metagRoot

F454674

General Info

Members	Datasets	Scaffolds	Average Seq Length
495	246	495	382

Family's Representative Sequence

Representative Sequence	3300005329\|Ga0070683_100000759\|Ga0070683_10000075919
Length	436
Sequence	MQACENQVYGTIRRLRAARLSPPWLKSGALSRKFWSMGRGMKSMKFGALAAASLLLLAACGTSGTSNGTARPTTQQPPTANMKPQTTIGAGEGQLNLILWDGYADKSWVDPFTQATGCKVNQHPAGSSDEMVSLMKNGGGGQWDMVSASGDADLRLIYGGDVKPMNVSLIPDWQNFQTYFQNPPFNTINGVHYGVSLQWGPNTLLYNTKVFPNKPTSWSVIYDSAYKGRITVPDNPIQIADAALYLSKSQPSLGIKDPYELTQPQFDAAVNLLKQQQPLIKHYWSLATDEISLFQNGDAVVGASWPYQTITLKAAGAPADDTIPQEGATGWADTWMLATKAPHPNCAYLWAKWVSTPQVQAEQALSFGETPVNSKACAVMETLQAGSCAKYHADQTSSAYFSTIAFWKTPLATCDDGTNNCVPYAQWVAAWTTIKG

Samples

	Sample ID	Description	Type	Environment
1	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
2	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
3	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
4	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
5	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
6	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
7	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
8	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
9	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
10	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
11	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
12	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
13	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
14	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
15	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
16	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
17	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
18	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
19	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
20	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
21	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
22	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
23	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
24	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
25	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
26	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
27	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
28	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
29	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
30	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
31	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
32	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
33	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
34	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
35	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
36	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
37	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
38	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
39	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
40	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
41	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
42	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
43	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
44	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
45	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
46	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
47	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
48	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
49	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
50	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
51	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
54	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
55	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
56	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
57	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
58	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
59	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
60	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
61	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
62	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
64	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
69	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
70	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
71	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
72	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
73	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
74	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
75	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
76	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
77	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
