINFATTALLLVVVLASRGLRGTDHVDGQESTDDSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 6 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 7 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 8 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 9 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 10 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 11 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 12 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 13 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 14 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 15 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 16 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 17 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 18 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 19 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 20 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 21 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 22 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 23 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 24 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 25 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 26 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 233 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 302 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.14 |
| Metatranscriptomes | 0.2 |
| Isolates | 5.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.43 |
| Nodule | 3.84 |
| Rhizoplane | 5.05 |
| Rhizosphere | 85.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10203169 | 3300003322 | Bacteria | 1743 |
| 2 | Ga0065707_10147027 | 3300005295 | Bacteria | 1701 |
| 3 | Ga0070658_10009913 | 3300005327 | Bacteria | 7655 |
| 4 | Ga0070658_10060929 | 3300005327 | Bacteria | 3074 |
| 5 | Ga0070658_10420986 | 3300005327 | Bacteria | 1148 |
| 6 | Ga0070676_10085636 | 3300005328 | Bacteria | 1921 |
| 7 | Ga0070676_10568101 | 3300005328 | Bacteria | 814 |
| 8 | Ga0070683_100008005 | 3300005329 | Bacteria | 8969 |
| 9 | Ga0070690_100010474 | 3300005330 | Bacteria | 5398 |
| 10 | Ga0070670_100530285 | 3300005331 | Bacteria | 1049 |
| 11 | Ga0070670_100777314 | 3300005331 | Bacteria | 864 |
| 12 | Ga0068869_100660960 | 3300005334 | Bacteria | 888 |
| 13 | Ga0068869_100813139 | 3300005334 | Unclassified | 804 |
| 14 | Ga0070666_10025010 | 3300005335 | Bacteria | 3891 |
| 15 | Ga0070680_100014420 | 3300005336 | Bacteria | 6177 |
| 16 | Ga0070680_100082068 | 3300005336 | Bacteria | 2660 |
| 17 | Ga0070680_100150011 | 3300005336 | Bacteria | 1957 |
| 18 | Ga0070680_100184071 | 3300005336 | Bacteria | 1760 |
| 19 | Ga0070682_100010286 | 3300005337 | Bacteria | 5308 |
| 20 | Ga0070682_100067246 | 3300005337 | Bacteria | 2282 |
| 21 | Ga0070682_100095987 | 3300005337 | Bacteria | 1948 |
| 22 | Ga0068868_100530189 | 3300005338 | Bacteria | 1035 |
| 23 | Ga0068868_101830663 | 3300005338 | Bacteria | 574 |
| 24 | Ga0070660_100019751 | 3300005339 | Bacteria | 4942 |
| 25 | Ga0070660_100069718 | 3300005339 | Bacteria | 2742 |
| 26 | Ga0070660_100302192 | 3300005339 | Bacteria | 1312 |
| 27 | Ga0070689_100284651 | 3300005340 | Bacteria | 1372 |
| 28 | Ga0070691_10020419 | 3300005341 | Bacteria | 3061 |
| 29 | Ga0070691_10339626 | 3300005341 | Bacteria | 831 |
| 30 | Ga0070687_100016154 | 3300005343 | Bacteria | 3396 |
| 31 | Ga0070687_100204002 | 3300005343 | Bacteria | 1200 |
| 32 | Ga0070661_100006965 | 3300005344 | Bacteria | 7801 |
| 33 | Ga0070661_100087159 | 3300005344 | Bacteria | 2309 |
| 34 | Ga0070661_100199711 | 3300005344 | Bacteria | 1527 |
| 35 | Ga0070661_100643809 | 3300005344 | Bacteria | 860 |
| 36 | Ga0070692_10007879 | 3300005345 | Bacteria | 4722 |
| 37 | Ga0070692_10170060 | 3300005345 | Bacteria | 1256 |
| 38 | Ga0070692_10187435 | 3300005345 | Bacteria | 1203 |
| 39 | Ga0070692_11031448 | 3300005345 | Bacteria | 577 |
| 40 | Ga0070668_100119736 | 3300005347 | Bacteria | 2103 |
| 41 | Ga0070669_100007367 | 3300005353 | Bacteria | 7889 |
| 42 | Ga0070669_100021059 | 3300005353 | Bacteria | 4658 |
| 43 | Ga0070675_100010896 | 3300005354 | Bacteria | 7112 |
| 44 | Ga0070675_100536351 | 3300005354 | Bacteria | 1057 |
| 45 | Ga0070671_100215278 | 3300005355 | Bacteria | 1630 |
| 46 | Ga0070674_100835352 | 3300005356 | Bacteria | 798 |
| 47 | Ga0070674_102134359 | 3300005356 | Bacteria | 511 |
| 48 | Ga0070673_100050649 | 3300005364 | Bacteria | 3248 |
| 49 | Ga0070673_101226158 | 3300005364 | Bacteria | 703 |
| 50 | Ga0070688_100024071 | 3300005365 | Bacteria | 3587 |
| 51 | Ga0070659_100000693 | 3300005366 | Bacteria | 24520 |
| 52 | Ga0070659_101242215 | 3300005366 | Bacteria | 660 |
| 53 | Ga0070667_100130344 | 3300005367 | Bacteria | 2194 |
| 54 | Ga0070667_101025107 | 3300005367 | Bacteria | 770 |
| 55 | Ga0070667_101957469 | 3300005367 | Bacteria | 552 |
| 56 | Ga0070703_10178768 | 3300005406 | Bacteria | 818 |
| 57 | Ga0070714_100020726 | 3300005435 | Bacteria | 5373 |
| 58 | Ga0070713_101499363 | 3300005436 | Bacteria | 654 |
| 59 | Ga0070711_100130172 | 3300005439 | Bacteria | 1873 |
| 60 | Ga0070700_100001753 | 3300005441 | Bacteria | 10904 |
| 61 | Ga0070700_100588129 | 3300005441 | Bacteria | 870 |
| 62 | Ga0070694_100402188 | 3300005444 | Bacteria | 1072 |
| 63 | Ga0070694_101028356 | 3300005444 | Bacteria | 685 |
| 64 | Ga0070663_100011149 | 3300005455 | Bacteria | 5628 |
| 65 | Ga0070663_100012452 | 3300005455 | Bacteria | 5382 |
| 66 | Ga0070663_100056190 | 3300005455 | Bacteria | 2819 |
| 67 | Ga0070678_100227662 | 3300005456 | Bacteria | 1553 |
| 68 | Ga0070678_100868910 | 3300005456 | Bacteria | 823 |
| 69 | Ga0070662_100184692 | 3300005457 | Bacteria | 1646 |
| 70 | Ga0070662_100265886 | 3300005457 | Bacteria | 1383 |
| 71 | Ga0070662_101358624 | 3300005457 | Bacteria | 612 |
| 72 | Ga0070681_10006828 | 3300005458 | Bacteria | 11113 |
| 73 | Ga0070681_10017527 | 3300005458 | Bacteria | 7158 |
| 74 | Ga0070681_10241619 | 3300005458 | Bacteria | 1719 |
| 75 | Ga0068867_100001755 | 3300005459 | Bacteria | 15105 |
| 76 | Ga0068867_100808459 | 3300005459 | Bacteria | 837 |
| 77 | Ga0068867_100844762 | 3300005459 | Unclassified | 820 |
| 78 | Ga0070685_10334377 | 3300005466 | Bacteria | 1031 |
| 79 | Ga0070679_100028734 | 3300005530 | Bacteria | 5485 |
| 80 | Ga0070679_100075251 | 3300005530 | Bacteria | 3366 |
| 81 | Ga0070679_100449638 | 3300005530 | Bacteria | 1233 |
| 82 | Ga0070684_100188684 | 3300005535 | Bacteria | 1875 |
| 83 | Ga0068853_100003131 | 3300005539 | Bacteria | 12646 |
| 84 | Ga0068853_100118457 | 3300005539 | Bacteria | 2360 |
| 85 | Ga0068853_100642387 | 3300005539 | Bacteria | 1010 |
| 86 | Ga0070672_100018691 | 3300005543 | Bacteria | 5017 |
| 87 | Ga0070686_100596766 | 3300005544 | Bacteria | 870 |
| 88 | Ga0070686_101378760 | 3300005544 | Bacteria | 591 |
| 89 | Ga0070695_100332525 | 3300005545 | Bacteria | 1133 |
| 90 | Ga0070695_100583481 | 3300005545 | Bacteria | 875 |
| 91 | Ga0070696_100098675 | 3300005546 | Bacteria | 2090 |
| 92 | Ga0070693_100030007 | 3300005547 | Bacteria | 2969 |
| 93 | Ga0070665_100063019 | 3300005548 | Bacteria | 3718 |
| 94 | Ga0070665_101161726 | 3300005548 | Bacteria | 783 |
| 95 | Ga0070704_100642975 | 3300005549 | Bacteria | 936 |
| 96 | Ga0068855_100063785 | 3300005563 | Bacteria | 4298 |
| 97 | Ga0068855_100074798 | 3300005563 | Bacteria | 3934 |
| 98 | Ga0068855_100444615 | 3300005563 | Bacteria | 1415 |
| 99 | Ga0070664_100005054 | 3300005564 | Bacteria | 10577 |
| 100 | Ga0070664_100014100 | 3300005564 | Bacteria | 6519 |
| 101 | Ga0070664_100218943 | 3300005564 | Bacteria | 1703 |
| 102 | Ga0070664_100996115 | 3300005564 | Bacteria | 788 |
| 103 | Ga0070664_101148197 | 3300005564 | Bacteria | 732 |
| 104 | Ga0070664_101742698 | 3300005564 | Bacteria | 591 |
| 105 | Ga0068857_100015019 | 3300005577 | Bacteria | 6756 |
| 106 | Ga0068857_100747171 | 3300005577 | Bacteria | 932 |
| 107 | Ga0068854_100029205 | 3300005578 | Bacteria | 3816 |
| 108 | Ga0068856_100197532 | 3300005614 | Bacteria | 2026 |
| 109 | Ga0068856_100502063 | 3300005614 | Bacteria | 1234 |
| 110 | Ga0068856_101443519 | 3300005614 | Bacteria | 702 |
| 111 | Ga0070702_100489888 | 3300005615 | Bacteria | 900 |
| 112 | Ga0068852_100320082 | 3300005616 | Bacteria | 1506 |
| 113 | Ga0068852_100363817 | 3300005616 | Bacteria | 1415 |
