F454699

General Info

Members Datasets Scaffolds Average Seq Length
495 302 467 110

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101148197|Ga0070664_1011481972
Length 117
Sequence MNELIVSLGIGVLTASGVWLLLRPRTFQVAIGLTLLAYAVNLFIFSMGRLRTGAAPVVTAAAADPSAYADPLPQALVLTAIVINFATTALLLVVVLASRGLRGTDHVDGQESTDDSP

Samples

Sample ID Description Type Environment
1 2516143018 Ensifer sp. BR816 Isolate Nodule
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
6 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
7 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
8 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
9 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
10 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
11 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
12 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
13 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
14 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
15 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
16 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
17 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
18 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
19 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
20 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
21 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
22 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
23 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
24 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
25 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
26 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
205 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
233 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
302 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.14
Metatranscriptomes 0.2
Isolates 5.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 3.84
Rhizoplane 5.05
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10203169 3300003322 Bacteria 1743
2 Ga0065707_10147027 3300005295 Bacteria 1701
3 Ga0070658_10009913 3300005327 Bacteria 7655
4 Ga0070658_10060929 3300005327 Bacteria 3074
5 Ga0070658_10420986 3300005327 Bacteria 1148
6 Ga0070676_10085636 3300005328 Bacteria 1921
7 Ga0070676_10568101 3300005328 Bacteria 814
8 Ga0070683_100008005 3300005329 Bacteria 8969
9 Ga0070690_100010474 3300005330 Bacteria 5398
10 Ga0070670_100530285 3300005331 Bacteria 1049
11 Ga0070670_100777314 3300005331 Bacteria 864
12 Ga0068869_100660960 3300005334 Bacteria 888
13 Ga0068869_100813139 3300005334 Unclassified 804
14 Ga0070666_10025010 3300005335 Bacteria 3891
15 Ga0070680_100014420 3300005336 Bacteria 6177
16 Ga0070680_100082068 3300005336 Bacteria 2660
17 Ga0070680_100150011 3300005336 Bacteria 1957
18 Ga0070680_100184071 3300005336 Bacteria 1760
19 Ga0070682_100010286 3300005337 Bacteria 5308
20 Ga0070682_100067246 3300005337 Bacteria 2282
21 Ga0070682_100095987 3300005337 Bacteria 1948
22 Ga0068868_100530189 3300005338 Bacteria 1035
23 Ga0068868_101830663 3300005338 Bacteria 574
24 Ga0070660_100019751 3300005339 Bacteria 4942
25 Ga0070660_100069718 3300005339 Bacteria 2742
26 Ga0070660_100302192 3300005339 Bacteria 1312
27 Ga0070689_100284651 3300005340 Bacteria 1372
28 Ga0070691_10020419 3300005341 Bacteria 3061
29 Ga0070691_10339626 3300005341 Bacteria 831
30 Ga0070687_100016154 3300005343 Bacteria 3396
31 Ga0070687_100204002 3300005343 Bacteria 1200
32 Ga0070661_100006965 3300005344 Bacteria 7801
33 Ga0070661_100087159 3300005344 Bacteria 2309
34 Ga0070661_100199711 3300005344 Bacteria 1527
35 Ga0070661_100643809 3300005344 Bacteria 860
36 Ga0070692_10007879 3300005345 Bacteria 4722
37 Ga0070692_10170060 3300005345 Bacteria 1256
38 Ga0070692_10187435 3300005345 Bacteria 1203
39 Ga0070692_11031448 3300005345 Bacteria 577
40 Ga0070668_100119736 3300005347 Bacteria 2103
41 Ga0070669_100007367 3300005353 Bacteria 7889
42 Ga0070669_100021059 3300005353 Bacteria 4658
43 Ga0070675_100010896 3300005354 Bacteria 7112
44 Ga0070675_100536351 3300005354 Bacteria 1057
45 Ga0070671_100215278 3300005355 Bacteria 1630
46 Ga0070674_100835352 3300005356 Bacteria 798
47 Ga0070674_102134359 3300005356 Bacteria 511
48 Ga0070673_100050649 3300005364 Bacteria 3248
49 Ga0070673_101226158 3300005364 Bacteria 703
50 Ga0070688_100024071 3300005365 Bacteria 3587
51 Ga0070659_100000693 3300005366 Bacteria 24520
52 Ga0070659_101242215 3300005366 Bacteria 660
53 Ga0070667_100130344 3300005367 Bacteria 2194
54 Ga0070667_101025107 3300005367 Bacteria 770
55 Ga0070667_101957469 3300005367 Bacteria 552
56 Ga0070703_10178768 3300005406 Bacteria 818
57 Ga0070714_100020726 3300005435 Bacteria 5373
58 Ga0070713_101499363 3300005436 Bacteria 654
59 Ga0070711_100130172 3300005439 Bacteria 1873
60 Ga0070700_100001753 3300005441 Bacteria 10904
61 Ga0070700_100588129 3300005441 Bacteria 870
62 Ga0070694_100402188 3300005444 Bacteria 1072
63 Ga0070694_101028356 3300005444 Bacteria 685
64 Ga0070663_100011149 3300005455 Bacteria 5628
65 Ga0070663_100012452 3300005455 Bacteria 5382
66 Ga0070663_100056190 3300005455 Bacteria 2819
67 Ga0070678_100227662 3300005456 Bacteria 1553
68 Ga0070678_100868910 3300005456 Bacteria 823
69 Ga0070662_100184692 3300005457 Bacteria 1646
70 Ga0070662_100265886 3300005457 Bacteria 1383
71 Ga0070662_101358624 3300005457 Bacteria 612
72 Ga0070681_10006828 3300005458 Bacteria 11113
73 Ga0070681_10017527 3300005458 Bacteria 7158
74 Ga0070681_10241619 3300005458 Bacteria 1719
75 Ga0068867_100001755 3300005459 Bacteria 15105
76 Ga0068867_100808459 3300005459 Bacteria 837
77 Ga0068867_100844762 3300005459 Unclassified 820
78 Ga0070685_10334377 3300005466 Bacteria 1031
79 Ga0070679_100028734 3300005530 Bacteria 5485
80 Ga0070679_100075251 3300005530 Bacteria 3366
81 Ga0070679_100449638 3300005530 Bacteria 1233
82 Ga0070684_100188684 3300005535 Bacteria 1875
83 Ga0068853_100003131 3300005539 Bacteria 12646
84 Ga0068853_100118457 3300005539 Bacteria 2360
85 Ga0068853_100642387 3300005539 Bacteria 1010
86 Ga0070672_100018691 3300005543 Bacteria 5017
87 Ga0070686_100596766 3300005544 Bacteria 870
88 Ga0070686_101378760 3300005544 Bacteria 591
89 Ga0070695_100332525 3300005545 Bacteria 1133
90 Ga0070695_100583481 3300005545 Bacteria 875
91 Ga0070696_100098675 3300005546 Bacteria 2090
92 Ga0070693_100030007 3300005547 Bacteria 2969
93 Ga0070665_100063019 3300005548 Bacteria 3718
94 Ga0070665_101161726 3300005548 Bacteria 783
95 Ga0070704_100642975 3300005549 Bacteria 936
96 Ga0068855_100063785 3300005563 Bacteria 4298
97 Ga0068855_100074798 3300005563 Bacteria 3934
98 Ga0068855_100444615 3300005563 Bacteria 1415
99 Ga0070664_100005054 3300005564 Bacteria 10577
100 Ga0070664_100014100 3300005564 Bacteria 6519
101 Ga0070664_100218943 3300005564 Bacteria 1703
102 Ga0070664_100996115 3300005564 Bacteria 788
103 Ga0070664_101148197 3300005564 Bacteria 732
104 Ga0070664_101742698 3300005564 Bacteria 591