78	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
79	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
80	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
81	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
82	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
83	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
84	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
85	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
86	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
130	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
132	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
133	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
134	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
135	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
136	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
137	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
138	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
139	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
140	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
141	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
142	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
143	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
144	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
145	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
146	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
147	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
148	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
149	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
150	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
151	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
152	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
153	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
154	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
155	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
156	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
157	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
158	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
159	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
160	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
161	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
162	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
163	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
164	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
165	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
166	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
167	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
168	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
169	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
170	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
171	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
172	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
173	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
174	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
175	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
176	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
177	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
178	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
179	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
180	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
181	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
182	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
183	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
184	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
185	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
186	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
187	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
188	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
189	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
190	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
191	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
192	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
193	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
194	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
195	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
196	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
197	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
198	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
199	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
200	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
201	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
202	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
203	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
204	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
205	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
206	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
207	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
208	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
209	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
210	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
211	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
212	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
213	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
214	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
215	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
216	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
217	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
218	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
219	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
220	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
221	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
222	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
223	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
224	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
225	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
226	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
227	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
228	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
229	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
230	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
231	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
232	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
233	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
234	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
235	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
238	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
239	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
240	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
241	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
242	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
243	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
244	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
245	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
246	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.8
Metatranscriptomes	0.2
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.4
Nodule	0
Rhizoplane	3.84
Rhizosphere	95.56
Stem	0
Stem Tuber	0
Unclassified	0.2

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070658_10116650	3300005327	Bacteria	2216
2	Ga0070683_100000759	3300005329	Bacteria	23645
3	Ga0070683_100021989	3300005329	Bacteria	5694
4	Ga0068869_100040059	3300005334	Bacteria	3348
5	Ga0070680_100027117	3300005336	Bacteria	4587
6	Ga0070680_100051226	3300005336	Bacteria	3368
7	Ga0070660_100033824	3300005339	Bacteria	3856
8	Ga0070689_100053962	3300005340	Bacteria	3111
9	Ga0070661_100059848	3300005344	Bacteria	2794
10	Ga0070692_10054660	3300005345	Bacteria	2085
11	Ga0070692_10126295	3300005345	Bacteria	1432
12	Ga0070675_100144816	3300005354	Bacteria	2033
13	Ga0070671_100065383	3300005355	Bacteria	3029
14	Ga0070674_100090824	3300005356	Bacteria	2204
15	Ga0070659_100019583	3300005366	Bacteria	5131
16	Ga0070659_100129274	3300005366	Bacteria	2050
17	Ga0070703_10035945	3300005406	Bacteria	1519
18	Ga0070714_100029653	3300005435	Bacteria	4548
19	Ga0070714_100031732	3300005435	Bacteria	4409
20	Ga0070714_100041152	3300005435	Bacteria	3898
21	Ga0070714_100096798	3300005435	Bacteria	2593
22	Ga0070714_100143961	3300005435	Bacteria	2142
23	Ga0070714_100268050	3300005435	Bacteria	1583
24	Ga0070713_100003035	3300005436	Bacteria	11032
25	Ga0070713_100014232	3300005436	Bacteria	5898
26	Ga0070713_100032696	3300005436	Bacteria	4158
27	Ga0070713_100044725	3300005436	Bacteria	3625
28	Ga0070713_100110805	3300005436	Bacteria	2393
29	Ga0070710_10000208	3300005437	Bacteria	27566
30	Ga0070710_10000538	3300005437	Bacteria	17939
31	Ga0070710_10027221	3300005437	Bacteria	3046
32	Ga0070710_10067421	3300005437	Bacteria	2053
33	Ga0070701_10004123	3300005438	Bacteria	5837
34	Ga0070711_100000269	3300005439	Bacteria	26809
35	Ga0070711_100068324	3300005439	Bacteria	2497
36	Ga0070694_100036114	3300005444	Bacteria	3271
37	Ga0070694_100058944	3300005444	Bacteria	2613
38	Ga0070708_100000037	3300005445	Bacteria	85774
39	Ga0070708_100004321	3300005445	Bacteria	11162
40	Ga0070708_100010970	3300005445	Bacteria	7362
41	Ga0070708_100017018	3300005445	Bacteria	6051
42	Ga0070708_100098364	3300005445	Bacteria	2675