| 114 | Ga0068852_100375379 | 3300005616 | Bacteria | 1394 |
| 115 | Ga0068859_100210991 | 3300005617 | Bacteria | 2028 |
| 116 | Ga0068859_100351101 | 3300005617 | Bacteria | 1570 |
| 117 | Ga0068859_102804066 | 3300005617 | Bacteria | 535 |
| 118 | Ga0068864_101074540 | 3300005618 | Bacteria | 800 |
| 119 | Ga0068866_10152414 | 3300005718 | Bacteria | 1340 |
| 120 | Ga0068861_100001610 | 3300005719 | Bacteria | 14384 |
| 121 | Ga0068861_100014724 | 3300005719 | Bacteria | 5494 |
| 122 | Ga0068861_100299708 | 3300005719 | Bacteria | 1392 |
| 123 | Ga0068861_100536626 | 3300005719 | Bacteria | 1064 |
| 124 | Ga0068851_10002036 | 3300005834 | Bacteria | 8920 |
| 125 | Ga0068851_10216247 | 3300005834 | Bacteria | 1075 |
| 126 | Ga0068851_10270964 | 3300005834 | Bacteria | 968 |
| 127 | Ga0068870_10012679 | 3300005840 | Bacteria | 3945 |
| 128 | Ga0068870_10284481 | 3300005840 | Bacteria | 1038 |
| 129 | Ga0068870_10995457 | 3300005840 | Unclassified | 597 |
| 130 | Ga0068863_100485776 | 3300005841 | Bacteria | 1215 |
| 131 | Ga0068858_101869927 | 3300005842 | Bacteria | 593 |
| 132 | Ga0068860_100060858 | 3300005843 | Bacteria | 3588 |
| 133 | Ga0068860_100281638 | 3300005843 | Bacteria | 1625 |
| 134 | Ga0068862_100005068 | 3300005844 | Bacteria | 11085 |
| 135 | Ga0068862_100487484 | 3300005844 | Bacteria | 1168 |
| 136 | Ga0068862_100974044 | 3300005844 | Bacteria | 837 |
| 137 | Ga0068862_102458499 | 3300005844 | Bacteria | 533 |
| 138 | Ga0075365_10022211 | 3300006038 | Bacteria | 3972 |
| 139 | Ga0075364_10815369 | 3300006051 | Bacteria | 636 |
| 140 | Ga0075362_10098821 | 3300006177 | Bacteria | 1362 |
| 141 | Ga0075367_10008005 | 3300006178 | Bacteria | 5449 |
| 142 | Ga0075367_10015269 | 3300006178 | Bacteria | 4169 |
| 143 | Ga0075366_10019210 | 3300006195 | Bacteria | 3951 |
| 144 | Ga0075366_10351781 | 3300006195 | Bacteria | 904 |
| 145 | Ga0097621_100423485 | 3300006237 | Bacteria | 1195 |
| 146 | Ga0097621_101561744 | 3300006237 | Bacteria | 627 |
| 147 | Ga0075370_10137065 | 3300006353 | Bacteria | 1430 |
| 148 | Ga0075370_10260130 | 3300006353 | Bacteria | 1029 |
| 149 | Ga0068871_100549003 | 3300006358 | Bacteria | 1046 |
| 150 | Ga0068871_102419998 | 3300006358 | Bacteria | 501 |
| 151 | Ga0075428_101436415 | 3300006844 | Bacteria | 723 |
| 152 | Ga0075431_100811435 | 3300006847 | Bacteria | 908 |
| 153 | Ga0075434_100547899 | 3300006871 | Bacteria | 1176 |
| 154 | Ga0075429_100126670 | 3300006880 | Bacteria | 2233 |
| 155 | Ga0068865_100004826 | 3300006881 | Bacteria | 8148 |
| 156 | Ga0068865_100316804 | 3300006881 | Bacteria | 1253 |
| 157 | Ga0068865_102048635 | 3300006881 | Bacteria | 520 |
| 158 | Ga0097620_100210985 | 3300006931 | Bacteria | 2028 |
| 159 | Ga0097620_100351121 | 3300006931 | Bacteria | 1570 |
| 160 | Ga0097620_102804085 | 3300006931 | Bacteria | 535 |
| 161 | Ga0105240_10154816 | 3300009093 | Bacteria | 2727 |
| 162 | Ga0111539_10435108 | 3300009094 | Bacteria | 1527 |
| 163 | Ga0105245_10284401 | 3300009098 | Bacteria | 1618 |
| 164 | Ga0114129_11497195 | 3300009147 | Bacteria | 829 |
| 165 | Ga0105243_10003862 | 3300009148 | Bacteria | 11970 |
| 166 | Ga0105241_10003941 | 3300009174 | Bacteria | 10983 |
| 167 | Ga0105241_10004527 | 3300009174 | Bacteria | 10281 |
| 168 | Ga0105241_11631367 | 3300009174 | Bacteria | 625 |
| 169 | Ga0105242_10581301 | 3300009176 | Unclassified | 1079 |
| 170 | Ga0105242_12476425 | 3300009176 | Bacteria | 567 |
| 171 | Ga0105248_10002755 | 3300009177 | Bacteria | 19524 |
| 172 | Ga0105248_11869018 | 3300009177 | Bacteria | 681 |
| 173 | Ga0105237_10026508 | 3300009545 | Bacteria | 5924 |
| 174 | Ga0105237_10617846 | 3300009545 | Bacteria | 1091 |
| 175 | Ga0105238_10113821 | 3300009551 | Bacteria | 2685 |
| 176 | Ga0105249_10008393 | 3300009553 | Bacteria | 8998 |
| 177 | Ga0105249_10918461 | 3300009553 | Bacteria | 943 |
| 178 | Ga0105239_11818878 | 3300010375 | Unclassified | 706 |
| 179 | Ga0157325_1014661 | 3300012485 | Bacteria | 632 |
| 180 | Ga0157373_10003131 | 3300013100 | Bacteria | 12498 |
| 181 | Ga0157373_10832597 | 3300013100 | Unclassified | 682 |
| 182 | Ga0157371_10032993 | 3300013102 | Bacteria | 3722 |
| 183 | Ga0157371_11297227 | 3300013102 | Bacteria | 563 |
| 184 | Ga0157370_10468512 | 3300013104 | Bacteria | 1158 |
| 185 | Ga0157370_10824077 | 3300013104 | Bacteria | 844 |
| 186 | Ga0157369_12146314 | 3300013105 | Bacteria | 566 |
| 187 | Ga0157374_10872402 | 3300013296 | Bacteria | 917 |
| 188 | Ga0157378_10415706 | 3300013297 | Bacteria | 1328 |
| 189 | Ga0157378_11413854 | 3300013297 | Bacteria | 739 |
| 190 | Ga0157378_11553815 | 3300013297 | Bacteria | 707 |
| 191 | Ga0157378_11917807 | 3300013297 | Bacteria | 642 |
| 192 | Ga0157372_10296762 | 3300013307 | Bacteria | 1880 |
| 193 | Ga0157372_10516559 | 3300013307 | Bacteria | 1392 |
| 194 | Ga0157372_11805883 | 3300013307 | Bacteria | 703 |
| 195 | Ga0157375_10336122 | 3300013308 | Bacteria | 1676 |
| 196 | Ga0157375_11049202 | 3300013308 | Bacteria | 953 |
| 197 | Ga0157380_10004661 | 3300014326 | Bacteria | 9541 |
| 198 | Ga0157380_10059377 | 3300014326 | Bacteria | 3052 |
| 199 | Ga0157380_11415837 | 3300014326 | Bacteria | 746 |
| 200 | Ga0157377_10113500 | 3300014745 | Bacteria | 1632 |
| 201 | Ga0157379_10035523 | 3300014968 | Bacteria | 4444 |
| 202 | Ga0157379_10143491 | 3300014968 | Bacteria | 2153 |
| 203 | Ga0157379_10413666 | 3300014968 | Bacteria | 1241 |
| 204 | Ga0157376_10387064 | 3300014969 | Bacteria | 1349 |
| 205 | Ga0157376_10918724 | 3300014969 | Bacteria | 894 |
| 206 | Ga0157376_12927572 | 3300014969 | Bacteria | 517 |
| 207 | Ga0163161_10469657 | 3300017792 | Bacteria | 1020 |
| 208 | Ga0206356_10640862 | 3300020070 | Bacteria | 1226 |
| 209 | Ga0207656_10020950 | 3300025321 | Bacteria | 2605 |
| 210 | Ga0207682_10047333 | 3300025893 | Bacteria | 1770 |
| 211 | Ga0207642_10018896 | 3300025899 | Bacteria | 2656 |
| 212 | Ga0207688_10764732 | 3300025901 | Bacteria | 612 |
| 213 | Ga0207680_10022011 | 3300025903 | Bacteria | 3461 |
| 214 | Ga0207680_10454008 | 3300025903 | Bacteria | 910 |
| 215 | Ga0207647_10116267 | 3300025904 | Bacteria | 1579 |
| 216 | Ga0207645_10338398 | 3300025907 | Bacteria | 1006 |
| 217 | Ga0207645_10503230 | 3300025907 | Bacteria | 820 |
| 218 | Ga0207645_10989280 | 3300025907 | Unclassified | 570 |
| 219 | Ga0207643_10063349 | 3300025908 | Bacteria | 2114 |
| 220 | Ga0207643_10304098 | 3300025908 | Unclassified | 993 |
| 221 | Ga0207643_10510622 | 3300025908 | Bacteria | 769 |
| 222 | Ga0207705_10018450 | 3300025909 | Bacteria | 4989 |
| 223 | Ga0207654_10048136 | 3300025911 | Bacteria | 2439 |
| 224 | Ga0207654_10297623 | 3300025911 | Bacteria | 1096 |
| 225 | Ga0207707_10000582 | 3300025912 | Bacteria | 37091 |
| 226 | Ga0207707_10106258 | 3300025912 | Bacteria | 2454 |
| 227 | Ga0207707_10212866 | 3300025912 | Bacteria | 1683 |
| 228 | Ga0207695_10129333 | 3300025913 | Bacteria | 2484 |
| 229 | Ga0207695_10713543 | 3300025913 | Bacteria | 883 |
| 230 | Ga0207671_10058206 | 3300025914 | Bacteria | 2865 |
| 231 | Ga0207671_10274369 | 3300025914 | Bacteria | 1329 |
| 232 | Ga0207663_10219548 | 3300025916 | Bacteria | 1382 |
| 233 | Ga0207660_10012873 | 3300025917 | Bacteria | 5477 |
| 234 | Ga0207660_10033504 | 3300025917 | Bacteria | 3554 |
| 235 | Ga0207660_10070599 | 3300025917 | Bacteria | 2539 |
| 236 | Ga0207660_10122834 | 3300025917 | Bacteria | 1968 |
| 237 | Ga0207660_10730628 | 3300025917 | Bacteria | 808 |
| 238 | Ga0207662_10027658 | 3300025918 | Bacteria | 3274 |
| 239 | Ga0207657_10000302 | 3300025919 | Bacteria | 52284 |
| 240 | Ga0207657_10902777 | 3300025919 | Unclassified | 681 |
| 241 | Ga0207649_10057670 | 3300025920 | Bacteria | 2429 |
| 242 | Ga0207652_10004959 | 3300025921 | Bacteria | 10782 |
| 243 | Ga0207652_10010922 | 3300025921 | Bacteria | 7320 |
| 244 | Ga0207652_10424002 | 3300025921 | Bacteria | 1200 |
| 245 | Ga0207681_10002070 | 3300025923 | Bacteria | 12847 |
| 246 | Ga0207681_10043653 | 3300025923 | Bacteria | 3002 |
| 247 | Ga0207694_10027148 | 3300025924 | Bacteria | 4360 |
| 248 | Ga0207650_10291983 | 3300025925 | Bacteria | 1330 |
| 249 | Ga0207650_10467897 | 3300025925 | Bacteria | 1051 |
| 250 | Ga0207650_10513320 | 3300025925 | Bacteria | 1002 |
| 251 | Ga0207659_10014621 | 3300025926 | Bacteria | 5067 |