105 Ga0068857_100015019 3300005577 Bacteria 6756
106 Ga0068857_100747171 3300005577 Bacteria 932
107 Ga0068854_100029205 3300005578 Bacteria 3816
108 Ga0068856_100197532 3300005614 Bacteria 2026
109 Ga0068856_100502063 3300005614 Bacteria 1234
110 Ga0068856_101443519 3300005614 Bacteria 702
111 Ga0070702_100489888 3300005615 Bacteria 900
112 Ga0068852_100320082 3300005616 Bacteria 1506
113 Ga0068852_100363817 3300005616 Bacteria 1415
114 Ga0068852_100375379 3300005616 Bacteria 1394
115 Ga0068859_100210991 3300005617 Bacteria 2028
116 Ga0068859_100351101 3300005617 Bacteria 1570
117 Ga0068859_102804066 3300005617 Bacteria 535
118 Ga0068864_101074540 3300005618 Bacteria 800
119 Ga0068866_10152414 3300005718 Bacteria 1340
120 Ga0068861_100001610 3300005719 Bacteria 14384
121 Ga0068861_100014724 3300005719 Bacteria 5494
122 Ga0068861_100299708 3300005719 Bacteria 1392
123 Ga0068861_100536626 3300005719 Bacteria 1064
124 Ga0068851_10002036 3300005834 Bacteria 8920
125 Ga0068851_10216247 3300005834 Bacteria 1075
126 Ga0068851_10270964 3300005834 Bacteria 968
127 Ga0068870_10012679 3300005840 Bacteria 3945
128 Ga0068870_10284481 3300005840 Bacteria 1038
129 Ga0068870_10995457 3300005840 Unclassified 597
130 Ga0068863_100485776 3300005841 Bacteria 1215
131 Ga0068858_101869927 3300005842 Bacteria 593
132 Ga0068860_100060858 3300005843 Bacteria 3588
133 Ga0068860_100281638 3300005843 Bacteria 1625
134 Ga0068862_100005068 3300005844 Bacteria 11085
135 Ga0068862_100487484 3300005844 Bacteria 1168
136 Ga0068862_100974044 3300005844 Bacteria 837
137 Ga0068862_102458499 3300005844 Bacteria 533
138 Ga0075365_10022211 3300006038 Bacteria 3972
139 Ga0075364_10815369 3300006051 Bacteria 636
140 Ga0075362_10098821 3300006177 Bacteria 1362
141 Ga0075367_10008005 3300006178 Bacteria 5449
142 Ga0075367_10015269 3300006178 Bacteria 4169
143 Ga0075366_10019210 3300006195 Bacteria 3951
144 Ga0075366_10351781 3300006195 Bacteria 904
145 Ga0097621_100423485 3300006237 Bacteria 1195
146 Ga0097621_101561744 3300006237 Bacteria 627
147 Ga0075370_10137065 3300006353 Bacteria 1430
148 Ga0075370_10260130 3300006353 Bacteria 1029
149 Ga0068871_100549003 3300006358 Bacteria 1046
150 Ga0068871_102419998 3300006358 Bacteria 501
151 Ga0075428_101436415 3300006844 Bacteria 723
152 Ga0075431_100811435 3300006847 Bacteria 908
153 Ga0075434_100547899 3300006871 Bacteria 1176
154 Ga0075429_100126670 3300006880 Bacteria 2233
155 Ga0068865_100004826 3300006881 Bacteria 8148
156 Ga0068865_100316804 3300006881 Bacteria 1253
157 Ga0068865_102048635 3300006881 Bacteria 520
158 Ga0097620_100210985 3300006931 Bacteria 2028
159 Ga0097620_100351121 3300006931 Bacteria 1570
160 Ga0097620_102804085 3300006931 Bacteria 535
161 Ga0105240_10154816 3300009093 Bacteria 2727
162 Ga0111539_10435108 3300009094 Bacteria 1527
163 Ga0105245_10284401 3300009098 Bacteria 1618
164 Ga0114129_11497195 3300009147 Bacteria 829
165 Ga0105243_10003862 3300009148 Bacteria 11970
166 Ga0105241_10003941 3300009174 Bacteria 10983
167 Ga0105241_10004527 3300009174 Bacteria 10281
168 Ga0105241_11631367 3300009174 Bacteria 625
169 Ga0105242_10581301 3300009176 Unclassified 1079
170 Ga0105242_12476425 3300009176 Bacteria 567
171 Ga0105248_10002755 3300009177 Bacteria 19524
172 Ga0105248_11869018 3300009177 Bacteria 681
173 Ga0105237_10026508 3300009545 Bacteria 5924
174 Ga0105237_10617846 3300009545 Bacteria 1091
175 Ga0105238_10113821 3300009551 Bacteria 2685
176 Ga0105249_10008393 3300009553 Bacteria 8998
177 Ga0105249_10918461 3300009553 Bacteria 943
178 Ga0105239_11818878 3300010375 Unclassified 706
179 Ga0157325_1014661 3300012485 Bacteria 632
180 Ga0157373_10003131 3300013100 Bacteria 12498
181 Ga0157373_10832597 3300013100 Unclassified 682
182 Ga0157371_10032993 3300013102 Bacteria 3722
183 Ga0157371_11297227 3300013102 Bacteria 563
184 Ga0157370_10468512 3300013104 Bacteria 1158
185 Ga0157370_10824077 3300013104 Bacteria 844
186 Ga0157369_12146314 3300013105 Bacteria 566
187 Ga0157374_10872402 3300013296 Bacteria 917
188 Ga0157378_10415706 3300013297 Bacteria 1328
189 Ga0157378_11413854 3300013297 Bacteria 739
190 Ga0157378_11553815 3300013297 Bacteria 707
191 Ga0157378_11917807 3300013297 Bacteria 642
192 Ga0157372_10296762 3300013307 Bacteria 1880
193 Ga0157372_10516559 3300013307 Bacteria 1392
194 Ga0157372_11805883 3300013307 Bacteria 703
195 Ga0157375_10336122 3300013308 Bacteria 1676
196 Ga0157375_11049202 3300013308 Bacteria 953
197 Ga0157380_10004661 3300014326 Bacteria 9541
198 Ga0157380_10059377 3300014326 Bacteria 3052
199 Ga0157380_11415837 3300014326 Bacteria 746
200 Ga0157377_10113500 3300014745 Bacteria 1632
201 Ga0157379_10035523 3300014968 Bacteria 4444
202 Ga0157379_10143491 3300014968 Bacteria 2153
203 Ga0157379_10413666 3300014968 Bacteria 1241
204 Ga0157376_10387064 3300014969 Bacteria 1349
205 Ga0157376_10918724 3300014969 Bacteria 894
206 Ga0157376_12927572 3300014969 Bacteria 517
207 Ga0163161_10469657 3300017792 Bacteria 1020
208 Ga0206356_10640862 3300020070 Bacteria 1226
209 Ga0207656_10020950 3300025321 Bacteria 2605
210 Ga0207682_10047333 3300025893 Bacteria 1770
211 Ga0207642_10018896 3300025899 Bacteria 2656
212 Ga0207688_10764732 3300025901 Bacteria 612
213 Ga0207680_10022011 3300025903 Bacteria 3461
214 Ga0207680_10454008 3300025903 Bacteria 910
215 Ga0207647_10116267 3300025904 Bacteria 1579
216 Ga0207645_10338398 3300025907 Bacteria 1006
217 Ga0207645_10503230 3300025907 Bacteria 820
218 Ga0207645_10989280 3300025907 Unclassified 570
219 Ga0207643_10063349 3300025908 Bacteria 2114
220 Ga0207643_10304098 3300025908 Unclassified 993
221 Ga0207643_10510622 3300025908 Bacteria 769
222 Ga0207705_10018450 3300025909 Bacteria 4989
223 Ga0207654_10048136 3300025911 Bacteria 2439
224 Ga0207654_10297623 3300025911 Bacteria 1096
225 Ga0207707_10000582 3300025912 Bacteria 37091
226 Ga0207707_10106258 3300025912 Bacteria 2454
227 Ga0207707_10212866 3300025912 Bacteria 1683
228 Ga0207695_10129333 3300025913 Bacteria 2484
229 Ga0207695_10713543 3300025913 Bacteria 883
230 Ga0207671_10058206 3300025914 Bacteria 2865
231 Ga0207671_10274369 3300025914 Bacteria 1329
232 Ga0207663_10219548 3300025916 Bacteria 1382
233 Ga0207660_10012873 3300025917 Bacteria 5477
234 Ga0207660_10033504 3300025917 Bacteria 3554
235 Ga0207660_10070599 3300025917 Bacteria 2539
236 Ga0207660_10122834 3300025917 Bacteria 1968
237 Ga0207660_10730628 3300025917 Bacteria 808
238 Ga0207662_10027658 3300025918 Bacteria 3274
239 Ga0207657_10000302 3300025919 Bacteria 52284
240 Ga0207657_10902777 3300025919 Unclassified 681
241 Ga0207649_10057670 3300025920 Bacteria 2429
242 Ga0207652_10004959 3300025921 Bacteria 10782
243 Ga0207652_10010922 3300025921 Bacteria 7320
244 Ga0207652_10424002 3300025921 Bacteria 1200
245 Ga0207681_10002070 3300025923 Bacteria 12847
246 Ga0207681_10043653 3300025923 Bacteria 3002
247 Ga0207694_10027148 3300025924 Bacteria 4360