43	Ga0070708_100221648	3300005445	Bacteria	1774
44	Ga0070678_100027277	3300005456	Bacteria	3877
45	Ga0070678_100035586	3300005456	Bacteria	3478
46	Ga0070662_100050393	3300005457	Bacteria	3003
47	Ga0070662_100052972	3300005457	Bacteria	2936
48	Ga0070706_100000073	3300005467	Bacteria	115960
49	Ga0070706_100000687	3300005467	Bacteria	38295
50	Ga0070706_100000752	3300005467	Bacteria	36298
51	Ga0070706_100001541	3300005467	Bacteria	24114
52	Ga0070706_100006185	3300005467	Bacteria	11329
53	Ga0070706_100031772	3300005467	Bacteria	4867
54	Ga0070706_100044336	3300005467	Bacteria	4109
55	Ga0070706_100050587	3300005467	Bacteria	3834
56	Ga0070706_100136820	3300005467	Bacteria	2286
57	Ga0070707_100000040	3300005468	Bacteria	111897
58	Ga0070707_100000293	3300005468	Bacteria	49051
59	Ga0070707_100004651	3300005468	Bacteria	12847
60	Ga0070707_100008457	3300005468	Bacteria	9559
61	Ga0070707_100027783	3300005468	Bacteria	5383
62	Ga0070707_100044488	3300005468	Bacteria	4251
63	Ga0070707_100050479	3300005468	Bacteria	3987
64	Ga0070707_100072150	3300005468	Bacteria	3327
65	Ga0070707_100089112	3300005468	Bacteria	2985
66	Ga0070707_100133298	3300005468	Bacteria	2416
67	Ga0070698_100000106	3300005471	Bacteria	69519
68	Ga0070698_100000862	3300005471	Bacteria	33342
69	Ga0070698_100005994	3300005471	Bacteria	13251
70	Ga0070698_100024582	3300005471	Bacteria	6285
71	Ga0070698_100130500	3300005471	Bacteria	2469
72	Ga0070698_100229100	3300005471	Bacteria	1791
73	Ga0070699_100000071	3300005518	Bacteria	96895
74	Ga0070699_100000120	3300005518	Bacteria	72063
75	Ga0070699_100020242	3300005518	Bacteria	5736
76	Ga0070699_100080034	3300005518	Bacteria	2847
77	Ga0070679_100151124	3300005530	Bacteria	2298
78	Ga0070684_100014981	3300005535	Bacteria	6296
79	Ga0070684_100017975	3300005535	Bacteria	5813
80	Ga0070697_100002322	3300005536	Bacteria	14620
81	Ga0070697_100004782	3300005536	Bacteria	10382
82	Ga0070697_100049996	3300005536	Bacteria	3393
83	Ga0070697_100061646	3300005536	Bacteria	3059
84	Ga0070697_100071148	3300005536	Bacteria	2852
85	Ga0070697_100081857	3300005536	Bacteria	2660
86	Ga0068853_100092211	3300005539	Bacteria	2664
87	Ga0070672_100049046	3300005543	Bacteria	3283
88	Ga0070686_100016734	3300005544	Bacteria	4270
89	Ga0070686_100058859	3300005544	Bacteria	2473
90	Ga0070695_100002484	3300005545	Bacteria	10612
91	Ga0070695_100057290	3300005545	Bacteria	2517
92	Ga0070696_100121037	3300005546	Bacteria	1894
93	Ga0070693_100087813	3300005547	Bacteria	1868
94	Ga0070693_100141609	3300005547	Bacteria	1514
95	Ga0070704_100002317	3300005549	Bacteria	10659
96	Ga0070704_100022153	3300005549	Bacteria	4131
97	Ga0070704_100032098	3300005549	Bacteria	3538
98	Ga0070704_100098855	3300005549	Bacteria	2193
99	Ga0068855_100171672	3300005563	Bacteria	2455
100	Ga0068855_100205242	3300005563	Bacteria	2217
101	Ga0070664_100021631	3300005564	Bacteria	5303
102	Ga0070664_100054562	3300005564	Bacteria	3390
103	Ga0068857_100000846	3300005577	Bacteria	22932
104	Ga0068854_100034668	3300005578	Bacteria	3527
105	Ga0068854_100064556	3300005578	Bacteria	2660
106	Ga0068856_100003521	3300005614	Bacteria	15794
107	Ga0068856_100057176	3300005614	Bacteria	3850
108	Ga0070702_100017792	3300005615	Bacteria	3673
109	Ga0070702_100039688	3300005615	Bacteria	2628
110	Ga0068859_100076245	3300005617	Bacteria	3393
111	Ga0068864_100241051	3300005618	Bacteria	1675
112	Ga0068861_100126606	3300005719	Bacteria	2067
113	Ga0068851_10070864	3300005834	Bacteria	1803
114	Ga0068863_100294461	3300005841	Bacteria	1573
115	Ga0068860_100049011	3300005843	Bacteria	4026
116	Ga0068860_100346396	3300005843	Bacteria	1461
117	Ga0081455_10005512	3300005937	Bacteria	13870
118	Ga0081455_10020435	3300005937	Bacteria	6234
119	Ga0081540_1001377	3300005983	Bacteria	21068
120	Ga0081540_1002348	3300005983	Bacteria	15492
121	Ga0081540_1027076	3300005983	Bacteria	3256
122	Ga0081540_1077990	3300005983	Bacteria	1504
123	Ga0070717_10000009	3300006028	Bacteria	297183
124	Ga0070717_10002005	3300006028	Bacteria	14237
125	Ga0070717_10005588	3300006028	Bacteria	9177
126	Ga0070717_10026163	3300006028	Bacteria	4652
127	Ga0070717_10127288	3300006028	Bacteria	2187
128	Ga0070717_10178928	3300006028	Bacteria	1847
129	Ga0075365_10030433	3300006038	Bacteria	3457
130	Ga0075432_10029848	3300006058	Bacteria	1883
131	Ga0070715_10033654	3300006163	Bacteria	2096
132	Ga0070716_100000693	3300006173	Bacteria	14353
133	Ga0070716_100043677	3300006173	Bacteria	2507
134	Ga0070712_100041550	3300006175	Bacteria	3157
135	Ga0070712_100150245	3300006175	Bacteria	1788
136	Ga0075431_100180072	3300006847	Bacteria	2169
137	Ga0075433_10010923	3300006852	Bacteria	7307
138	Ga0075434_100132680	3300006871	Bacteria	2510