| 252 | Ga0207659_11483765 | 3300025926 | Bacteria | 580 |
| 253 | Ga0207700_11575107 | 3300025928 | Bacteria | 582 |
| 254 | Ga0207664_10272430 | 3300025929 | Bacteria | 1483 |
| 255 | Ga0207664_11522102 | 3300025929 | Bacteria | 591 |
| 256 | Ga0207644_10007077 | 3300025931 | Bacteria | 7312 |
| 257 | Ga0207690_10071890 | 3300025932 | Bacteria | 2387 |
| 258 | Ga0207706_10040247 | 3300025933 | Bacteria | 4142 |
| 259 | Ga0207706_10178192 | 3300025933 | Bacteria | 1867 |
| 260 | Ga0207706_10425564 | 3300025933 | Bacteria | 1150 |
| 261 | Ga0207686_11000011 | 3300025934 | Unclassified | 679 |
| 262 | Ga0207709_10002476 | 3300025935 | Bacteria | 11575 |
| 263 | Ga0207709_10051400 | 3300025935 | Bacteria | 2526 |
| 264 | Ga0207670_10436218 | 3300025936 | Bacteria | 1054 |
| 265 | Ga0207669_10220223 | 3300025937 | Bacteria | 1392 |
| 266 | Ga0207669_11738430 | 3300025937 | Bacteria | 533 |
| 267 | Ga0207704_10021013 | 3300025938 | Bacteria | 3467 |
| 268 | Ga0207691_10030728 | 3300025940 | Bacteria | 5017 |
| 269 | Ga0207691_11501650 | 3300025940 | Bacteria | 551 |
| 270 | Ga0207711_10029358 | 3300025941 | Bacteria | 4638 |
| 271 | Ga0207689_10168247 | 3300025942 | Bacteria | 1806 |
| 272 | Ga0207689_10728454 | 3300025942 | Bacteria | 837 |
| 273 | Ga0207661_10077775 | 3300025944 | Bacteria | 2730 |
| 274 | Ga0207679_10350683 | 3300025945 | Bacteria | 1286 |
| 275 | Ga0207679_10369263 | 3300025945 | Bacteria | 1255 |
| 276 | Ga0207679_10535105 | 3300025945 | Bacteria | 1049 |
| 277 | Ga0207679_11275729 | 3300025945 | Bacteria | 674 |
| 278 | Ga0207667_10001606 | 3300025949 | Bacteria | 28419 |
| 279 | Ga0207667_10107421 | 3300025949 | Bacteria | 2879 |
| 280 | Ga0207667_10328663 | 3300025949 | Bacteria | 1561 |
| 281 | Ga0207651_10050020 | 3300025960 | Bacteria | 2836 |
| 282 | Ga0207651_10110517 | 3300025960 | Bacteria | 2062 |
| 283 | Ga0207651_11069904 | 3300025960 | Bacteria | 722 |
| 284 | Ga0207712_10002513 | 3300025961 | Bacteria | 11800 |
| 285 | Ga0207668_10003072 | 3300025972 | Bacteria | 9786 |
| 286 | Ga0207668_10460664 | 3300025972 | Bacteria | 1087 |
| 287 | Ga0207668_10614727 | 3300025972 | Bacteria | 948 |
| 288 | Ga0207640_10067218 | 3300025981 | Bacteria | 2397 |
| 289 | Ga0207640_10227542 | 3300025981 | Bacteria | 1432 |
| 290 | Ga0207640_10397591 | 3300025981 | Bacteria | 1121 |
| 291 | Ga0207658_10067166 | 3300025986 | Bacteria | 2700 |
| 292 | Ga0207658_10227874 | 3300025986 | Bacteria | 1571 |
| 293 | Ga0207658_11841423 | 3300025986 | Bacteria | 552 |
| 294 | Ga0207677_10328649 | 3300026023 | Bacteria | 1273 |
| 295 | Ga0207677_10491837 | 3300026023 | Bacteria | 1059 |
| 296 | Ga0207677_10621355 | 3300026023 | Bacteria | 950 |
| 297 | Ga0207703_10075600 | 3300026035 | Bacteria | 2792 |
| 298 | Ga0207703_10159169 | 3300026035 | Bacteria | 1976 |
| 299 | Ga0207703_11113226 | 3300026035 | Bacteria | 759 |
| 300 | Ga0207703_11738390 | 3300026035 | Bacteria | 600 |
| 301 | Ga0207639_10012400 | 3300026041 | Bacteria | 5934 |
| 302 | Ga0207639_10132595 | 3300026041 | Bacteria | 2065 |
| 303 | Ga0207678_10004254 | 3300026067 | Bacteria | 12835 |
| 304 | Ga0207678_10011384 | 3300026067 | Bacteria | 7807 |
| 305 | Ga0207678_10604975 | 3300026067 | Bacteria | 961 |
| 306 | Ga0207678_10643860 | 3300026067 | Bacteria | 931 |
| 307 | Ga0207678_10839966 | 3300026067 | Bacteria | 811 |
| 308 | Ga0207708_10006309 | 3300026075 | Bacteria | 8789 |
| 309 | Ga0207702_10007075 | 3300026078 | Bacteria | 9597 |
| 310 | Ga0207702_10516996 | 3300026078 | Bacteria | 1165 |
| 311 | Ga0207702_11250876 | 3300026078 | Unclassified | 736 |
| 312 | Ga0207641_10563807 | 3300026088 | Bacteria | 1112 |
| 313 | Ga0207641_11489800 | 3300026088 | Bacteria | 678 |
| 314 | Ga0207648_10011201 | 3300026089 | Bacteria | 8455 |
| 315 | Ga0207648_10653440 | 3300026089 | Bacteria | 972 |
| 316 | Ga0207676_11475829 | 3300026095 | Bacteria | 677 |
| 317 | Ga0207674_10000251 | 3300026116 | Bacteria | 66996 |
| 318 | Ga0207674_10314059 | 3300026116 | Bacteria | 1516 |
| 319 | Ga0207674_10599495 | 3300026116 | Bacteria | 1064 |
| 320 | Ga0207675_100010339 | 3300026118 | Bacteria | 8745 |
| 321 | Ga0207675_100469195 | 3300026118 | Bacteria | 1249 |
| 322 | Ga0207675_101349580 | 3300026118 | Bacteria | 734 |
| 323 | Ga0207683_10434885 | 3300026121 | Bacteria | 1209 |
| 324 | Ga0207683_10656541 | 3300026121 | Bacteria | 972 |
| 325 | Ga0207698_10068386 | 3300026142 | Bacteria | 2804 |
| 326 | Ga0207698_10195119 | 3300026142 | Bacteria | 1808 |
| 327 | Ga0207698_10209742 | 3300026142 | Bacteria | 1752 |
| 328 | Ga0209971_1039403 | 3300027682 | Bacteria | 1138 |
| 329 | Ga0209966_1010430 | 3300027695 | Bacteria | 1675 |
| 330 | Ga0209998_10085910 | 3300027717 | Bacteria | 767 |
| 331 | Ga0268266_10052746 | 3300028379 | Bacteria | 3493 |
| 332 | Ga0268266_10481806 | 3300028379 | Bacteria | 1183 |
| 333 | Ga0268266_10507812 | 3300028379 | Bacteria | 1152 |
| 334 | Ga0268265_10000291 | 3300028380 | Bacteria | 56604 |
| 335 | Ga0268265_10522708 | 3300028380 | Bacteria | 1122 |
| 336 | Ga0268265_10689427 | 3300028380 | Bacteria | 986 |
| 337 | Ga0268264_10005401 | 3300028381 | Bacteria | 10823 |
| 338 | Ga0268264_10388337 | 3300028381 | Bacteria | 1338 |
| 339 | Ga0268264_10529826 | 3300028381 | Bacteria | 1153 |
| 340 | Ga0307408_101212266 | 3300031548 | Bacteria | 704 |
| 341 | Ga0307405_11879462 | 3300031731 | Bacteria | 534 |
| 342 | Ga0307407_10560613 | 3300031903 | Bacteria | 846 |
| 343 | Ga0307409_101561740 | 3300031995 | Bacteria | 688 |
| 344 | Ga0307416_100012292 | 3300032002 | Bacteria | 5760 |
| 345 | Ga0307416_100844311 | 3300032002 | Bacteria | 1014 |
| 346 | Ga0307416_102718420 | 3300032002 | Bacteria | 591 |
| 347 | Ga0307416_103179502 | 3300032002 | Bacteria | 549 |
| 348 | Ga0307411_10763327 | 3300032005 | Bacteria | 848 |
| 349 | Ga0307415_100023641 | 3300032126 | Bacteria | 3820 |
| 350 | Ga0373930_0008971 | 3300034816 | Bacteria | 1760 |
| 351 | Ga0373948_0023623 | 3300034817 | Bacteria | 1194 |
| 352 | Ga0373928_0005437 | 3300035084 | Bacteria | 2436 |
| 353 | Ga0373929_0004743 | 3300035085 | Bacteria | 2437 |
| 354 | Ga0373934_0249697 | 3300035086 | Bacteria | 733 |
| 355 | Ga0373940_0004866 | 3300035088 | Bacteria | 2867 |
| 356 | Ga0373949_0008294 | 3300035090 | Bacteria | 2275 |
| 357 | Ga0373951_0032877 | 3300035091 | Bacteria | 1228 |
| 358 | Ga0373932_0001687 | 3300035112 | Bacteria | 6016 |
| 359 | Ga0373939_0000922 | 3300035114 | Bacteria | 7298 |
| 360 | Ga0373941_0000933 | 3300035115 | Bacteria | 6034 |
| 361 | Ga0373953_0043175 | 3300035117 | Bacteria | 1799 |
| 362 | Ga0373954_0027058 | 3300035118 | Bacteria | 2630 |
| 363 | Ga0373956_0114304 | 3300035119 | Bacteria | 1258 |
| 364 | Ga0373955_0180276 | 3300035172 | Bacteria | 1253 |
| 365 | Ga0373962_0003112 | 3300035242 | Bacteria | 3974 |
| 366 | Ga0373931_0000344 | 3300035691 | Bacteria | 19127 |
| 367 | Ga0373933_0068256 | 3300035724 | Bacteria | 2159 |
| 368 | Ga0373937_0009190 | 3300036401 | Bacteria | 8580 |
| 369 | Ga0373925_0192333 | 3300037068 | Bacteria | 1619 |
| 370 | Ga0395899_0102890 | 3300037312 | Bacteria | 2060 |
| 371 | Ga0395900_0008836 | 3300037418 | Bacteria | 10348 |
| 372 | Ga0395900_0148643 | 3300037418 | Bacteria | 2395 |
| 373 | Ga0395900_0384718 | 3300037418 | Bacteria | 1370 |
| 374 | Ga0395898_0020070 | 3300037466 | Bacteria | 6791 |
| 375 | Ga0395898_0412455 | 3300037466 | Bacteria | 1287 |
| 376 | Ga0395905_0399306 | 3300037471 | Bacteria | 1270 |
| 377 | Ga0395901_0013535 | 3300038443 | Bacteria | 8296 |
| 378 | Ga0451800_0017687 | 3300041459 | Bacteria | 610 |
| 379 | Ga0451833_0590600 | 3300041491 | Bacteria | 658 |
| 380 | Ga0451853_0476034 | 3300041512 | Bacteria | 556 |
| 381 | Ga0451853_2948516 | 3300041512 | Bacteria | 591 |
| 382 | Ga0439449_0057240 | 3300042007 | Bacteria | 1439 |
| 383 | Ga0450921_005103 | 3300042123 | Bacteria | 983 |
| 384 | Ga0451577_0198323 | 3300042876 | Bacteria | 1812 |
| 385 | Ga0466963_0147916 | 3300044694 | Bacteria | 1631 |
| 386 | Ga0466964_0523096 | 3300044706 | Bacteria | 640 |
| 387 | Ga0466957_0521857 | 3300044842 | Bacteria | 825 |
| 388 | Ga0451576_0027587 | 3300045051 | Bacteria | 6096 |
| 389 | Ga0466958_0370109 | 3300045836 | Bacteria | 923 |
| 390 | Ga0495592_0020432 | 3300046454 | Bacteria | 5036 |