248 Ga0207650_10291983 3300025925 Bacteria 1330
249 Ga0207650_10467897 3300025925 Bacteria 1051
250 Ga0207650_10513320 3300025925 Bacteria 1002
251 Ga0207659_10014621 3300025926 Bacteria 5067
252 Ga0207659_11483765 3300025926 Bacteria 580
253 Ga0207700_11575107 3300025928 Bacteria 582
254 Ga0207664_10272430 3300025929 Bacteria 1483
255 Ga0207664_11522102 3300025929 Bacteria 591
256 Ga0207644_10007077 3300025931 Bacteria 7312
257 Ga0207690_10071890 3300025932 Bacteria 2387
258 Ga0207706_10040247 3300025933 Bacteria 4142
259 Ga0207706_10178192 3300025933 Bacteria 1867
260 Ga0207706_10425564 3300025933 Bacteria 1150
261 Ga0207686_11000011 3300025934 Unclassified 679
262 Ga0207709_10002476 3300025935 Bacteria 11575
263 Ga0207709_10051400 3300025935 Bacteria 2526
264 Ga0207670_10436218 3300025936 Bacteria 1054
265 Ga0207669_10220223 3300025937 Bacteria 1392
266 Ga0207669_11738430 3300025937 Bacteria 533
267 Ga0207704_10021013 3300025938 Bacteria 3467
268 Ga0207691_10030728 3300025940 Bacteria 5017
269 Ga0207691_11501650 3300025940 Bacteria 551
270 Ga0207711_10029358 3300025941 Bacteria 4638
271 Ga0207689_10168247 3300025942 Bacteria 1806
272 Ga0207689_10728454 3300025942 Bacteria 837
273 Ga0207661_10077775 3300025944 Bacteria 2730
274 Ga0207679_10350683 3300025945 Bacteria 1286
275 Ga0207679_10369263 3300025945 Bacteria 1255
276 Ga0207679_10535105 3300025945 Bacteria 1049
277 Ga0207679_11275729 3300025945 Bacteria 674
278 Ga0207667_10001606 3300025949 Bacteria 28419
279 Ga0207667_10107421 3300025949 Bacteria 2879
280 Ga0207667_10328663 3300025949 Bacteria 1561
281 Ga0207651_10050020 3300025960 Bacteria 2836
282 Ga0207651_10110517 3300025960 Bacteria 2062
283 Ga0207651_11069904 3300025960 Bacteria 722
284 Ga0207712_10002513 3300025961 Bacteria 11800
285 Ga0207668_10003072 3300025972 Bacteria 9786
286 Ga0207668_10460664 3300025972 Bacteria 1087
287 Ga0207668_10614727 3300025972 Bacteria 948
288 Ga0207640_10067218 3300025981 Bacteria 2397
289 Ga0207640_10227542 3300025981 Bacteria 1432
290 Ga0207640_10397591 3300025981 Bacteria 1121
291 Ga0207658_10067166 3300025986 Bacteria 2700
292 Ga0207658_10227874 3300025986 Bacteria 1571
293 Ga0207658_11841423 3300025986 Bacteria 552
294 Ga0207677_10328649 3300026023 Bacteria 1273
295 Ga0207677_10491837 3300026023 Bacteria 1059
296 Ga0207677_10621355 3300026023 Bacteria 950
297 Ga0207703_10075600 3300026035 Bacteria 2792
298 Ga0207703_10159169 3300026035 Bacteria 1976
299 Ga0207703_11113226 3300026035 Bacteria 759
300 Ga0207703_11738390 3300026035 Bacteria 600
301 Ga0207639_10012400 3300026041 Bacteria 5934
302 Ga0207639_10132595 3300026041 Bacteria 2065
303 Ga0207678_10004254 3300026067 Bacteria 12835
304 Ga0207678_10011384 3300026067 Bacteria 7807
305 Ga0207678_10604975 3300026067 Bacteria 961
306 Ga0207678_10643860 3300026067 Bacteria 931
307 Ga0207678_10839966 3300026067 Bacteria 811
308 Ga0207708_10006309 3300026075 Bacteria 8789
309 Ga0207702_10007075 3300026078 Bacteria 9597
310 Ga0207702_10516996 3300026078 Bacteria 1165
311 Ga0207702_11250876 3300026078 Unclassified 736
312 Ga0207641_10563807 3300026088 Bacteria 1112
313 Ga0207641_11489800 3300026088 Bacteria 678
314 Ga0207648_10011201 3300026089 Bacteria 8455
315 Ga0207648_10653440 3300026089 Bacteria 972
316 Ga0207676_11475829 3300026095 Bacteria 677
317 Ga0207674_10000251 3300026116 Bacteria 66996
318 Ga0207674_10314059 3300026116 Bacteria 1516
319 Ga0207674_10599495 3300026116 Bacteria 1064
320 Ga0207675_100010339 3300026118 Bacteria 8745
321 Ga0207675_100469195 3300026118 Bacteria 1249
322 Ga0207675_101349580 3300026118 Bacteria 734
323 Ga0207683_10434885 3300026121 Bacteria 1209
324 Ga0207683_10656541 3300026121 Bacteria 972
325 Ga0207698_10068386 3300026142 Bacteria 2804
326 Ga0207698_10195119 3300026142 Bacteria 1808
327 Ga0207698_10209742 3300026142 Bacteria 1752
328 Ga0209971_1039403 3300027682 Bacteria 1138
329 Ga0209966_1010430 3300027695 Bacteria 1675
330 Ga0209998_10085910 3300027717 Bacteria 767
331 Ga0268266_10052746 3300028379 Bacteria 3493
332 Ga0268266_10481806 3300028379 Bacteria 1183
333 Ga0268266_10507812 3300028379 Bacteria 1152
334 Ga0268265_10000291 3300028380 Bacteria 56604
335 Ga0268265_10522708 3300028380 Bacteria 1122
336 Ga0268265_10689427 3300028380 Bacteria 986
337 Ga0268264_10005401 3300028381 Bacteria 10823
338 Ga0268264_10388337 3300028381 Bacteria 1338
339 Ga0268264_10529826 3300028381 Bacteria 1153
340 Ga0307408_101212266 3300031548 Bacteria 704
341 Ga0307405_11879462 3300031731 Bacteria 534
342 Ga0307407_10560613 3300031903 Bacteria 846
343 Ga0307409_101561740 3300031995 Bacteria 688
344 Ga0307416_100012292 3300032002 Bacteria 5760
345 Ga0307416_100844311 3300032002 Bacteria 1014
346 Ga0307416_102718420 3300032002 Bacteria 591
347 Ga0307416_103179502 3300032002 Bacteria 549
348 Ga0307411_10763327 3300032005 Bacteria 848
349 Ga0307415_100023641 3300032126 Bacteria 3820
350 Ga0373930_0008971 3300034816 Bacteria 1760
351 Ga0373948_0023623 3300034817 Bacteria 1194
352 Ga0373928_0005437 3300035084 Bacteria 2436
353 Ga0373929_0004743 3300035085 Bacteria 2437
354 Ga0373934_0249697 3300035086 Bacteria 733
355 Ga0373940_0004866 3300035088 Bacteria 2867
356 Ga0373949_0008294 3300035090 Bacteria 2275
357 Ga0373951_0032877 3300035091 Bacteria 1228
358 Ga0373932_0001687 3300035112 Bacteria 6016
359 Ga0373939_0000922 3300035114 Bacteria 7298
360 Ga0373941_0000933 3300035115 Bacteria 6034
361 Ga0373953_0043175 3300035117 Bacteria 1799
362 Ga0373954_0027058 3300035118 Bacteria 2630
363 Ga0373956_0114304 3300035119 Bacteria 1258
364 Ga0373955_0180276 3300035172 Bacteria 1253
365 Ga0373962_0003112 3300035242 Bacteria 3974
366 Ga0373931_0000344 3300035691 Bacteria 19127
367 Ga0373933_0068256 3300035724 Bacteria 2159
368 Ga0373937_0009190 3300036401 Bacteria 8580
369 Ga0373925_0192333 3300037068 Bacteria 1619
370 Ga0395899_0102890 3300037312 Bacteria 2060
371 Ga0395900_0008836 3300037418 Bacteria 10348
372 Ga0395900_0148643 3300037418 Bacteria 2395
373 Ga0395900_0384718 3300037418 Bacteria 1370
374 Ga0395898_0020070 3300037466 Bacteria 6791
375 Ga0395898_0412455 3300037466 Bacteria 1287
376 Ga0395905_0399306 3300037471 Bacteria 1270
377 Ga0395901_0013535 3300038443 Bacteria 8296
378 Ga0451800_0017687 3300041459 Bacteria 610
379 Ga0451833_0590600 3300041491 Bacteria 658
380 Ga0451853_0476034 3300041512 Bacteria 556
381 Ga0451853_2948516 3300041512 Bacteria 591
382 Ga0439449_0057240 3300042007 Bacteria 1439
383 Ga0450921_005103 3300042123 Bacteria 983
384 Ga0451577_0198323 3300042876 Bacteria 1812
385 Ga0466963_0147916 3300044694 Bacteria 1631
386 Ga0466964_0523096 3300044706 Bacteria 640
387 Ga0466957_0521857 3300044842 Bacteria 825
388 Ga0451576_0027587 3300045051 Bacteria 6096
389 Ga0466958_0370109 3300045836 Bacteria 923
390 Ga0495592_0020432 3300046454 Bacteria 5036
391 Ga0495651_0006031 3300046462 Bacteria 9252
392 Ga0495653_0176848 3300046463 Bacteria 1468