139	Ga0068865_100049006	3300006881	Bacteria	2909
140	Ga0075436_100007268	3300006914	Bacteria	7575
141	Ga0075436_100058132	3300006914	Bacteria	2671
142	Ga0097620_100076245	3300006931	Bacteria	3393
143	Ga0075435_100073329	3300007076	Bacteria	2798
144	Ga0075435_100076707	3300007076	Bacteria	2739
145	Ga0105244_10074979	3300009036	Bacteria	1682
146	Ga0111539_10150476	3300009094	Bacteria	2724
147	Ga0105245_10015728	3300009098	Bacteria	6599
148	Ga0105245_10016172	3300009098	Bacteria	6502
149	Ga0105245_10038537	3300009098	Bacteria	4253
150	Ga0114129_10062499	3300009147	Bacteria	5201
151	Ga0114129_10276776	3300009147	Bacteria	2243
152	Ga0105243_10015286	3300009148	Bacteria	5807
153	Ga0105243_10049192	3300009148	Bacteria	3325
154	Ga0105243_10059277	3300009148	Bacteria	3054
155	Ga0105241_10075988	3300009174	Bacteria	2618
156	Ga0105242_10060398	3300009176	Bacteria	3115
157	Ga0105249_10070665	3300009553	Bacteria	3223
158	Ga0105249_10080730	3300009553	Bacteria	3022
159	Ga0105249_10083366	3300009553	Bacteria	2976
160	Ga0105249_10095587	3300009553	Bacteria	2786
161	Ga0105239_10137882	3300010375	Bacteria	2716
162	Ga0105239_10372093	3300010375	Bacteria	1615
163	Ga0105246_10058504	3300011119	Bacteria	2670
164	Ga0157373_10040894	3300013100	Bacteria	3317
165	Ga0157371_10008996	3300013102	Bacteria	7898
166	Ga0157371_10046440	3300013102	Bacteria	3089
167	Ga0157369_10219981	3300013105	Bacteria	1988
168	Ga0157378_10036474	3300013297	Bacteria	4351
169	Ga0157378_10234453	3300013297	Bacteria	1750
170	Ga0163162_10296038	3300013306	Bacteria	1750
171	Ga0163162_10420144	3300013306	Bacteria	1469
172	Ga0157372_10366722	3300013307	Bacteria	1678
173	Ga0157375_10011528	3300013308	Bacteria	7806
174	Ga0157375_10301809	3300013308	Bacteria	1765
175	Ga0163163_10130303	3300014325	Bacteria	2555
176	Ga0157377_10092128	3300014745	Bacteria	1791
177	Ga0157376_10186969	3300014969	Bacteria	1897
178	Ga0224712_10038730	3300022467	Bacteria	1783
179	Ga0224572_1002095	3300024225	Bacteria	3146
180	Ga0207692_10083837	3300025898	Bacteria	1711
181	Ga0207642_10039777	3300025899	Bacteria	2046
182	Ga0207710_10016238	3300025900	Bacteria	3149
183	Ga0207688_10085291	3300025901	Bacteria	1808
184	Ga0207647_10066845	3300025904	Bacteria	2179
185	Ga0207699_10000697	3300025906	Bacteria	16037
186	Ga0207699_10000794	3300025906	Bacteria	15073
187	Ga0207699_10016962	3300025906	Bacteria	3821
188	Ga0207645_10017703	3300025907	Bacteria	4697
189	Ga0207645_10116321	3300025907	Bacteria	1734
190	Ga0207643_10023428	3300025908	Bacteria	3403
191	Ga0207684_10000003	3300025910	Bacteria	766933
192	Ga0207684_10000151	3300025910	Bacteria	121836
193	Ga0207684_10000156	3300025910	Bacteria	115974
194	Ga0207684_10000571	3300025910	Bacteria	44831
195	Ga0207684_10008878	3300025910	Bacteria	8925
196	Ga0207684_10010114	3300025910	Bacteria	8309
197	Ga0207684_10011586	3300025910	Bacteria	7706
198	Ga0207684_10015395	3300025910	Bacteria	6584
199	Ga0207684_10060549	3300025910	Bacteria	3215
200	Ga0207684_10073625	3300025910	Bacteria	2901
201	Ga0207684_10103070	3300025910	Bacteria	2440
202	Ga0207684_10132506	3300025910	Bacteria	2139
203	Ga0207684_10145231	3300025910	Bacteria	2040
204	Ga0207707_10151885	3300025912	Bacteria	2024
205	Ga0207695_10249397	3300025913	Bacteria	1675
206	Ga0207693_10006607	3300025915	Bacteria	9584
207	Ga0207693_10016039	3300025915	Bacteria	5997
208	Ga0207693_10036660	3300025915	Bacteria	3866
209	Ga0207693_10069220	3300025915	Bacteria	2762
210	Ga0207663_10023417	3300025916	Bacteria	3543
211	Ga0207663_10035476	3300025916	Bacteria	2992
212	Ga0207663_10043979	3300025916	Bacteria	2738
213	Ga0207663_10065297	3300025916	Bacteria	2326
214	Ga0207663_10155160	3300025916	Bacteria	1610
215	Ga0207662_10006227	3300025918	Bacteria	6423
216	Ga0207657_10008369	3300025919	Bacteria	10503
217	Ga0207657_10038704	3300025919	Bacteria	4242
218	Ga0207649_10034192	3300025920	Bacteria	3043
219	Ga0207652_10132202	3300025921	Bacteria	2226
220	Ga0207646_10000050	3300025922	Bacteria	171554
221	Ga0207646_10000079	3300025922	Bacteria	129281
222	Ga0207646_10000100	3300025922	Bacteria	115974
223	Ga0207646_10000567	3300025922	Bacteria	48701
224	Ga0207646_10000779	3300025922	Bacteria	41345
225	Ga0207646_10001122	3300025922	Bacteria	34163
226	Ga0207646_10003432	3300025922	Bacteria	17896
227	Ga0207646_10004842	3300025922	Bacteria	14422
228	Ga0207646_10005615	3300025922	Bacteria	13174
229	Ga0207646_10006252	3300025922	Bacteria	12361
230	Ga0207646_10008547	3300025922	Bacteria	10241
231	Ga0207646_10036749	3300025922	Bacteria	4420
232	Ga0207646_10040994	3300025922	Bacteria	4163
233	Ga0207646_10064972	3300025922	Unclassified	3257
234	Ga0207646_10076120	3300025922	Bacteria	2998
235	Ga0207646_10208374	3300025922	Bacteria	1765
236	