| 391 | Ga0495651_0006031 | 3300046462 | Bacteria | 9252 |
| 392 | Ga0495653_0176848 | 3300046463 | Bacteria | 1468 |
| 393 | Ga0495608_0119649 | 3300046511 | Bacteria | 1689 |
| 394 | Ga0495628_0079641 | 3300046516 | Bacteria | 2547 |
| 395 | Ga0495652_0008742 | 3300046529 | Bacteria | 9219 |
| 396 | Ga0495640_0277998 | 3300046533 | Bacteria | 1043 |
| 397 | Ga0495587_0002777 | 3300046536 | Bacteria | 11689 |
| 398 | Ga0495667_0029932 | 3300046559 | Bacteria | 3662 |
| 399 | Ga0495635_1059976 | 3300046663 | Bacteria | 514 |
| 400 | Ga0495657_0035784 | 3300046675 | Bacteria | 3438 |
| 401 | Ga0495599_0005909 | 3300046678 | Bacteria | 7356 |
| 402 | Ga0495623_0007781 | 3300046679 | Bacteria | 6966 |
| 403 | Ga0495646_0148824 | 3300046680 | Bacteria | 1304 |
| 404 | Ga0495604_0008315 | 3300047317 | Bacteria | 8206 |
| 405 | Ga0495680_0093764 | 3300047322 | Bacteria | 2247 |
| 406 | Ga0495675_0015410 | 3300047444 | Bacteria | 4835 |
| 407 | Ga0495602_0034886 | 3300048088 | Bacteria | 4697 |
| 408 | Ga0496100_0169290 | 3300048903 | Bacteria | 1572 |
| 409 | Ga0496100_0952945 | 3300048903 | Bacteria | 675 |
| 410 | Ga0496102_0112568 | 3300048905 | Bacteria | 2539 |
| 411 | Ga0496102_0501069 | 3300048905 | Bacteria | 1136 |
| 412 | Ga0496102_0520546 | 3300048905 | Bacteria | 1112 |
| 413 | Ga0496102_1750836 | 3300048905 | Bacteria | 539 |
| 414 | Ga0496103_0003025 | 3300048906 | Bacteria | 10357 |
| 415 | Ga0496103_0540004 | 3300048906 | Bacteria | 745 |
| 416 | Ga0496104_0735200 | 3300048907 | Unclassified | 894 |
| 417 | Ga0496106_0015222 | 3300048909 | Bacteria | 5692 |
| 418 | Ga0496106_0090086 | 3300048909 | Bacteria | 2367 |
| 419 | Ga0496106_0431642 | 3300048909 | Bacteria | 1059 |
| 420 | Ga0496106_1389997 | 3300048909 | Bacteria | 543 |
| 421 | Ga0496107_0021433 | 3300048910 | Bacteria | 4567 |
| 422 | Ga0496108_0135605 | 3300048911 | Bacteria | 2118 |
| 423 | Ga0496108_0589047 | 3300048911 | Bacteria | 969 |
| 424 | Ga0496108_1545724 | 3300048911 | Bacteria | 551 |
| 425 | Ga0496109_0746266 | 3300048912 | Bacteria | 917 |
| 426 | Ga0496109_0947074 | 3300048912 | Bacteria | 799 |
| 427 | Ga0496111_0547043 | 3300048914 | Bacteria | 850 |
| 428 | Ga0496112_0884234 | 3300048915 | Bacteria | 816 |
| 429 | Ga0496112_0943992 | 3300048915 | Bacteria | 784 |
| 430 | Ga0496114_0248261 | 3300048917 | Bacteria | 1566 |
| 431 | Ga0496115_0039507 | 3300048918 | Bacteria | 3748 |
| 432 | Ga0501036_0201429 | 3300049572 | Bacteria | 1674 |
| 433 | Ga0501036_1014269 | 3300049572 | Bacteria | 679 |
| 434 | Ga0501040_0068260 | 3300049576 | Bacteria | 2452 |
| 435 | Ga0501043_0389105 | 3300049579 | Bacteria | 1055 |
| 436 | Ga0501047_0025007 | 3300049581 | Bacteria | 5736 |
| 437 | Ga0501047_0859495 | 3300049581 | Bacteria | 721 |
| 438 | Ga0501048_0308681 | 3300049582 | Bacteria | 1126 |
| 439 | Ga0501071_0525392 | 3300049587 | Bacteria | 908 |
| 440 | Ga0501072_0243866 | 3300049588 | Bacteria | 1431 |
| 441 | Ga0501074_0654559 | 3300049590 | Bacteria | 742 |
| 442 | Ga0501075_0013470 | 3300049591 | Bacteria | 5836 |
| 443 | Ga0501076_0021916 | 3300049592 | Bacteria | 4906 |
| 444 | Ga0501236_112788 | 3300049670 | Bacteria | 545 |
| 445 | Ga0501081_0134753 | 3300049743 | Bacteria | 1767 |
| 446 | Ga0501083_0729326 | 3300049744 | Bacteria | 645 |
| 447 | Ga0501283_053057 | 3300049779 | Bacteria | 721 |
| 448 | Ga0501044_0168518 | 3300049823 | Bacteria | 2163 |
| 449 | Ga0501045_0032604 | 3300049824 | Bacteria | 3776 |
| 450 | nmdc:mga03n38_806249_c1 | 3300050490 | Bacteria | 547 |
| 451 | nmdc:mga00v17_818084_c1 | 3300050491 | Bacteria | 593 |
| 452 | nmdc:mga0yw44_301242_c1 | 3300050492 | Bacteria | 1074 |
| 453 | nmdc:mga0k408_42546_c1 | 3300050493 | Bacteria | 2616 |
| 454 | nmdc:mga06z11_146038_c1 | 3300050494 | Bacteria | 1341 |
| 455 | nmdc:mga06z11_70385_c1 | 3300050494 | Bacteria | 1849 |
| 456 | nmdc:mga07m45_554088_c1 | 3300050496 | Bacteria | 665 |
| 457 | nmdc:mga05p37_1219095_c1 | 3300050507 | Bacteria | 775 |
| 458 | nmdc:mga0qj67_151587_c1 | 3300050509 | Bacteria | 1881 |
| 459 | nmdc:mga0qj67_49109_c1 | 3300050509 | Bacteria | 3335 |
| 460 | nmdc:mga06r32_326437_c1 | 3300050510 | Bacteria | 1520 |
| 461 | nmdc:mga08y16_1470445_c1 | 3300050511 | Bacteria | 643 |
| 462 | nmdc:mga08y16_301535_c1 | 3300050511 | Bacteria | 1651 |
| 463 | nmdc:mga0n895_2102802_c1 | 3300050512 | Bacteria | 521 |
| 464 | nmdc:mga0sz30_143305_c1 | 3300050516 | Bacteria | 1055 |
| 465 | Ga0495601_0084264 | 3300053077 | Bacteria | 2042 |
| 466 | Ga0495619_0089480 | 3300053085 | Bacteria | 2083 |
| 467 | Ga0501082_0502572 | 3300060353 | Bacteria | 1060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_101358624 | Ga0070662_1013586241 | 97 |
| 2 | 3300005719 | Ga0068861_100299708 | Ga0068861_1002997082 | 97 |
| 3 | 3300025901 | Ga0207688_10764732 | Ga0207688_107647321 | 97 |
| 4 | 3300025933 | Ga0207706_10040247 | Ga0207706_100402472 | 97 |
| 5 | 3300026118 | Ga0207675_100469195 | Ga0207675_1004691952 | 97 |
| 6 | 3300046463 | Ga0495653_0176848 | Ga0495653_0176848_1142_1435 | 97 |
| 7 | 3300027682 | Ga0209971_1039403 | Ga0209971_10394032 | 103 |
| 8 | 3300027695 | Ga0209966_1010430 | Ga0209966_10104302 | 103 |
| 9 | 3300049572 | Ga0501036_1014269 | Ga0501036_1014269_303_647 | 103 |
| 10 | 3300026041 | Ga0207639_10132595 | Ga0207639_101325952 | 104 |
| 11 | 3300037418 | Ga0395900_0384718 | Ga0395900_0384718_655_999 | 104 |
| 12 | 3300037466 | Ga0395898_0020070 | Ga0395898_0020070_548_892 | 104 |
| 13 | 3300038443 | Ga0395901_0013535 | Ga0395901_0013535_1107_1451 | 104 |
| 14 | 3300005295 | Ga0065707_10147027 | Ga0065707_101470272 | 105 |
| 15 | 3300005328 | Ga0070676_10085636 | Ga0070676_100856362 | 105 |
| 16 | 3300005328 | Ga0070676_10568101 | Ga0070676_105681012 | 105 |
| 17 | 3300005330 | Ga0070690_100010474 | Ga0070690_1000104748 | 105 |
| 18 | 3300005334 | Ga0068869_100660960 | Ga0068869_1006609602 | 105 |
| 19 | 3300005335 | Ga0070666_10025010 | Ga0070666_100250103 | 105 |
| 20 | 3300005336 | Ga0070680_100014420 | Ga0070680_1000144207 | 105 |
| 21 | 3300005336 | Ga0070680_100150011 | Ga0070680_1001500112 | 105 |
| 22 | 3300005337 | Ga0070682_100067246 | Ga0070682_1000672462 | 105 |
| 23 | 3300005338 | Ga0068868_100530189 | Ga0068868_1005301892 | 105 |
| 24 | 3300005338 | Ga0068868_101830663 | Ga0068868_1018306631 | 105 |
| 25 | 3300005340 | Ga0070689_100284651 | Ga0070689_1002846512 | 105 |
| 26 | 3300005343 | Ga0070687_100016154 | Ga0070687_1000161542 | 105 |
| 27 | 3300005343 | Ga0070687_100204002 | Ga0070687_1002040022 | 105 |
| 28 | 3300005345 | Ga0070692_10007879 | Ga0070692_100078792 | 105 |
| 29 | 3300005345 | Ga0070692_10187435 | Ga0070692_101874352 | 105 |
| 30 | 3300005345 | Ga0070692_11031448 | Ga0070692_110314482 | 105 |
| 31 | 3300005347 | Ga0070668_100119736 | Ga0070668_1001197362 | 105 |
| 32 | 3300005353 | Ga0070669_100007367 | Ga0070669_1000073672 | 105 |
| 33 | 3300005353 | Ga0070669_100021059 | Ga0070669_1000210599 | 105 |
| 34 | 3300005354 | Ga0070675_100010896 | Ga0070675_1000108969 | 105 |
| 35 | 3300005355 | Ga0070671_100215278 | Ga0070671_1002152782 | 105 |
| 36 | 3300005356 | Ga0070674_100835352 | Ga0070674_1008353522 | 105 |
| 37 | 3300005356 | Ga0070674_102134359 | Ga0070674_1021343591 | 105 |
| 38 | 3300005364 | Ga0070673_100050649 | Ga0070673_1000506492 | 105 |
| 39 | 3300005365 | Ga0070688_100024071 | Ga0070688_1000240712 | 105 |
| 40 | 3300005367 | Ga0070667_101025107 | Ga0070667_1010251072 | 105 |
| 41 | 3300005406 | Ga0070703_10178768 | Ga0070703_101787682 | 105 |
| 42 | 3300005441 | Ga0070700_100001753 | Ga0070700_10000175312 | 105 |
| 43 | 3300005441 | Ga0070700_100588129 | Ga0070700_1005881292 | 105 |
| 44 | 3300005444 | Ga0070694_101028356 | Ga0070694_1010283562 | 105 |
| 45 | 3300005455 | Ga0070663_100056190 | Ga0070663_1000561902 | 105 |
| 46 | 3300005456 | Ga0070678_100227662 | Ga0070678_1002276622 | 105 |
| 47 | 3300005456 | Ga0070678_100868910 | Ga0070678_1008689102 | 105 |
| 48 | 3300005458 | Ga0070681_10006828 | Ga0070681_100068287 | 105 |
| 49 | 3300005459 | Ga0068867_100001755 | Ga0068867_1000017559 | 105 |
| 50 | 3300005459 | Ga0068867_100808459 | Ga0068867_1008084592 | 105 |
| 51 | 3300005466 | Ga0070685_10334377 | Ga0070685_103343772 | 105 |
| 52 | 3300005530 | Ga0070679_100028734 | Ga0070679_1000287342 | 105 |
| 53 | 3300005543 | Ga0070672_100018691 | Ga0070672_1000186912 | 105 |