393 Ga0495608_0119649 3300046511 Bacteria 1689
394 Ga0495628_0079641 3300046516 Bacteria 2547
395 Ga0495652_0008742 3300046529 Bacteria 9219
396 Ga0495640_0277998 3300046533 Bacteria 1043
397 Ga0495587_0002777 3300046536 Bacteria 11689
398 Ga0495667_0029932 3300046559 Bacteria 3662
399 Ga0495635_1059976 3300046663 Bacteria 514
400 Ga0495657_0035784 3300046675 Bacteria 3438
401 Ga0495599_0005909 3300046678 Bacteria 7356
402 Ga0495623_0007781 3300046679 Bacteria 6966
403 Ga0495646_0148824 3300046680 Bacteria 1304
404 Ga0495604_0008315 3300047317 Bacteria 8206
405 Ga0495680_0093764 3300047322 Bacteria 2247
406 Ga0495675_0015410 3300047444 Bacteria 4835
407 Ga0495602_0034886 3300048088 Bacteria 4697
408 Ga0496100_0169290 3300048903 Bacteria 1572
409 Ga0496100_0952945 3300048903 Bacteria 675
410 Ga0496102_0112568 3300048905 Bacteria 2539
411 Ga0496102_0501069 3300048905 Bacteria 1136
412 Ga0496102_0520546 3300048905 Bacteria 1112
413 Ga0496102_1750836 3300048905 Bacteria 539
414 Ga0496103_0003025 3300048906 Bacteria 10357
415 Ga0496103_0540004 3300048906 Bacteria 745
416 Ga0496104_0735200 3300048907 Unclassified 894
417 Ga0496106_0015222 3300048909 Bacteria 5692
418 Ga0496106_0090086 3300048909 Bacteria 2367
419 Ga0496106_0431642 3300048909 Bacteria 1059
420 Ga0496106_1389997 3300048909 Bacteria 543
421 Ga0496107_0021433 3300048910 Bacteria 4567
422 Ga0496108_0135605 3300048911 Bacteria 2118
423 Ga0496108_0589047 3300048911 Bacteria 969
424 Ga0496108_1545724 3300048911 Bacteria 551
425 Ga0496109_0746266 3300048912 Bacteria 917
426 Ga0496109_0947074 3300048912 Bacteria 799
427 Ga0496111_0547043 3300048914 Bacteria 850
428 Ga0496112_0884234 3300048915 Bacteria 816
429 Ga0496112_0943992 3300048915 Bacteria 784
430 Ga0496114_0248261 3300048917 Bacteria 1566
431 Ga0496115_0039507 3300048918 Bacteria 3748
432 Ga0501036_0201429 3300049572 Bacteria 1674
433 Ga0501036_1014269 3300049572 Bacteria 679
434 Ga0501040_0068260 3300049576 Bacteria 2452
435 Ga0501043_0389105 3300049579 Bacteria 1055
436 Ga0501047_0025007 3300049581 Bacteria 5736
437 Ga0501047_0859495 3300049581 Bacteria 721
438 Ga0501048_0308681 3300049582 Bacteria 1126
439 Ga0501071_0525392 3300049587 Bacteria 908
440 Ga0501072_0243866 3300049588 Bacteria 1431
441 Ga0501074_0654559 3300049590 Bacteria 742
442 Ga0501075_0013470 3300049591 Bacteria 5836
443 Ga0501076_0021916 3300049592 Bacteria 4906
444 Ga0501236_112788 3300049670 Bacteria 545
445 Ga0501081_0134753 3300049743 Bacteria 1767
446 Ga0501083_0729326 3300049744 Bacteria 645
447 Ga0501283_053057 3300049779 Bacteria 721
448 Ga0501044_0168518 3300049823 Bacteria 2163
449 Ga0501045_0032604 3300049824 Bacteria 3776
450 nmdc:mga03n38_806249_c1 3300050490 Bacteria 547
451 nmdc:mga00v17_818084_c1 3300050491 Bacteria 593
452 nmdc:mga0yw44_301242_c1 3300050492 Bacteria 1074
453 nmdc:mga0k408_42546_c1 3300050493 Bacteria 2616
454 nmdc:mga06z11_146038_c1 3300050494 Bacteria 1341
455 nmdc:mga06z11_70385_c1 3300050494 Bacteria 1849
456 nmdc:mga07m45_554088_c1 3300050496 Bacteria 665
457 nmdc:mga05p37_1219095_c1 3300050507 Bacteria 775
458 nmdc:mga0qj67_151587_c1 3300050509 Bacteria 1881
459 nmdc:mga0qj67_49109_c1 3300050509 Bacteria 3335
460 nmdc:mga06r32_326437_c1 3300050510 Bacteria 1520
461 nmdc:mga08y16_1470445_c1 3300050511 Bacteria 643
462 nmdc:mga08y16_301535_c1 3300050511 Bacteria 1651
463 nmdc:mga0n895_2102802_c1 3300050512 Bacteria 521
464 nmdc:mga0sz30_143305_c1 3300050516 Bacteria 1055
465 Ga0495601_0084264 3300053077 Bacteria 2042
466 Ga0495619_0089480 3300053085 Bacteria 2083
467 Ga0501082_0502572 3300060353 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_101358624 Ga0070662_1013586241 97
2 3300005719 Ga0068861_100299708 Ga0068861_1002997082 97
3 3300025901 Ga0207688_10764732 Ga0207688_107647321 97
4 3300025933 Ga0207706_10040247 Ga0207706_100402472 97
5 3300026118 Ga0207675_100469195 Ga0207675_1004691952 97
6 3300046463 Ga0495653_0176848 Ga0495653_0176848_1142_1435 97
7 3300027682 Ga0209971_1039403 Ga0209971_10394032 103
8 3300027695 Ga0209966_1010430 Ga0209966_10104302 103
9 3300049572 Ga0501036_1014269 Ga0501036_1014269_303_647 103
10 3300026041 Ga0207639_10132595 Ga0207639_101325952 104
11 3300037418 Ga0395900_0384718 Ga0395900_0384718_655_999 104
12 3300037466 Ga0395898_0020070 Ga0395898_0020070_548_892 104
13 3300038443 Ga0395901_0013535 Ga0395901_0013535_1107_1451 104
14 3300005295 Ga0065707_10147027 Ga0065707_101470272 105
15 3300005328 Ga0070676_10085636 Ga0070676_100856362 105
16 3300005328 Ga0070676_10568101 Ga0070676_105681012 105
17 3300005330 Ga0070690_100010474 Ga0070690_1000104748 105
18 3300005334 Ga0068869_100660960 Ga0068869_1006609602 105
19 3300005335 Ga0070666_10025010 Ga0070666_100250103 105
20 3300005336 Ga0070680_100014420 Ga0070680_1000144207 105
21 3300005336 Ga0070680_100150011 Ga0070680_1001500112 105
22 3300005337 Ga0070682_100067246 Ga0070682_1000672462 105
23 3300005338 Ga0068868_100530189 Ga0068868_1005301892 105
24 3300005338 Ga0068868_101830663 Ga0068868_1018306631 105
25 3300005340 Ga0070689_100284651 Ga0070689_1002846512 105
26 3300005343 Ga0070687_100016154 Ga0070687_1000161542 105
27 3300005343 Ga0070687_100204002 Ga0070687_1002040022 105
28 3300005345 Ga0070692_10007879 Ga0070692_100078792 105
29 3300005345 Ga0070692_10187435 Ga0070692_101874352 105
30 3300005345 Ga0070692_11031448 Ga0070692_110314482 105
31 3300005347 Ga0070668_100119736 Ga0070668_1001197362 105
32 3300005353 Ga0070669_100007367 Ga0070669_1000073672 105
33 3300005353 Ga0070669_100021059 Ga0070669_1000210599 105
34 3300005354 Ga0070675_100010896 Ga0070675_1000108969 105
35 3300005355 Ga0070671_100215278 Ga0070671_1002152782 105
36 3300005356 Ga0070674_100835352 Ga0070674_1008353522 105
37 3300005356 Ga0070674_102134359 Ga0070674_1021343591 105
38 3300005364 Ga0070673_100050649 Ga0070673_1000506492 105
39 3300005365 Ga0070688_100024071 Ga0070688_1000240712 105
40 3300005367 Ga0070667_101025107 Ga0070667_1010251072 105
41 3300005406 Ga0070703_10178768 Ga0070703_101787682 105
42 3300005441 Ga0070700_100001753 Ga0070700_10000175312 105
43 3300005441 Ga0070700_100588129 Ga0070700_1005881292 105
44 3300005444 Ga0070694_101028356 Ga0070694_1010283562 105
45 3300005455 Ga0070663_100056190 Ga0070663_1000561902 105
46 3300005456 Ga0070678_100227662 Ga0070678_1002276622 105
47 3300005456 Ga0070678_100868910 Ga0070678_1008689102 105
48 3300005458 Ga0070681_10006828 Ga0070681_100068287 105
49 3300005459 Ga0068867_100001755 Ga0068867_1000017559 105
50 3300005459 Ga0068867_100808459 Ga0068867_1008084592 105
51 3300005466 Ga0070685_10334377 Ga0070685_103343772 105
52 3300005530 Ga0070679_100028734 Ga0070679_1000287342 105
53 3300005543 Ga0070672_100018691 Ga0070672_1000186912 105
54 3300005544 Ga0070686_100596766 Ga0070686_1005967662 105
55 3300005544 Ga0070686_101378760 Ga0070686_1013787601 105
56 3300005545 Ga0070695_100583481 Ga0070695_1005834811 105
57 3300005548 Ga0070665_100063019 Ga0070665_1000630192 105
58 3300005549 Ga0070704_100642975 Ga0070704_1006429752 105
59 3300005563 Ga0068855_100074798 Ga0068855_1000747982 105
60 3300005563 Ga0068855_100444615 Ga0068855_1004446152 105
61 3300005616 Ga0068852_100375379 Ga0068852_1003753791 105
62 3300005617 Ga0068859_100351101 Ga0068859_1003511012 105
63 3300005617 Ga0068859_102804066 Ga0068859_1028040661 105
64 3300005618 Ga0068864_101074540 Ga0068864_1010745402 105
65 3300005718 Ga0068866_10152414 Ga0068866_101524142 105
66 3300005719 Ga0068861_100001610 Ga0068861_1000016108 105
67 3300005719 Ga0068861_100014724 Ga0068861_1000147243 105
68 3300005719 Ga0068861_100536626 Ga0068861_1005366262 105
69 3300005834 Ga0068851_10216247 Ga0068851_102162472 105
70 3300005840 Ga0068870_10012679 Ga0068870_100126794 105
71 3300005840 Ga0068870_10284481 Ga0068870_102844812 105
72 3300005841 Ga0068863_100485776 Ga0068863_1004857762 105
73 3300005843 Ga0068860_100060858 Ga0068860_1000608585 105
74 3300005843 Ga0068860_100281638 Ga0068860_1002816382 105
75 3300005844 Ga0068862_100005068 Ga0068862_10000506813 105
76 3300005844 Ga0068862_100487484 Ga0068862_1004874842 105
77 3300005844 Ga0068862_100974044 Ga0068862_1009740441 105
78 3300005844 Ga0068862_102458499 Ga0068862_1024584992 105
79 3300006038 Ga0075365_10022211 Ga0075365_100222112 105
80 3300006051 Ga0075364_10815369 Ga0075364_108153692 105
81 3300006178 Ga0075367_10008005 Ga0075367_100080052 105
82 3300006195 Ga0075366_10351781 Ga0075366_103517812 105
83 3300006237 Ga0097621_100423485 Ga0097621_1004234852 105
84 3300006353 Ga0075370_10260130 Ga0075370_102601302 105
85 3300006358 Ga0068871_102419998 Ga0068871_1024199981 105
86 3300006844 Ga0075428_101436415 Ga0075428_1014364151 105
87 3300006847 Ga0075431_100811435 Ga0075431_1008114352 105
88 3300006880 Ga0075429_100126670 Ga0075429_1001266702 105
89 3300006881 Ga0068865_100004826 Ga0068865_10000482610 105
90 3300006881 Ga0068865_102048635 Ga0068865_1020486352 105
91 3300006931 Ga0097620_100351121 Ga0097620_1003511212 105
92 3300006931 Ga0097620_102804085 Ga0097620_1028040851 105
93 3300009093 Ga0105240_10154816 Ga0105240_101548162 105
94 3300009094 Ga0111539_10435108 Ga0111539_104351082 105
95 3300009098 Ga0105245_10284401 Ga0105245_102844012 105
96 3300009148 Ga0105243_10003862 Ga0105243_1000386213 105
97 3300009174 Ga0105241_11631367 Ga0105241_116313672 105
98 3300009176 Ga0105242_12476425 Ga0105242_124764251 105
99 3300009177 Ga0105248_10002755 Ga0105248_1000275519 105
100 3300009553 Ga0105249_10008393 Ga0105249_100083932 105
101 3300009553 Ga0105249_10918461 Ga0105249_109184612 105
102 3300013296 Ga0157374_10872402 Ga0157374_108724022 105
103 3300013297 Ga0157378_11553815 Ga0157378_115538152 105
104 3300013307 Ga0157372_11805883 Ga0157372_118058831 105
105 3300013308 Ga0157375_10336122 Ga0157375_103361222 105
106 3300013308 Ga0157375_11049202 Ga0157375_110492022 105
107 3300014326 Ga0157380_10004661 Ga0157380_100046613 105
108 3300014326 Ga0157380_10059377 Ga0157380_100593771 105
109 3300014326 Ga0157380_11415837 Ga0157380_114158372 105
110 3300014745 Ga0157377_10113500 Ga0157377_101135001 105
111 3300014968 Ga0157379_10143491 Ga0157379_101434912 105
112 3300014969 Ga0157376_10387064 Ga0157376_103870642 105
113 3300017792 Ga0163161_10469657 Ga0163161_104696572 105
114 3300025893 Ga0207682_10047333 Ga0207682_100473332 105
115 3300025899 Ga0207642_10018896 Ga0207642_100188962 105
116 3300025903 Ga0207680_10022011 Ga0207680_100220111 105
117 3300025903 Ga0207680_10454008 Ga0207680_104540082 105
118 3300025907 Ga0207645_10338398 Ga0207645_103383982 105
119 3300025907 Ga0207645_10503230 Ga0207645_105032301 105
120 3300025908 Ga0207643_10063349 Ga0207643_100633492 105
121 3300025911 Ga0207654_10297623 Ga0207654_102976232 105
122 3300025912 Ga0207707_10000582 Ga0207707_1000058219 105
123 3300025913 Ga0207695_10713543 Ga0207695_107135432 105
124 3300025917 Ga0207660_10012873 Ga0207660_100128732 105
125 3300025917 Ga0207660_10033504 Ga0207660_100335042 105
126 3300025917 Ga0207660_10730628 Ga0207660_107306281 105
127 3300025918 Ga0207662_10027658 Ga0207662_100276582 105
128 3300025921 Ga0207652_10004959 Ga0207652_1000495911 105
129 3300025923 Ga0207681_10002070 Ga0207681_100020707 105
130 3300025923 Ga0207681_10043653 Ga0207681_100436532 105
131 3300025925 Ga0207650_10513320 Ga0207650_105133202 105
132 3300025926 Ga0207659_10014621 Ga0207659_100146212 105
133 3300025931 Ga0207644_10007077 Ga0207644_100070778 105
134 3300025935 Ga0207709_10002476 Ga0207709_100024763 105
135 3300025936 Ga0207670_10436218 Ga0207670_104362182 105
136 3300025937 Ga0207669_10220223 Ga0207669_102202232 105
137 3300025937 Ga0207669_11738430 Ga0207669_117384301 105
138 3300025938 Ga0207704_10021013 Ga0207704_100210133 105
139 3300025940 Ga0207691_10030728 Ga0207691_100307282 105
140 3300025940 Ga0207691_11501650 Ga0207691_115016501 105
141 3300025941 Ga0207711_10029358 Ga0207711_100293582 105
142 3300025942 Ga0207689_10168247 Ga0207689_101682472 105
143 3300025942 Ga0207689_10728454 Ga0207689_107284542 105
144 3300025949 Ga0207667_10328663 Ga0207667_103286632 105
145 3300025960 Ga0207651_10050020 Ga0207651_100500202 105
146 3300025960 Ga0207651_10110517 Ga0207651_101105172 105
147 3300025961 Ga0207712_10002513 Ga0207712_1000251315 105
148 3300025972 Ga0207668_10003072 Ga0207668_1000307213 105
149 3300025972 Ga0207668_10460664 Ga0207668_104606642 105
150 3300025981 Ga0207640_10067218 Ga0207640_100672182 105
151 3300025981 Ga0207640_10397591 Ga0207640_103975911 105
152 3300025986 Ga0207658_10067166 Ga0207658_100671663 105
153 3300026023 Ga0207677_10328649 Ga0207677_103286491 105
154 3300026023 Ga0207677_10491837 Ga0207677_104918372 105
155 3300026023 Ga0207677_10621355 Ga0207677_106213552 105
156 3300026035 Ga0207703_10159169 Ga0207703_101591692 105
157 3300026067 Ga0207678_10604975 Ga0207678_106049752 105
158 3300026075 Ga0207708_10006309 Ga0207708_1000630911 105
159 3300026088 Ga0207641_10563807 Ga0207641_105638072 105
160 3300026088 Ga0207641_11489800 Ga0207641_114898001 105
161 3300026089 Ga0207648_10011201 Ga0207648_1001120111 105
162 3300026089 Ga0207648_10653440 Ga0207648_106534402 105
163 3300026095 Ga0207676_11475829 Ga0207676_114758291 105
164 3300026116 Ga0207674_10599495 Ga0207674_105994952 105
165 3300026118 Ga0207675_100010339 Ga0207675_10001033911 105
166 3300026118 Ga0207675_101349580 Ga0207675_1013495802 105
167 3300026121 Ga0207683_10434885 Ga0207683_104348852 105
168 3300026142 Ga0207698_10195119 Ga0207698_101951192 105
169 3300027717 Ga0209998_10085910 Ga0209998_100859101 105
170 3300028379 Ga0268266_10052746 Ga0268266_100527462 105
171 3300028379 Ga0268266_10481806 Ga0268266_104818062 105
172 3300028380 Ga0268265_10000291 Ga0268265_1000029156 105
173 3300028380 Ga0268265_10522708 Ga0268265_105227082 105
174 3300028380 Ga0268265_10689427 Ga0268265_106894272 105
175 3300028381 Ga0268264_10005401 Ga0268264_100054014 105