| 54 | 3300005544 | Ga0070686_100596766 | Ga0070686_1005967662 | 105 |
| 55 | 3300005544 | Ga0070686_101378760 | Ga0070686_1013787601 | 105 |
| 56 | 3300005545 | Ga0070695_100583481 | Ga0070695_1005834811 | 105 |
| 57 | 3300005548 | Ga0070665_100063019 | Ga0070665_1000630192 | 105 |
| 58 | 3300005549 | Ga0070704_100642975 | Ga0070704_1006429752 | 105 |
| 59 | 3300005563 | Ga0068855_100074798 | Ga0068855_1000747982 | 105 |
| 60 | 3300005563 | Ga0068855_100444615 | Ga0068855_1004446152 | 105 |
| 61 | 3300005616 | Ga0068852_100375379 | Ga0068852_1003753791 | 105 |
| 62 | 3300005617 | Ga0068859_100351101 | Ga0068859_1003511012 | 105 |
| 63 | 3300005617 | Ga0068859_102804066 | Ga0068859_1028040661 | 105 |
| 64 | 3300005618 | Ga0068864_101074540 | Ga0068864_1010745402 | 105 |
| 65 | 3300005718 | Ga0068866_10152414 | Ga0068866_101524142 | 105 |
| 66 | 3300005719 | Ga0068861_100001610 | Ga0068861_1000016108 | 105 |
| 67 | 3300005719 | Ga0068861_100014724 | Ga0068861_1000147243 | 105 |
| 68 | 3300005719 | Ga0068861_100536626 | Ga0068861_1005366262 | 105 |
| 69 | 3300005834 | Ga0068851_10216247 | Ga0068851_102162472 | 105 |
| 70 | 3300005840 | Ga0068870_10012679 | Ga0068870_100126794 | 105 |
| 71 | 3300005840 | Ga0068870_10284481 | Ga0068870_102844812 | 105 |
| 72 | 3300005841 | Ga0068863_100485776 | Ga0068863_1004857762 | 105 |
| 73 | 3300005843 | Ga0068860_100060858 | Ga0068860_1000608585 | 105 |
| 74 | 3300005843 | Ga0068860_100281638 | Ga0068860_1002816382 | 105 |
| 75 | 3300005844 | Ga0068862_100005068 | Ga0068862_10000506813 | 105 |
| 76 | 3300005844 | Ga0068862_100487484 | Ga0068862_1004874842 | 105 |
| 77 | 3300005844 | Ga0068862_100974044 | Ga0068862_1009740441 | 105 |
| 78 | 3300005844 | Ga0068862_102458499 | Ga0068862_1024584992 | 105 |
| 79 | 3300006038 | Ga0075365_10022211 | Ga0075365_100222112 | 105 |
| 80 | 3300006051 | Ga0075364_10815369 | Ga0075364_108153692 | 105 |
| 81 | 3300006178 | Ga0075367_10008005 | Ga0075367_100080052 | 105 |
| 82 | 3300006195 | Ga0075366_10351781 | Ga0075366_103517812 | 105 |
| 83 | 3300006237 | Ga0097621_100423485 | Ga0097621_1004234852 | 105 |
| 84 | 3300006353 | Ga0075370_10260130 | Ga0075370_102601302 | 105 |
| 85 | 3300006358 | Ga0068871_102419998 | Ga0068871_1024199981 | 105 |
| 86 | 3300006844 | Ga0075428_101436415 | Ga0075428_1014364151 | 105 |
| 87 | 3300006847 | Ga0075431_100811435 | Ga0075431_1008114352 | 105 |
| 88 | 3300006880 | Ga0075429_100126670 | Ga0075429_1001266702 | 105 |
| 89 | 3300006881 | Ga0068865_100004826 | Ga0068865_10000482610 | 105 |
| 90 | 3300006881 | Ga0068865_102048635 | Ga0068865_1020486352 | 105 |
| 91 | 3300006931 | Ga0097620_100351121 | Ga0097620_1003511212 | 105 |
| 92 | 3300006931 | Ga0097620_102804085 | Ga0097620_1028040851 | 105 |
| 93 | 3300009093 | Ga0105240_10154816 | Ga0105240_101548162 | 105 |
| 94 | 3300009094 | Ga0111539_10435108 | Ga0111539_104351082 | 105 |
| 95 | 3300009098 | Ga0105245_10284401 | Ga0105245_102844012 | 105 |
| 96 | 3300009148 | Ga0105243_10003862 | Ga0105243_1000386213 | 105 |
| 97 | 3300009174 | Ga0105241_11631367 | Ga0105241_116313672 | 105 |
| 98 | 3300009176 | Ga0105242_12476425 | Ga0105242_124764251 | 105 |
| 99 | 3300009177 | Ga0105248_10002755 | Ga0105248_1000275519 | 105 |
| 100 | 3300009553 | Ga0105249_10008393 | Ga0105249_100083932 | 105 |
| 101 | 3300009553 | Ga0105249_10918461 | Ga0105249_109184612 | 105 |
| 102 | 3300013296 | Ga0157374_10872402 | Ga0157374_108724022 | 105 |
| 103 | 3300013297 | Ga0157378_11553815 | Ga0157378_115538152 | 105 |
| 104 | 3300013307 | Ga0157372_11805883 | Ga0157372_118058831 | 105 |
| 105 | 3300013308 | Ga0157375_10336122 | Ga0157375_103361222 | 105 |
| 106 | 3300013308 | Ga0157375_11049202 | Ga0157375_110492022 | 105 |
| 107 | 3300014326 | Ga0157380_10004661 | Ga0157380_100046613 | 105 |
| 108 | 3300014326 | Ga0157380_10059377 | Ga0157380_100593771 | 105 |
| 109 | 3300014326 | Ga0157380_11415837 | Ga0157380_114158372 | 105 |
| 110 | 3300014745 | Ga0157377_10113500 | Ga0157377_101135001 | 105 |
| 111 | 3300014968 | Ga0157379_10143491 | Ga0157379_101434912 | 105 |
| 112 | 3300014969 | Ga0157376_10387064 | Ga0157376_103870642 | 105 |
| 113 | 3300017792 | Ga0163161_10469657 | Ga0163161_104696572 | 105 |
| 114 | 3300025893 | Ga0207682_10047333 | Ga0207682_100473332 | 105 |
| 115 | 3300025899 | Ga0207642_10018896 | Ga0207642_100188962 | 105 |
| 116 | 3300025903 | Ga0207680_10022011 | Ga0207680_100220111 | 105 |
| 117 | 3300025903 | Ga0207680_10454008 | Ga0207680_104540082 | 105 |
| 118 | 3300025907 | Ga0207645_10338398 | Ga0207645_103383982 | 105 |
| 119 | 3300025907 | Ga0207645_10503230 | Ga0207645_105032301 | 105 |
| 120 | 3300025908 | Ga0207643_10063349 | Ga0207643_100633492 | 105 |
| 121 | 3300025911 | Ga0207654_10297623 | Ga0207654_102976232 | 105 |
| 122 | 3300025912 | Ga0207707_10000582 | Ga0207707_1000058219 | 105 |
| 123 | 3300025913 | Ga0207695_10713543 | Ga0207695_107135432 | 105 |
| 124 | 3300025917 | Ga0207660_10012873 | Ga0207660_100128732 | 105 |
| 125 | 3300025917 | Ga0207660_10033504 | Ga0207660_100335042 | 105 |
| 126 | 3300025917 | Ga0207660_10730628 | Ga0207660_107306281 | 105 |
| 127 | 3300025918 | Ga0207662_10027658 | Ga0207662_100276582 | 105 |
| 128 | 3300025921 | Ga0207652_10004959 | Ga0207652_1000495911 | 105 |
| 129 | 3300025923 | Ga0207681_10002070 | Ga0207681_100020707 | 105 |
| 130 | 3300025923 | Ga0207681_10043653 | Ga0207681_100436532 | 105 |
| 131 | 3300025925 | Ga0207650_10513320 | Ga0207650_105133202 | 105 |
| 132 | 3300025926 | Ga0207659_10014621 | Ga0207659_100146212 | 105 |
| 133 | 3300025931 | Ga0207644_10007077 | Ga0207644_100070778 | 105 |
| 134 | 3300025935 | Ga0207709_10002476 | Ga0207709_100024763 | 105 |
| 135 | 3300025936 | Ga0207670_10436218 | Ga0207670_104362182 | 105 |
| 136 | 3300025937 | Ga0207669_10220223 | Ga0207669_102202232 | 105 |
| 137 | 3300025937 | Ga0207669_11738430 | Ga0207669_117384301 | 105 |
| 138 | 3300025938 | Ga0207704_10021013 | Ga0207704_100210133 | 105 |
| 139 | 3300025940 | Ga0207691_10030728 | Ga0207691_100307282 | 105 |
| 140 | 3300025940 | Ga0207691_11501650 | Ga0207691_115016501 | 105 |
| 141 | 3300025941 | Ga0207711_10029358 | Ga0207711_100293582 | 105 |
| 142 | 3300025942 | Ga0207689_10168247 | Ga0207689_101682472 | 105 |
| 143 | 3300025942 | Ga0207689_10728454 | Ga0207689_107284542 | 105 |
| 144 | 3300025949 | Ga0207667_10328663 | Ga0207667_103286632 | 105 |
| 145 | 3300025960 | Ga0207651_10050020 | Ga0207651_100500202 | 105 |
| 146 | 3300025960 | Ga0207651_10110517 | Ga0207651_101105172 | 105 |
| 147 | 3300025961 | Ga0207712_10002513 | Ga0207712_1000251315 | 105 |
| 148 | 3300025972 | Ga0207668_10003072 | Ga0207668_1000307213 | 105 |
| 149 | 3300025972 | Ga0207668_10460664 | Ga0207668_104606642 | 105 |
| 150 | 3300025981 | Ga0207640_10067218 | Ga0207640_100672182 | 105 |
| 151 | 3300025981 | Ga0207640_10397591 | Ga0207640_103975911 | 105 |
| 152 | 3300025986 | Ga0207658_10067166 | Ga0207658_100671663 | 105 |
| 153 | 3300026023 | Ga0207677_10328649 | Ga0207677_103286491 | 105 |
| 154 | 3300026023 | Ga0207677_10491837 | Ga0207677_104918372 | 105 |
| 155 | 3300026023 | Ga0207677_10621355 | Ga0207677_106213552 | 105 |
| 156 | 3300026035 | Ga0207703_10159169 | Ga0207703_101591692 | 105 |
| 157 | 3300026067 | Ga0207678_10604975 | Ga0207678_106049752 | 105 |
| 158 | 3300026075 | Ga0207708_10006309 | Ga0207708_1000630911 | 105 |
| 159 | 3300026088 | Ga0207641_10563807 | Ga0207641_105638072 | 105 |
| 160 | 3300026088 | Ga0207641_11489800 | Ga0207641_114898001 | 105 |
| 161 | 3300026089 | Ga0207648_10011201 | Ga0207648_1001120111 | 105 |
| 162 | 3300026089 | Ga0207648_10653440 | Ga0207648_106534402 | 105 |
| 163 | 3300026095 | Ga0207676_11475829 | Ga0207676_114758291 | 105 |
| 164 | 3300026116 | Ga0207674_10599495 | Ga0207674_105994952 | 105 |
| 165 | 3300026118 | Ga0207675_100010339 | Ga0207675_10001033911 | 105 |
| 166 | 3300026118 | Ga0207675_101349580 | Ga0207675_1013495802 | 105 |
| 167 | 3300026121 | Ga0207683_10434885 | Ga0207683_104348852 | 105 |
| 168 | 3300026142 | Ga0207698_10195119 | Ga0207698_101951192 | 105 |
| 169 | 3300027717 | Ga0209998_10085910 | Ga0209998_100859101 | 105 |
| 170 | 3300028379 | Ga0268266_10052746 | Ga0268266_100527462 | 105 |
| 171 | 3300028379 | Ga0268266_10481806 | Ga0268266_104818062 | 105 |