176 3300028381 Ga0268264_10529826 Ga0268264_105298262 105
177 3300031548 Ga0307408_101212266 Ga0307408_1012122662 105
178 3300031731 Ga0307405_11879462 Ga0307405_118794622 105
179 3300031995 Ga0307409_101561740 Ga0307409_1015617402 105
180 3300032002 Ga0307416_100012292 Ga0307416_1000122926 105
181 3300032002 Ga0307416_100844311 Ga0307416_1008443112 105
182 3300032002 Ga0307416_102718420 Ga0307416_1027184202 105
183 3300032002 Ga0307416_103179502 Ga0307416_1031795022 105
184 3300032005 Ga0307411_10763327 Ga0307411_107633272 105
185 3300032126 Ga0307415_100023641 Ga0307415_1000236413 105
186 3300034816 Ga0373930_0008971 Ga0373930_0008971_729_1073 105
187 3300034817 Ga0373948_0023623 Ga0373948_0023623_784_1128 105
188 3300035084 Ga0373928_0005437 Ga0373928_0005437_149_493 105
189 3300035085 Ga0373929_0004743 Ga0373929_0004743_1310_1654 105
190 3300035088 Ga0373940_0004866 Ga0373940_0004866_2286_2630 105
191 3300035090 Ga0373949_0008294 Ga0373949_0008294_439_783 105
192 3300035091 Ga0373951_0032877 Ga0373951_0032877_638_982 105
193 3300035112 Ga0373932_0001687 Ga0373932_0001687_678_1022 105
194 3300035114 Ga0373939_0000922 Ga0373939_0000922_1647_1991 105
195 3300035115 Ga0373941_0000933 Ga0373941_0000933_2263_2607 105
196 3300035242 Ga0373962_0003112 Ga0373962_0003112_1366_1710 105
197 3300035691 Ga0373931_0000344 Ga0373931_0000344_6932_7276 105
198 3300037068 Ga0373925_0192333 Ga0373925_0192333_426_770 105
199 3300042123 Ga0450921_005103 Ga0450921_005103_529_873 105
200 3300045051 Ga0451576_0027587 Ga0451576_0027587_5032_5376 105
201 3300045836 Ga0466958_0370109 Ga0466958_0370109_535_882 105
202 3300048903 Ga0496100_0952945 Ga0496100_0952945_13_357 105
203 3300048905 Ga0496102_0112568 Ga0496102_0112568_858_1202 105
204 3300048905 Ga0496102_0520546 Ga0496102_0520546_530_877 105
205 3300048906 Ga0496103_0540004 Ga0496103_0540004_117_464 105
206 3300048909 Ga0496106_0090086 Ga0496106_0090086_1995_2342 105
207 3300048911 Ga0496108_0589047 Ga0496108_0589047_314_661 105
208 3300048912 Ga0496109_0746266 Ga0496109_0746266_441_788 105
209 3300048914 Ga0496111_0547043 Ga0496111_0547043_221_568 105
210 3300049587 Ga0501071_0525392 Ga0501071_0525392_125_472 105
211 3300049779 Ga0501283_053057 Ga0501283_053057_34_378 105
212 3300050492 nmdc:mga0yw44_301242_c1 nmdc:mga0yw44_301242_c1_289_633 105
213 3300050494 nmdc:mga06z11_70385_c1 nmdc:mga06z11_70385_c1_1461_1805 105
214 3300050507 nmdc:mga05p37_1219095_c1 nmdc:mga05p37_1219095_c1_271_615 105
215 3300050509 nmdc:mga0qj67_151587_c1 nmdc:mga0qj67_151587_c1_298_642 105
216 3300050510 nmdc:mga06r32_326437_c1 nmdc:mga06r32_326437_c1_485_829 105
217 3300050511 nmdc:mga08y16_1470445_c1 nmdc:mga08y16_1470445_c1_38_382 105
218 3300049670 Ga0501236_112788 Ga0501236_112788_58_402 106
219 3300005364 Ga0070673_101226158 Ga0070673_1012261581 108
220 3300005367 Ga0070667_100130344 Ga0070667_1001303442 108
221 3300005842 Ga0068858_101869927 Ga0068858_1018699272 108
222 3300025960 Ga0207651_11069904 Ga0207651_110699042 108
223 3300025986 Ga0207658_10227874 Ga0207658_102278742 108
224 3300026035 Ga0207703_11738390 Ga0207703_117383901 108
225 3300031903 Ga0307407_10560613 Ga0307407_105606132 108
226 iso_pu_bacteria 2738541281 2738745994 108
227 iso_pu_bacteria 2738543032 2739355224 108
228 iso_pu_bacteria 2643221614 2644085821 109
229 iso_pu_bacteria 2643221661 2644345003 109
230 iso_pu_bacteria 2643221666 2644369277 109
231 iso_pu_bacteria 2844002411 2844004671 109
232 iso_pu_bacteria 2856334872 2856336014 109
233 iso_pu_bacteria 2857367948 2857369078 109
234 iso_pu_bacteria 2878781027 2878782261 109
235 iso_pu_bacteria 2922151315 2922152015 109
236 iso_pu_bacteria 2958122699 2958129316 109
237 iso_pu_bacteria 2965032056 2965038820 109
238 iso_pu_bacteria 2965110997 2965112047 109
239 iso_pu_bacteria 2977872689 2977878477 109
240 iso_pu_bacteria 2977957713 2977959125 109
241 iso_pu_bacteria 2987673487 2987675752 109
242 iso_pu_bacteria 3004239961 3004244547 109
243 iso_pu_bacteria 8004695233 8004695776 109
244 iso_pu_bacteria 2516143018 2516205324 110
245 iso_pu_bacteria 2690316117 2692314428 110
246 iso_pu_bacteria 2751185821 2753461013 110
247 iso_pu_bacteria 2791355091 2792624350 110
248 iso_pu_bacteria 2791355092 2792625648 110
249 iso_pu_bacteria 2791355094 2792643724 110
250 iso_pu_bacteria 2847417321 2847420520 110
251 iso_pu_bacteria 2848992105 2848995392 110
252 iso_pu_bacteria 2855872281 2855878353 110
253 iso_pu_bacteria 643692032 643827158 110
254 3300005548 Ga0070665_101161726 Ga0070665_1011617262 111
255 3300006177 Ga0075362_10098821 Ga0075362_100988212 111
256 3300006178 Ga0075367_10015269 Ga0075367_100152692 111
257 3300006195 Ga0075366_10019210 Ga0075366_100192102 111
258 3300006353 Ga0075370_10137065 Ga0075370_101370652 111
259 3300026067 Ga0207678_10839966 Ga0207678_108399662 111
260 3300028379 Ga0268266_10507812 Ga0268266_105078122 111
261 3300050490 nmdc:mga03n38_806249_c1 nmdc:mga03n38_806249_c1_61_399 111
262 3300050491 nmdc:mga00v17_818084_c1 nmdc:mga00v17_818084_c1_171_509 111
263 3300050493 nmdc:mga0k408_42546_c1 nmdc:mga0k408_42546_c1_902_1237 111
264 3300050494 nmdc:mga06z11_146038_c1 nmdc:mga06z11_146038_c1_963_1298 111
265 3300050496 nmdc:mga07m45_554088_c1 nmdc:mga07m45_554088_c1_280_618 111
266 3300050516 nmdc:mga0sz30_143305_c1 nmdc:mga0sz30_143305_c1_141_476 111
267 3300048909 Ga0496106_0431642 Ga0496106_0431642_48_386 112
268 3300048911 Ga0496108_0135605 Ga0496108_0135605_168_506 112
269 3300048915 Ga0496112_0943992 Ga0496112_0943992_161_499 112
270 3300005331 Ga0070670_100530285 Ga0070670_1005302852 113
271 3300005436 Ga0070713_101499363 Ga0070713_1014993632 113
272 3300005564 Ga0070664_101148197 Ga0070664_1011481972 113
273 3300012485 Ga0157325_1014661 Ga0157325_10146612 113
274 3300025908 Ga0207643_10510622 Ga0207643_105106221 113
275 3300025912 Ga0207707_10212866 Ga0207707_102128662 113
276 3300025925 Ga0207650_10467897 Ga0207650_104678972 113
277 3300025928 Ga0207700_11575107 Ga0207700_115751071 113
278 3300025972 Ga0207668_10614727 Ga0207668_106147272 113
279 3300035086 Ga0373934_0249697 Ga0373934_0249697_351_695 113
280 3300035117 Ga0373953_0043175 Ga0373953_0043175_141_485 113
281 3300035118 Ga0373954_0027058 Ga0373954_0027058_537_881 113
282 3300035119 Ga0373956_0114304 Ga0373956_0114304_754_1098 113
283 3300035172 Ga0373955_0180276 Ga0373955_0180276_141_485 113
284 3300035724 Ga0373933_0068256 Ga0373933_0068256_45_389 113
285 3300036401 Ga0373937_0009190 Ga0373937_0009190_2039_2383 113
286 3300041512 Ga0451853_0476034 Ga0451853_0476034_100_444 113
287 3300046454 Ga0495592_0020432 Ga0495592_0020432_3065_3409 113
288 3300046462 Ga0495651_0006031 Ga0495651_0006031_4149_4493 113
289 3300046511 Ga0495608_0119649 Ga0495608_0119649_1249_1593 113
290 3300046516 Ga0495628_0079641 Ga0495628_0079641_188_532 113
291 3300046529 Ga0495652_0008742 Ga0495652_0008742_5481_5825 113
292 3300046533 Ga0495640_0277998 Ga0495640_0277998_297_641 113
293 3300046536 Ga0495587_0002777 Ga0495587_0002777_6020_6364 113
294 3300046559 Ga0495667_0029932 Ga0495667_0029932_1672_2016 113
295 3300046663 Ga0495635_1059976 Ga0495635_1059976_44_388 113
296 3300046675 Ga0495657_0035784 Ga0495657_0035784_1265_1609 113
297 3300046678 Ga0495599_0005909 Ga0495599_0005909_3195_3539 113
298 3300046679 Ga0495623_0007781 Ga0495623_0007781_2197_2541 113
299 3300046680 Ga0495646_0148824 Ga0495646_0148824_701_1045 113
300 3300047317 Ga0495604_0008315 Ga0495604_0008315_4062_4406 113
301 3300047322 Ga0495680_0093764 Ga0495680_0093764_1695_2039 113
302 3300047444 Ga0495675_0015410 Ga0495675_0015410_2416_2760 113
303 3300048088 Ga0495602_0034886 Ga0495602_0034886_448_792 113
304 3300049572 Ga0501036_0201429 Ga0501036_0201429_510_851 113
305 3300049576 Ga0501040_0068260 Ga0501040_0068260_563_904 113
306 3300049579 Ga0501043_0389105 Ga0501043_0389105_470_811 113
307 3300049581 Ga0501047_0025007 Ga0501047_0025007_118_459 113
308 3300049582 Ga0501048_0308681 Ga0501048_0308681_37_378 113
309 3300049590 Ga0501074_0654559 Ga0501074_0654559_186_527 113
310 3300049591 Ga0501075_0013470 Ga0501075_0013470_4836_5177 113
311 3300049592 Ga0501076_0021916 Ga0501076_0021916_2474_2815 113
312 3300049743 Ga0501081_0134753 Ga0501081_0134753_515_856 113
313 3300049744 Ga0501083_0729326 Ga0501083_0729326_156_497 113
314 3300049824 Ga0501045_0032604 Ga0501045_0032604_2878_3219 113
315 3300053077 Ga0495601_0084264 Ga0495601_0084264_87_431 113
316 3300053085 Ga0495619_0089480 Ga0495619_0089480_1452_1796 113
317 3300003322 rootL2_10203169 rootL2_102031692 114
318 3300005327 Ga0070658_10009913 Ga0070658_100099132 114
319 3300005327 Ga0070658_10060929 Ga0070658_100609292 114
320 3300005327 Ga0070658_10420986 Ga0070658_104209862 114
321 3300005329 Ga0070683_100008005 Ga0070683_1000080053 114
322 3300005331 Ga0070670_100777314 Ga0070670_1007773142 114
323 3300005334 Ga0068869_100813139 Ga0068869_1008131392 114
324 3300005336 Ga0070680_100082068 Ga0070680_1000820682 114
325 3300005336 Ga0070680_100184071 Ga0070680_1001840712 114
326 3300005337 Ga0070682_100010286 Ga0070682_1000102862 114
327 3300005337 Ga0070682_100095987 Ga0070682_1000959871 114
328 3300005339 Ga0070660_100019751 Ga0070660_1000197512 114
329 3300005339 Ga0070660_100069718 Ga0070660_1000697182 114
330 3300005339 Ga0070660_100302192 Ga0070660_1003021922 114
331 3300005341 Ga0070691_10020419 Ga0070691_100204192 114
332 3300005341 Ga0070691_10339626 Ga0070691_103396261 114
333 3300005344 Ga0070661_100006965 Ga0070661_1000069652 114
334 3300005344 Ga0070661_100087159 Ga0070661_1000871592 114
335 3300005344 Ga0070661_100199711 Ga0070661_1001997112 114
336 3300005344 Ga0070661_100643809 Ga0070661_1006438092 114
337 3300005345 Ga0070692_10170060 Ga0070692_101700602 114
338 3300005354 Ga0070675_100536351 Ga0070675_1005363512 114
339 3300005366 Ga0070659_100000693 Ga0070659_10000069315 114
340 3300005366 Ga0070659_101242215 Ga0070659_1012422152 114
341 3300005367 Ga0070667_101957469 Ga0070667_1019574691 114
342 3300005435 Ga0070714_100020726 Ga0070714_1000207263 114
343 3300005439 Ga0070711_100130172 Ga0070711_1001301722 114
344 3300005444 Ga0070694_100402188 Ga0070694_1004021881 114
345 3300005455 Ga0070663_100011149 Ga0070663_1000111492 114
346 3300005455 Ga0070663_100012452 Ga0070663_1000124522 114
347 3300005457 Ga0070662_100184692 Ga0070662_1001846922 114
348 3300005457 Ga0070662_100265886 Ga0070662_1002658862 114
349 3300005458 Ga0070681_10017527 Ga0070681_100175279 114
350 3300005458 Ga0070681_10241619 Ga0070681_102416192 114
351 3300005459 Ga0068867_100844762 Ga0068867_1008447622 114
352 3300005530 Ga0070679_100075251 Ga0070679_1000752512 114
353 3300005530 Ga0070679_100449638 Ga0070679_1004496382 114
354 3300005535 Ga0070684_100188684 Ga0070684_1001886842 114
355 3300005539 Ga0068853_100003131 Ga0068853_1000031317 114
356 3300005539 Ga0068853_100118457 Ga0068853_1001184571 114
357 3300005539 Ga0068853_100642387 Ga0068853_1006423872 114
358 3300005545 Ga0070695_100332525 Ga0070695_1003325251 114
359 3300005546 Ga0070696_100098675 Ga0070696_1000986752 114
360 3300005547 Ga0070693_100030007 Ga0070693_1000300073 114
361 3300005563 Ga0068855_100063785 Ga0068855_1000637855 114
362 3300005564 Ga0070664_100005054 Ga0070664_1000050546 114
363 3300005564 Ga0070664_100014100 Ga0070664_1000141005 114
364 3300005564 Ga0070664_100218943 Ga0070664_1002189432 114
365 3300005564 Ga0070664_100996115 Ga0070664_1009961152 114
366 3300005564 Ga0070664_101742698 Ga0070664_1017426982 114
367 3300005577 Ga0068857_100015019 Ga0068857_1000150194 114
368 3300005577 Ga0068857_100747171 Ga0068857_1007471712 114
369 3300005578 Ga0068854_100029205 Ga0068854_1000292052 114
370 3300005614 Ga0068856_100197532 Ga0068856_1001975322 114
371 3300005614 Ga0068856_100502063 Ga0068856_1005020632 114
372 3300005614 Ga0068856_101443519 Ga0068856_1014435192 114
373 3300005615 Ga0070702_100489888 Ga0070702_1004898882 114
374 3300005616 Ga0068852_100320082 Ga0068852_1003200822 114
375 3300005616 Ga0068852_100363817 Ga0068852_1003638172 114
376 3300005617 Ga0068859_100210991 Ga0068859_1002109912 114
377 3300005834 Ga0068851_10002036 Ga0068851_100020369 114
378 3300005834 Ga0068851_10270964 Ga0068851_102709642 114
379 3300005840 Ga0068870_10995457 Ga0068870_109954571 114
380 3300006237 Ga0097621_101561744 Ga0097621_1015617442 114
381 3300006358 Ga0068871_100549003 Ga0068871_1005490032 114
382 3300006871 Ga0075434_100547899 Ga0075434_1005478992 114
383 3300006881 Ga0068865_100316804 Ga0068865_1003168042 114
384 3300006931 Ga0097620_100210985 Ga0097620_1002109852 114
385 3300009147 Ga0114129_11497195 Ga0114129_114971952 114
386 3300009174 Ga0105241_10003941 Ga0105241_100039417 114
387 3300009174 Ga0105241_10004527 Ga0105241_100045273 114
388 3300009176 Ga0105242_10581301 Ga0105242_105813012 114
389 3300009177 Ga0105248_11869018 Ga0105248_118690182 114
390 3300009545 Ga0105237_10026508 Ga0105237_100265087 114
391 3300009545 Ga0105237_10617846 Ga0105237_106178461 114
392 3300009551 Ga0105238_10113821 Ga0105238_101138212 114
393 3300010375 Ga0105239_11818878 Ga0105239_118188782 114
394 3300013100 Ga0157373_10003131 Ga0157373_100031312 114
395 3300013100 Ga0157373_10832597 Ga0157373_108325971 114
396 3300013102 Ga0157371_10032993 Ga0157371_100329932 114
397 3300013102 Ga0157371_11297227 Ga0157371_112972272 114
398 3300013104 Ga0157370_10468512 Ga0157370_104685122 114
399 3300013104 Ga0157370_10824077 Ga0157370_108240772 114
400 3300013105 Ga0157369_12146314 Ga0157369_121463142 114
401 3300013297 Ga0157378_10415706 Ga0157378_104157062 114
402 3300013297 Ga0157378_11413854 Ga0157378_114138542 114
403 3300013297 Ga0157378_11917807 Ga0157378_119178072 114
404 3300013307 Ga0157372_10296762 Ga0157372_102967622 114
405 3300013307 Ga0157372_10516559 Ga0157372_105165592 114
406 3300014968 Ga0157379_10035523 Ga0157379_100355232 114
407 3300014968 Ga0157379_10413666 Ga0157379_104136662 114