| 172 | 3300028380 | Ga0268265_10000291 | Ga0268265_1000029156 | 105 |
| 173 | 3300028380 | Ga0268265_10522708 | Ga0268265_105227082 | 105 |
| 174 | 3300028380 | Ga0268265_10689427 | Ga0268265_106894272 | 105 |
| 175 | 3300028381 | Ga0268264_10005401 | Ga0268264_100054014 | 105 |
| 176 | 3300028381 | Ga0268264_10529826 | Ga0268264_105298262 | 105 |
| 177 | 3300031548 | Ga0307408_101212266 | Ga0307408_1012122662 | 105 |
| 178 | 3300031731 | Ga0307405_11879462 | Ga0307405_118794622 | 105 |
| 179 | 3300031995 | Ga0307409_101561740 | Ga0307409_1015617402 | 105 |
| 180 | 3300032002 | Ga0307416_100012292 | Ga0307416_1000122926 | 105 |
| 181 | 3300032002 | Ga0307416_100844311 | Ga0307416_1008443112 | 105 |
| 182 | 3300032002 | Ga0307416_102718420 | Ga0307416_1027184202 | 105 |
| 183 | 3300032002 | Ga0307416_103179502 | Ga0307416_1031795022 | 105 |
| 184 | 3300032005 | Ga0307411_10763327 | Ga0307411_107633272 | 105 |
| 185 | 3300032126 | Ga0307415_100023641 | Ga0307415_1000236413 | 105 |
| 186 | 3300034816 | Ga0373930_0008971 | Ga0373930_0008971_729_1073 | 105 |
| 187 | 3300034817 | Ga0373948_0023623 | Ga0373948_0023623_784_1128 | 105 |
| 188 | 3300035084 | Ga0373928_0005437 | Ga0373928_0005437_149_493 | 105 |
| 189 | 3300035085 | Ga0373929_0004743 | Ga0373929_0004743_1310_1654 | 105 |
| 190 | 3300035088 | Ga0373940_0004866 | Ga0373940_0004866_2286_2630 | 105 |
| 191 | 3300035090 | Ga0373949_0008294 | Ga0373949_0008294_439_783 | 105 |
| 192 | 3300035091 | Ga0373951_0032877 | Ga0373951_0032877_638_982 | 105 |
| 193 | 3300035112 | Ga0373932_0001687 | Ga0373932_0001687_678_1022 | 105 |
| 194 | 3300035114 | Ga0373939_0000922 | Ga0373939_0000922_1647_1991 | 105 |
| 195 | 3300035115 | Ga0373941_0000933 | Ga0373941_0000933_2263_2607 | 105 |
| 196 | 3300035242 | Ga0373962_0003112 | Ga0373962_0003112_1366_1710 | 105 |
| 197 | 3300035691 | Ga0373931_0000344 | Ga0373931_0000344_6932_7276 | 105 |
| 198 | 3300037068 | Ga0373925_0192333 | Ga0373925_0192333_426_770 | 105 |
| 199 | 3300042123 | Ga0450921_005103 | Ga0450921_005103_529_873 | 105 |
| 200 | 3300045051 | Ga0451576_0027587 | Ga0451576_0027587_5032_5376 | 105 |
| 201 | 3300045836 | Ga0466958_0370109 | Ga0466958_0370109_535_882 | 105 |
| 202 | 3300048903 | Ga0496100_0952945 | Ga0496100_0952945_13_357 | 105 |
| 203 | 3300048905 | Ga0496102_0112568 | Ga0496102_0112568_858_1202 | 105 |
| 204 | 3300048905 | Ga0496102_0520546 | Ga0496102_0520546_530_877 | 105 |
| 205 | 3300048906 | Ga0496103_0540004 | Ga0496103_0540004_117_464 | 105 |
| 206 | 3300048909 | Ga0496106_0090086 | Ga0496106_0090086_1995_2342 | 105 |
| 207 | 3300048911 | Ga0496108_0589047 | Ga0496108_0589047_314_661 | 105 |
| 208 | 3300048912 | Ga0496109_0746266 | Ga0496109_0746266_441_788 | 105 |
| 209 | 3300048914 | Ga0496111_0547043 | Ga0496111_0547043_221_568 | 105 |
| 210 | 3300049587 | Ga0501071_0525392 | Ga0501071_0525392_125_472 | 105 |
| 211 | 3300049779 | Ga0501283_053057 | Ga0501283_053057_34_378 | 105 |
| 212 | 3300050492 | nmdc:mga0yw44_301242_c1 | nmdc:mga0yw44_301242_c1_289_633 | 105 |
| 213 | 3300050494 | nmdc:mga06z11_70385_c1 | nmdc:mga06z11_70385_c1_1461_1805 | 105 |
| 214 | 3300050507 | nmdc:mga05p37_1219095_c1 | nmdc:mga05p37_1219095_c1_271_615 | 105 |
| 215 | 3300050509 | nmdc:mga0qj67_151587_c1 | nmdc:mga0qj67_151587_c1_298_642 | 105 |
| 216 | 3300050510 | nmdc:mga06r32_326437_c1 | nmdc:mga06r32_326437_c1_485_829 | 105 |
| 217 | 3300050511 | nmdc:mga08y16_1470445_c1 | nmdc:mga08y16_1470445_c1_38_382 | 105 |
| 218 | 3300049670 | Ga0501236_112788 | Ga0501236_112788_58_402 | 106 |
| 219 | 3300005364 | Ga0070673_101226158 | Ga0070673_1012261581 | 108 |
| 220 | 3300005367 | Ga0070667_100130344 | Ga0070667_1001303442 | 108 |
| 221 | 3300005842 | Ga0068858_101869927 | Ga0068858_1018699272 | 108 |
| 222 | 3300025960 | Ga0207651_11069904 | Ga0207651_110699042 | 108 |
| 223 | 3300025986 | Ga0207658_10227874 | Ga0207658_102278742 | 108 |
| 224 | 3300026035 | Ga0207703_11738390 | Ga0207703_117383901 | 108 |
| 225 | 3300031903 | Ga0307407_10560613 | Ga0307407_105606132 | 108 |
| 226 | iso_pu_bacteria | 2738541281 | 2738745994 | 108 |
| 227 | iso_pu_bacteria | 2738543032 | 2739355224 | 108 |
| 228 | iso_pu_bacteria | 2643221614 | 2644085821 | 109 |
| 229 | iso_pu_bacteria | 2643221661 | 2644345003 | 109 |
| 230 | iso_pu_bacteria | 2643221666 | 2644369277 | 109 |
| 231 | iso_pu_bacteria | 2844002411 | 2844004671 | 109 |
| 232 | iso_pu_bacteria | 2856334872 | 2856336014 | 109 |
| 233 | iso_pu_bacteria | 2857367948 | 2857369078 | 109 |
| 234 | iso_pu_bacteria | 2878781027 | 2878782261 | 109 |
| 235 | iso_pu_bacteria | 2922151315 | 2922152015 | 109 |
| 236 | iso_pu_bacteria | 2958122699 | 2958129316 | 109 |
| 237 | iso_pu_bacteria | 2965032056 | 2965038820 | 109 |
| 238 | iso_pu_bacteria | 2965110997 | 2965112047 | 109 |
| 239 | iso_pu_bacteria | 2977872689 | 2977878477 | 109 |
| 240 | iso_pu_bacteria | 2977957713 | 2977959125 | 109 |
| 241 | iso_pu_bacteria | 2987673487 | 2987675752 | 109 |
| 242 | iso_pu_bacteria | 3004239961 | 3004244547 | 109 |
| 243 | iso_pu_bacteria | 8004695233 | 8004695776 | 109 |
| 244 | iso_pu_bacteria | 2516143018 | 2516205324 | 110 |
| 245 | iso_pu_bacteria | 2690316117 | 2692314428 | 110 |
| 246 | iso_pu_bacteria | 2751185821 | 2753461013 | 110 |
| 247 | iso_pu_bacteria | 2791355091 | 2792624350 | 110 |
| 248 | iso_pu_bacteria | 2791355092 | 2792625648 | 110 |
| 249 | iso_pu_bacteria | 2791355094 | 2792643724 | 110 |
| 250 | iso_pu_bacteria | 2847417321 | 2847420520 | 110 |
| 251 | iso_pu_bacteria | 2848992105 | 2848995392 | 110 |
| 252 | iso_pu_bacteria | 2855872281 | 2855878353 | 110 |
| 253 | iso_pu_bacteria | 643692032 | 643827158 | 110 |
| 254 | 3300005548 | Ga0070665_101161726 | Ga0070665_1011617262 | 111 |
| 255 | 3300006177 | Ga0075362_10098821 | Ga0075362_100988212 | 111 |
| 256 | 3300006178 | Ga0075367_10015269 | Ga0075367_100152692 | 111 |
| 257 | 3300006195 | Ga0075366_10019210 | Ga0075366_100192102 | 111 |
| 258 | 3300006353 | Ga0075370_10137065 | Ga0075370_101370652 | 111 |
| 259 | 3300026067 | Ga0207678_10839966 | Ga0207678_108399662 | 111 |
| 260 | 3300028379 | Ga0268266_10507812 | Ga0268266_105078122 | 111 |
| 261 | 3300050490 | nmdc:mga03n38_806249_c1 | nmdc:mga03n38_806249_c1_61_399 | 111 |
| 262 | 3300050491 | nmdc:mga00v17_818084_c1 | nmdc:mga00v17_818084_c1_171_509 | 111 |
| 263 | 3300050493 | nmdc:mga0k408_42546_c1 | nmdc:mga0k408_42546_c1_902_1237 | 111 |
| 264 | 3300050494 | nmdc:mga06z11_146038_c1 | nmdc:mga06z11_146038_c1_963_1298 | 111 |
| 265 | 3300050496 | nmdc:mga07m45_554088_c1 | nmdc:mga07m45_554088_c1_280_618 | 111 |
| 266 | 3300050516 | nmdc:mga0sz30_143305_c1 | nmdc:mga0sz30_143305_c1_141_476 | 111 |
| 267 | 3300048909 | Ga0496106_0431642 | Ga0496106_0431642_48_386 | 112 |
| 268 | 3300048911 | Ga0496108_0135605 | Ga0496108_0135605_168_506 | 112 |
| 269 | 3300048915 | Ga0496112_0943992 | Ga0496112_0943992_161_499 | 112 |
| 270 | 3300005331 | Ga0070670_100530285 | Ga0070670_1005302852 | 113 |
| 271 | 3300005436 | Ga0070713_101499363 | Ga0070713_1014993632 | 113 |
| 272 | 3300005564 | Ga0070664_101148197 | Ga0070664_1011481972 | 113 |
| 273 | 3300012485 | Ga0157325_1014661 | Ga0157325_10146612 | 113 |
| 274 | 3300025908 | Ga0207643_10510622 | Ga0207643_105106221 | 113 |
| 275 | 3300025912 | Ga0207707_10212866 | Ga0207707_102128662 | 113 |
| 276 | 3300025925 | Ga0207650_10467897 | Ga0207650_104678972 | 113 |
| 277 | 3300025928 | Ga0207700_11575107 | Ga0207700_115751071 | 113 |
| 278 | 3300025972 | Ga0207668_10614727 | Ga0207668_106147272 | 113 |
| 279 | 3300035086 | Ga0373934_0249697 | Ga0373934_0249697_351_695 | 113 |
| 280 | 3300035117 | Ga0373953_0043175 | Ga0373953_0043175_141_485 | 113 |
| 281 | 3300035118 | Ga0373954_0027058 | Ga0373954_0027058_537_881 | 113 |
| 282 | 3300035119 | Ga0373956_0114304 | Ga0373956_0114304_754_1098 | 113 |
| 283 | 3300035172 | Ga0373955_0180276 | Ga0373955_0180276_141_485 | 113 |
| 284 | 3300035724 | Ga0373933_0068256 | Ga0373933_0068256_45_389 | 113 |
| 285 | 3300036401 | Ga0373937_0009190 | Ga0373937_0009190_2039_2383 | 113 |
| 286 | 3300041512 | Ga0451853_0476034 | Ga0451853_0476034_100_444 | 113 |
| 287 | 3300046454 | Ga0495592_0020432 | Ga0495592_0020432_3065_3409 | 113 |
| 288 | 3300046462 | Ga0495651_0006031 | Ga0495651_0006031_4149_4493 | 113 |
| 289 | 3300046511 | Ga0495608_0119649 | Ga0495608_0119649_1249_1593 | 113 |
| 290 | 3300046516 | Ga0495628_0079641 | Ga0495628_0079641_188_532 | 113 |
| 291 | 3300046529 | Ga0495652_0008742 | Ga0495652_0008742_5481_5825 | 113 |
| 292 | 3300046533 | Ga0495640_0277998 | Ga0495640_0277998_297_641 | 113 |
| 293 | 3300046536 | Ga0495587_0002777 | Ga0495587_0002777_6020_6364 | 113 |
| 294 | 3300046559 | Ga0495667_0029932 | Ga0495667_0029932_1672_2016 | 113 |
| 295 | 3300046663 | Ga0495635_1059976 | Ga0495635_1059976_44_388 | 113 |
| 296 | 3300046675 | Ga0495657_0035784 | Ga0495657_0035784_1265_1609 | 113 |
| 297 | 3300046678 | Ga0495599_0005909 | Ga0495599_0005909_3195_3539 | 113 |
| 298 | 3300046679 | Ga0495623_0007781 | Ga0495623_0007781_2197_2541 | 113 |
| 299 | 3300046680 | Ga0495646_0148824 | Ga0495646_0148824_701_1045 | 113 |
| 300 | 3300047317 | Ga0495604_0008315 | Ga0495604_0008315_4062_4406 | 113 |
| 301 | 3300047322 | Ga0495680_0093764 | Ga0495680_0093764_1695_2039 | 113 |
| 302 | 3300047444 | Ga0495675_0015410 | Ga0495675_0015410_2416_2760 | 113 |
| 303 | 3300048088 | Ga0495602_0034886 | Ga0495602_0034886_448_792 | 113 |
| 304 | 3300049572 | Ga0501036_0201429 | Ga0501036_0201429_510_851 | 113 |
| 305 | 3300049576 | Ga0501040_0068260 | Ga0501040_0068260_563_904 | 113 |
| 306 | 3300049579 | Ga0501043_0389105 | Ga0501043_0389105_470_811 | 113 |
| 307 | 3300049581 | Ga0501047_0025007 | Ga0501047_0025007_118_459 | 113 |
| 308 | 3300049582 | Ga0501048_0308681 | Ga0501048_0308681_37_378 | 113 |
| 309 | 3300049590 | Ga0501074_0654559 | Ga0501074_0654559_186_527 | 113 |
| 310 | 3300049591 | Ga0501075_0013470 | Ga0501075_0013470_4836_5177 | 113 |
| 311 | 3300049592 | Ga0501076_0021916 | Ga0501076_0021916_2474_2815 | 113 |
| 312 | 3300049743 | Ga0501081_0134753 | Ga0501081_0134753_515_856 | 113 |
| 313 | 3300049744 | Ga0501083_0729326 | Ga0501083_0729326_156_497 | 113 |
| 314 | 3300049824 | Ga0501045_0032604 | Ga0501045_0032604_2878_3219 | 113 |
| 315 | 3300053077 | Ga0495601_0084264 | Ga0495601_0084264_87_431 | 113 |
| 316 | 3300053085 | Ga0495619_0089480 | Ga0495619_0089480_1452_1796 | 113 |
| 317 | 3300003322 | rootL2_10203169 | rootL2_102031692 | 114 |
| 318 | 3300005327 | Ga0070658_10009913 | Ga0070658_100099132 | 114 |
| 319 | 3300005327 | Ga0070658_10060929 | Ga0070658_100609292 | 114 |
| 320 | 3300005327 | Ga0070658_10420986 | Ga0070658_104209862 | 114 |
| 321 | 3300005329 | Ga0070683_100008005 | Ga0070683_1000080053 | 114 |
| 322 | 3300005331 | Ga0070670_100777314 | Ga0070670_1007773142 | 114 |
| 323 | 3300005334 | Ga0068869_100813139 | Ga0068869_1008131392 | 114 |
| 324 | 3300005336 | Ga0070680_100082068 | Ga0070680_1000820682 | 114 |
| 325 | 3300005336 | Ga0070680_100184071 | Ga0070680_1001840712 | 114 |
| 326 | 3300005337 | Ga0070682_100010286 | Ga0070682_1000102862 | 114 |
| 327 | 3300005337 | Ga0070682_100095987 | Ga0070682_1000959871 | 114 |
| 328 | 3300005339 | Ga0070660_100019751 | Ga0070660_1000197512 | 114 |
| 329 | 3300005339 | Ga0070660_100069718 | Ga0070660_1000697182 | 114 |
| 330 | 3300005339 | Ga0070660_100302192 | Ga0070660_1003021922 | 114 |
| 331 | 3300005341 | Ga0070691_10020419 | Ga0070691_100204192 | 114 |
| 332 | 3300005341 | Ga0070691_10339626 | Ga0070691_103396261 | 114 |
| 333 | 3300005344 | Ga0070661_100006965 | Ga0070661_1000069652 | 114 |
| 334 | 3300005344 | Ga0070661_100087159 | Ga0070661_1000871592 | 114 |
| 335 | 3300005344 | Ga0070661_100199711 | Ga0070661_1001997112 | 114 |
| 336 | 3300005344 | Ga0070661_100643809 | Ga0070661_1006438092 | 114 |
| 337 | 3300005345 | Ga0070692_10170060 | Ga0070692_101700602 | 114 |
| 338 | 3300005354 | Ga0070675_100536351 | Ga0070675_1005363512 | 114 |
| 339 | 3300005366 | Ga0070659_100000693 | Ga0070659_10000069315 | 114 |
| 340 | 3300005366 | Ga0070659_101242215 | Ga0070659_1012422152 | 114 |
| 341 | 3300005367 | Ga0070667_101957469 | Ga0070667_1019574691 | 114 |
| 342 | 3300005435 | Ga0070714_100020726 | Ga0070714_1000207263 | 114 |
| 343 | 3300005439 | Ga0070711_100130172 | Ga0070711_1001301722 | 114 |
| 344 | 3300005444 | Ga0070694_100402188 | Ga0070694_1004021881 | 114 |
| 345 | 3300005455 | Ga0070663_100011149 | Ga0070663_1000111492 | 114 |
| 346 | 3300005455 | Ga0070663_100012452 | Ga0070663_1000124522 | 114 |
| 347 | 3300005457 | Ga0070662_100184692 | Ga0070662_1001846922 | 114 |
| 348 | 3300005457 | Ga0070662_100265886 | Ga0070662_1002658862 | 114 |
| 349 | 3300005458 | Ga0070681_10017527 | Ga0070681_100175279 | 114 |
| 350 | 3300005458 | Ga0070681_10241619 | Ga0070681_102416192 | 114 |
| 351 | 3300005459 | Ga0068867_100844762 | Ga0068867_1008447622 | 114 |
| 352 | 3300005530 | Ga0070679_100075251 | Ga0070679_1000752512 | 114 |
| 353 | 3300005530 | Ga0070679_100449638 | Ga0070679_1004496382 | 114 |
| 354 | 3300005535 | Ga0070684_100188684 | Ga0070684_1001886842 | 114 |
| 355 | 3300005539 | Ga0068853_100003131 | Ga0068853_1000031317 | 114 |
| 356 | 3300005539 | Ga0068853_100118457 | Ga0068853_1001184571 | 114 |
| 357 | 3300005539 | Ga0068853_100642387 | Ga0068853_1006423872 | 114 |
| 358 | 3300005545 | Ga0070695_100332525 | Ga0070695_1003325251 | 114 |
| 359 | 3300005546 | Ga0070696_100098675 | Ga0070696_1000986752 | 114 |
| 360 | 3300005547 | Ga0070693_100030007 | Ga0070693_1000300073 | 114 |
| 361 | 3300005563 | Ga0068855_100063785 | Ga0068855_1000637855 | 114 |
| 362 | 3300005564 | Ga0070664_100005054 | Ga0070664_1000050546 | 114 |
| 363 | 3300005564 | Ga0070664_100014100 | Ga0070664_1000141005 | 114 |
| 364 | 3300005564 | Ga0070664_100218943 | Ga0070664_1002189432 | 114 |
| 365 | 3300005564 | Ga0070664_100996115 | Ga0070664_1009961152 | 114 |
| 366 | 3300005564 | Ga0070664_101742698 | Ga0070664_1017426982 | 114 |
| 367 | 3300005577 | Ga0068857_100015019 | Ga0068857_1000150194 | 114 |
| 368 | 3300005577 | Ga0068857_100747171 | Ga0068857_1007471712 | 114 |
| 369 | 3300005578 | Ga0068854_100029205 | Ga0068854_1000292052 | 114 |
| 370 | 3300005614 | Ga0068856_100197532 | Ga0068856_1001975322 | 114 |
| 371 | 3300005614 | Ga0068856_100502063 | Ga0068856_1005020632 | 114 |
| 372 | 3300005614 | Ga0068856_101443519 | Ga0068856_1014435192 | 114 |
| 373 | 3300005615 | Ga0070702_100489888 | Ga0070702_1004898882 | 114 |
| 374 | 3300005616 | Ga0068852_100320082 | Ga0068852_1003200822 | 114 |
| 375 | 3300005616 | Ga0068852_100363817 | Ga0068852_1003638172 | 114 |
| 376 | 3300005617 | Ga0068859_100210991 | Ga0068859_1002109912 | 114 |
| 377 | 3300005834 | Ga0068851_10002036 | Ga0068851_100020369 | 114 |
| 378 | 3300005834 | Ga0068851_10270964 | Ga0068851_102709642 | 114 |
| 379 | 3300005840 | Ga0068870_10995457 | Ga0068870_109954571 | 114 |
| 380 | 3300006237 | Ga0097621_101561744 | Ga0097621_1015617442 | 114 |
| 381 | 3300006358 | Ga0068871_100549003 | Ga0068871_1005490032 | 114 |
| 382 | 3300006871 | Ga0075434_100547899 | Ga0075434_1005478992 | 114 |
| 383 | 3300006881 | Ga0068865_100316804 | Ga0068865_1003168042 | 114 |
| 384 | 3300006931 | Ga0097620_100210985 | Ga0097620_1002109852 | 114 |
| 385 | 3300009147 | Ga0114129_11497195 | Ga0114129_114971952 | 114 |
| 386 | 3300009174 | Ga0105241_10003941 | Ga0105241_100039417 | 114 |
| 387 | 3300009174 | Ga0105241_10004527 | Ga0105241_100045273 | 114 |
| 388 | 3300009176 | Ga0105242_10581301 | Ga0105242_105813012 | 114 |
| 389 | 3300009177 | Ga0105248_11869018 | Ga0105248_118690182 | 114 |
| 390 | 3300009545 | Ga0105237_10026508 | Ga0105237_100265087 | 114 |
| 391 | 3300009545 | Ga0105237_10617846 | Ga0105237_106178461 | 114 |
| 392 | 3300009551 | Ga0105238_10113821 | Ga0105238_101138212 | 114 |
| 393 | 3300010375 | Ga0105239_11818878 | Ga0105239_118188782 | 114 |
| 394 | 3300013100 | Ga0157373_10003131 | Ga0157373_100031312 | 114 |
| 395 | 3300013100 | Ga0157373_10832597 | Ga0157373_108325971 | 114 |
| 396 | 3300013102 | Ga0157371_10032993 | Ga0157371_100329932 | 114 |
| 397 | 3300013102 | Ga0157371_11297227 | Ga0157371_112972272 | 114 |
| 398 | 3300013104 | Ga0157370_10468512 | Ga0157370_104685122 | 114 |
| 399 | 3300013104 | Ga0157370_10824077 | Ga0157370_108240772 | 114 |
| 400 | 3300013105 | Ga0157369_12146314 | Ga0157369_121463142 | 114 |
| 401 | 3300013297 | Ga0157378_10415706 | Ga0157378_104157062 | 114 |
| 402 | 3300013297 | Ga0157378_11413854 | Ga0157378_114138542 | 114 |
| 403 | 3300013297 | Ga0157378_11917807 | Ga0157378_119178072 | 114 |