408 3300014969 Ga0157376_10918724 Ga0157376_109187242 114
409 3300014969 Ga0157376_12927572 Ga0157376_129275721 114
410 3300020070 Ga0206356_10640862 Ga0206356_106408622 114
411 3300025321 Ga0207656_10020950 Ga0207656_100209502 114
412 3300025904 Ga0207647_10116267 Ga0207647_101162672 114
413 3300025907 Ga0207645_10989280 Ga0207645_109892802 114
414 3300025908 Ga0207643_10304098 Ga0207643_103040982 114
415 3300025909 Ga0207705_10018450 Ga0207705_100184502 114
416 3300025911 Ga0207654_10048136 Ga0207654_100481362 114
417 3300025912 Ga0207707_10106258 Ga0207707_101062583 114
418 3300025913 Ga0207695_10129333 Ga0207695_101293332 114
419 3300025914 Ga0207671_10058206 Ga0207671_100582063 114
420 3300025914 Ga0207671_10274369 Ga0207671_102743692 114
421 3300025916 Ga0207663_10219548 Ga0207663_102195482 114
422 3300025917 Ga0207660_10070599 Ga0207660_100705992 114
423 3300025917 Ga0207660_10122834 Ga0207660_101228342 114
424 3300025919 Ga0207657_10000302 Ga0207657_1000030222 114
425 3300025919 Ga0207657_10902777 Ga0207657_109027772 114
426 3300025920 Ga0207649_10057670 Ga0207649_100576702 114
427 3300025921 Ga0207652_10010922 Ga0207652_100109223 114
428 3300025921 Ga0207652_10424002 Ga0207652_104240022 114
429 3300025924 Ga0207694_10027148 Ga0207694_100271482 114
430 3300025925 Ga0207650_10291983 Ga0207650_102919832 114
431 3300025926 Ga0207659_11483765 Ga0207659_114837652 114
432 3300025929 Ga0207664_10272430 Ga0207664_102724302 114
433 3300025929 Ga0207664_11522102 Ga0207664_115221022 114
434 3300025932 Ga0207690_10071890 Ga0207690_100718902 114
435 3300025933 Ga0207706_10178192 Ga0207706_101781922 114
436 3300025933 Ga0207706_10425564 Ga0207706_104255642 114
437 3300025934 Ga0207686_11000011 Ga0207686_110000112 114
438 3300025935 Ga0207709_10051400 Ga0207709_100514002 114
439 3300025944 Ga0207661_10077775 Ga0207661_100777752 114
440 3300025945 Ga0207679_10350683 Ga0207679_103506831 114
441 3300025945 Ga0207679_10369263 Ga0207679_103692632 114
442 3300025945 Ga0207679_10535105 Ga0207679_105351052 114
443 3300025945 Ga0207679_11275729 Ga0207679_112757292 114
444 3300025949 Ga0207667_10001606 Ga0207667_1000160628 114
445 3300025949 Ga0207667_10107421 Ga0207667_101074212 114
446 3300025981 Ga0207640_10227542 Ga0207640_102275422 114
447 3300025986 Ga0207658_11841423 Ga0207658_118414232 114
448 3300026035 Ga0207703_10075600 Ga0207703_100756003 114
449 3300026035 Ga0207703_11113226 Ga0207703_111132262 114
450 3300026041 Ga0207639_10012400 Ga0207639_100124004 114
451 3300026067 Ga0207678_10004254 Ga0207678_100042547 114
452 3300026067 Ga0207678_10011384 Ga0207678_100113842 114
453 3300026067 Ga0207678_10643860 Ga0207678_106438601 114
454 3300026078 Ga0207702_10007075 Ga0207702_100070757 114
455 3300026078 Ga0207702_10516996 Ga0207702_105169962 114
456 3300026078 Ga0207702_11250876 Ga0207702_112508762 114
457 3300026116 Ga0207674_10000251 Ga0207674_1000025140 114
458 3300026116 Ga0207674_10314059 Ga0207674_103140591 114
459 3300026121 Ga0207683_10656541 Ga0207683_106565411 114
460 3300026142 Ga0207698_10068386 Ga0207698_100683862 114
461 3300026142 Ga0207698_10209742 Ga0207698_102097422 114
462 3300028381 Ga0268264_10388337 Ga0268264_103883372 114
463 3300037312 Ga0395899_0102890 Ga0395899_0102890_1636_1980 114
464 3300037418 Ga0395900_0008836 Ga0395900_0008836_9181_9525 114
465 3300037418 Ga0395900_0148643 Ga0395900_0148643_1727_2074 114
466 3300037466 Ga0395898_0412455 Ga0395898_0412455_789_1133 114
467 3300037471 Ga0395905_0399306 Ga0395905_0399306_160_507 114
468 3300041459 Ga0451800_0017687 Ga0451800_0017687_95_442 114
469 3300041491 Ga0451833_0590600 Ga0451833_0590600_47_394 114
470 3300041512 Ga0451853_2948516 Ga0451853_2948516_231_578 114
471 3300042007 Ga0439449_0057240 Ga0439449_0057240_1065_1415 114
472 3300042876 Ga0451577_0198323 Ga0451577_0198323_1175_1522 114
473 3300044694 Ga0466963_0147916 Ga0466963_0147916_626_973 114
474 3300044706 Ga0466964_0523096 Ga0466964_0523096_50_397 114
475 3300044842 Ga0466957_0521857 Ga0466957_0521857_170_517 114
476 3300048903 Ga0496100_0169290 Ga0496100_0169290_202_546 114
477 3300048905 Ga0496102_0501069 Ga0496102_0501069_101_445 114
478 3300048905 Ga0496102_1750836 Ga0496102_1750836_173_520 114
479 3300048906 Ga0496103_0003025 Ga0496103_0003025_3329_3673 114
480 3300048907 Ga0496104_0735200 Ga0496104_0735200_535_879 114
481 3300048909 Ga0496106_0015222 Ga0496106_0015222_3514_3858 114
482 3300048909 Ga0496106_1389997 Ga0496106_1389997_11_358 114
483 3300048910 Ga0496107_0021433 Ga0496107_0021433_2894_3238 114
484 3300048911 Ga0496108_1545724 Ga0496108_1545724_52_396 114
485 3300048912 Ga0496109_0947074 Ga0496109_0947074_65_409 114
486 3300048915 Ga0496112_0884234 Ga0496112_0884234_414_761 114
487 3300048917 Ga0496114_0248261 Ga0496114_0248261_451_795 114
488 3300048918 Ga0496115_0039507 Ga0496115_0039507_3109_3453 114
489 3300049581 Ga0501047_0859495 Ga0501047_0859495_12_356 114
490 3300049588 Ga0501072_0243866 Ga0501072_0243866_183_527 114
491 3300049823 Ga0501044_0168518 Ga0501044_0168518_948_1292 114
492 3300050509 nmdc:mga0qj67_49109_c1 nmdc:mga0qj67_49109_c1_998_1342 114
493 3300050511 nmdc:mga08y16_301535_c1 nmdc:mga08y16_301535_c1_552_899 114
494 3300050512 nmdc:mga0n895_2102802_c1 nmdc:mga0n895_2102802_c1_51_398 114
495 3300060353 Ga0501082_0502572 Ga0501082_0502572_571_915 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

5

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nyu-assembly1.cif.gz_K respiratory complex i from escherichia coli - conformation 2 0.5608 7 99
7bv1-assembly1.cif.gz_A cryo-em structure of the apo nsp12-nsp7-nsp8 complex 0.5398 2 56
2nr5-assembly1.cif.gz_C crystal structure of protein of unknown function so2669 from shewanella oneidensis mr-1 0.5311 2 54
7d3u-assembly1.cif.gz_C structure of mrp complex from dietzia sp. dq12-45-1b 0.5227 4 98
8gwe-assembly1.cif.gz_A sars-cov-2 e-rtc complex with rna-nsp9 and gmppnp 0.4982 3 71
ID Description Score Start End Superfamily
af_A0A0P0X9L3_107_499_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9324 5 50 1.10.3860.10
af_H0WEV0_822_1008_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.891 1 48 1.25.40.10
af_Q19153_735_929_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.8677 2 43 1.20.1640.10
af_I1JYC9_28_130_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.827 12 52 1.20.930.10
af_I1KB67_1_98_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.821 13 53 1.20.930.10
ID Description Score Start End GO Terms
AF-A0A512CS11-F1-model_v4 deleted 0.9557 1 51
AF-A0A1H0BM56-F1-model_v4 DUF3239 domain-containing protein 0.848 3 55 GO:0016020
AF-A0A2H0ERF4-F1-model_v4 Na+/H+ antiporter subunit C 0.8309 1 61 GO:0016020
AF-A0A2H0ERF4-F1-model_v4 Na+/H+ antiporter subunit C 0.8185 1 61 GO:0016020
AF-Q8NT24-F1-model_v4 Hypothetical membrane protein 0.8153 5 57 GO:0016020

Feature Viewer

pLDDT pTM Quality
74.77 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map