| 404 | 3300013307 | Ga0157372_10296762 | Ga0157372_102967622 | 114 |
| 405 | 3300013307 | Ga0157372_10516559 | Ga0157372_105165592 | 114 |
| 406 | 3300014968 | Ga0157379_10035523 | Ga0157379_100355232 | 114 |
| 407 | 3300014968 | Ga0157379_10413666 | Ga0157379_104136662 | 114 |
| 408 | 3300014969 | Ga0157376_10918724 | Ga0157376_109187242 | 114 |
| 409 | 3300014969 | Ga0157376_12927572 | Ga0157376_129275721 | 114 |
| 410 | 3300020070 | Ga0206356_10640862 | Ga0206356_106408622 | 114 |
| 411 | 3300025321 | Ga0207656_10020950 | Ga0207656_100209502 | 114 |
| 412 | 3300025904 | Ga0207647_10116267 | Ga0207647_101162672 | 114 |
| 413 | 3300025907 | Ga0207645_10989280 | Ga0207645_109892802 | 114 |
| 414 | 3300025908 | Ga0207643_10304098 | Ga0207643_103040982 | 114 |
| 415 | 3300025909 | Ga0207705_10018450 | Ga0207705_100184502 | 114 |
| 416 | 3300025911 | Ga0207654_10048136 | Ga0207654_100481362 | 114 |
| 417 | 3300025912 | Ga0207707_10106258 | Ga0207707_101062583 | 114 |
| 418 | 3300025913 | Ga0207695_10129333 | Ga0207695_101293332 | 114 |
| 419 | 3300025914 | Ga0207671_10058206 | Ga0207671_100582063 | 114 |
| 420 | 3300025914 | Ga0207671_10274369 | Ga0207671_102743692 | 114 |
| 421 | 3300025916 | Ga0207663_10219548 | Ga0207663_102195482 | 114 |
| 422 | 3300025917 | Ga0207660_10070599 | Ga0207660_100705992 | 114 |
| 423 | 3300025917 | Ga0207660_10122834 | Ga0207660_101228342 | 114 |
| 424 | 3300025919 | Ga0207657_10000302 | Ga0207657_1000030222 | 114 |
| 425 | 3300025919 | Ga0207657_10902777 | Ga0207657_109027772 | 114 |
| 426 | 3300025920 | Ga0207649_10057670 | Ga0207649_100576702 | 114 |
| 427 | 3300025921 | Ga0207652_10010922 | Ga0207652_100109223 | 114 |
| 428 | 3300025921 | Ga0207652_10424002 | Ga0207652_104240022 | 114 |
| 429 | 3300025924 | Ga0207694_10027148 | Ga0207694_100271482 | 114 |
| 430 | 3300025925 | Ga0207650_10291983 | Ga0207650_102919832 | 114 |
| 431 | 3300025926 | Ga0207659_11483765 | Ga0207659_114837652 | 114 |
| 432 | 3300025929 | Ga0207664_10272430 | Ga0207664_102724302 | 114 |
| 433 | 3300025929 | Ga0207664_11522102 | Ga0207664_115221022 | 114 |
| 434 | 3300025932 | Ga0207690_10071890 | Ga0207690_100718902 | 114 |
| 435 | 3300025933 | Ga0207706_10178192 | Ga0207706_101781922 | 114 |
| 436 | 3300025933 | Ga0207706_10425564 | Ga0207706_104255642 | 114 |
| 437 | 3300025934 | Ga0207686_11000011 | Ga0207686_110000112 | 114 |
| 438 | 3300025935 | Ga0207709_10051400 | Ga0207709_100514002 | 114 |
| 439 | 3300025944 | Ga0207661_10077775 | Ga0207661_100777752 | 114 |
| 440 | 3300025945 | Ga0207679_10350683 | Ga0207679_103506831 | 114 |
| 441 | 3300025945 | Ga0207679_10369263 | Ga0207679_103692632 | 114 |
| 442 | 3300025945 | Ga0207679_10535105 | Ga0207679_105351052 | 114 |
| 443 | 3300025945 | Ga0207679_11275729 | Ga0207679_112757292 | 114 |
| 444 | 3300025949 | Ga0207667_10001606 | Ga0207667_1000160628 | 114 |
| 445 | 3300025949 | Ga0207667_10107421 | Ga0207667_101074212 | 114 |
| 446 | 3300025981 | Ga0207640_10227542 | Ga0207640_102275422 | 114 |
| 447 | 3300025986 | Ga0207658_11841423 | Ga0207658_118414232 | 114 |
| 448 | 3300026035 | Ga0207703_10075600 | Ga0207703_100756003 | 114 |
| 449 | 3300026035 | Ga0207703_11113226 | Ga0207703_111132262 | 114 |
| 450 | 3300026041 | Ga0207639_10012400 | Ga0207639_100124004 | 114 |
| 451 | 3300026067 | Ga0207678_10004254 | Ga0207678_100042547 | 114 |
| 452 | 3300026067 | Ga0207678_10011384 | Ga0207678_100113842 | 114 |
| 453 | 3300026067 | Ga0207678_10643860 | Ga0207678_106438601 | 114 |
| 454 | 3300026078 | Ga0207702_10007075 | Ga0207702_100070757 | 114 |
| 455 | 3300026078 | Ga0207702_10516996 | Ga0207702_105169962 | 114 |
| 456 | 3300026078 | Ga0207702_11250876 | Ga0207702_112508762 | 114 |
| 457 | 3300026116 | Ga0207674_10000251 | Ga0207674_1000025140 | 114 |
| 458 | 3300026116 | Ga0207674_10314059 | Ga0207674_103140591 | 114 |
| 459 | 3300026121 | Ga0207683_10656541 | Ga0207683_106565411 | 114 |
| 460 | 3300026142 | Ga0207698_10068386 | Ga0207698_100683862 | 114 |
| 461 | 3300026142 | Ga0207698_10209742 | Ga0207698_102097422 | 114 |
| 462 | 3300028381 | Ga0268264_10388337 | Ga0268264_103883372 | 114 |
| 463 | 3300037312 | Ga0395899_0102890 | Ga0395899_0102890_1636_1980 | 114 |
| 464 | 3300037418 | Ga0395900_0008836 | Ga0395900_0008836_9181_9525 | 114 |
| 465 | 3300037418 | Ga0395900_0148643 | Ga0395900_0148643_1727_2074 | 114 |
| 466 | 3300037466 | Ga0395898_0412455 | Ga0395898_0412455_789_1133 | 114 |
| 467 | 3300037471 | Ga0395905_0399306 | Ga0395905_0399306_160_507 | 114 |
| 468 | 3300041459 | Ga0451800_0017687 | Ga0451800_0017687_95_442 | 114 |
| 469 | 3300041491 | Ga0451833_0590600 | Ga0451833_0590600_47_394 | 114 |
| 470 | 3300041512 | Ga0451853_2948516 | Ga0451853_2948516_231_578 | 114 |
| 471 | 3300042007 | Ga0439449_0057240 | Ga0439449_0057240_1065_1415 | 114 |
| 472 | 3300042876 | Ga0451577_0198323 | Ga0451577_0198323_1175_1522 | 114 |
| 473 | 3300044694 | Ga0466963_0147916 | Ga0466963_0147916_626_973 | 114 |
| 474 | 3300044706 | Ga0466964_0523096 | Ga0466964_0523096_50_397 | 114 |
| 475 | 3300044842 | Ga0466957_0521857 | Ga0466957_0521857_170_517 | 114 |
| 476 | 3300048903 | Ga0496100_0169290 | Ga0496100_0169290_202_546 | 114 |
| 477 | 3300048905 | Ga0496102_0501069 | Ga0496102_0501069_101_445 | 114 |
| 478 | 3300048905 | Ga0496102_1750836 | Ga0496102_1750836_173_520 | 114 |
| 479 | 3300048906 | Ga0496103_0003025 | Ga0496103_0003025_3329_3673 | 114 |
| 480 | 3300048907 | Ga0496104_0735200 | Ga0496104_0735200_535_879 | 114 |
| 481 | 3300048909 | Ga0496106_0015222 | Ga0496106_0015222_3514_3858 | 114 |
| 482 | 3300048909 | Ga0496106_1389997 | Ga0496106_1389997_11_358 | 114 |
| 483 | 3300048910 | Ga0496107_0021433 | Ga0496107_0021433_2894_3238 | 114 |
| 484 | 3300048911 | Ga0496108_1545724 | Ga0496108_1545724_52_396 | 114 |
| 485 | 3300048912 | Ga0496109_0947074 | Ga0496109_0947074_65_409 | 114 |
| 486 | 3300048915 | Ga0496112_0884234 | Ga0496112_0884234_414_761 | 114 |
| 487 | 3300048917 | Ga0496114_0248261 | Ga0496114_0248261_451_795 | 114 |
| 488 | 3300048918 | Ga0496115_0039507 | Ga0496115_0039507_3109_3453 | 114 |
| 489 | 3300049581 | Ga0501047_0859495 | Ga0501047_0859495_12_356 | 114 |
| 490 | 3300049588 | Ga0501072_0243866 | Ga0501072_0243866_183_527 | 114 |
| 491 | 3300049823 | Ga0501044_0168518 | Ga0501044_0168518_948_1292 | 114 |
| 492 | 3300050509 | nmdc:mga0qj67_49109_c1 | nmdc:mga0qj67_49109_c1_998_1342 | 114 |
| 493 | 3300050511 | nmdc:mga08y16_301535_c1 | nmdc:mga08y16_301535_c1_552_899 | 114 |
| 494 | 3300050512 | nmdc:mga0n895_2102802_c1 | nmdc:mga0n895_2102802_c1_51_398 | 114 |
| 495 | 3300060353 | Ga0501082_0502572 | Ga0501082_0502572_571_915 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nyu-assembly1.cif.gz_K | respiratory complex i from escherichia coli - conformation 2 | 0.5608 | 7 | 99 |
| 7bv1-assembly1.cif.gz_A | cryo-em structure of the apo nsp12-nsp7-nsp8 complex | 0.5398 | 2 | 56 |
| 2nr5-assembly1.cif.gz_C | crystal structure of protein of unknown function so2669 from shewanella oneidensis mr-1 | 0.5311 | 2 | 54 |
| 7d3u-assembly1.cif.gz_C | structure of mrp complex from dietzia sp. dq12-45-1b | 0.5227 | 4 | 98 |
| 8gwe-assembly1.cif.gz_A | sars-cov-2 e-rtc complex with rna-nsp9 and gmppnp | 0.4982 | 3 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0X9L3_107_499_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9324 | 5 | 50 | 1.10.3860.10 |
| af_H0WEV0_822_1008_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.891 | 1 | 48 | 1.25.40.10 |
| af_Q19153_735_929_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.8677 | 2 | 43 | 1.20.1640.10 |
| af_I1JYC9_28_130_1.20.930.10 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 | 0.827 | 12 | 52 | 1.20.930.10 |
| af_I1KB67_1_98_1.20.930.10 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 | 0.821 | 13 | 53 | 1.20.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A512CS11-F1-model_v4 | deleted | 0.9557 | 1 | 51 |
|
| AF-A0A1H0BM56-F1-model_v4 | DUF3239 domain-containing protein | 0.848 | 3 | 55 |
GO:0016020
|
| AF-A0A2H0ERF4-F1-model_v4 | Na+/H+ antiporter subunit C | 0.8309 | 1 | 61 |
GO:0016020
|
| AF-A0A2H0ERF4-F1-model_v4 | Na+/H+ antiporter subunit C | 0.8185 | 1 | 61 |
GO:0016020
|
| AF-Q8NT24-F1-model_v4 | Hypothetical membrane protein | 0.8153 | 5 | 57 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar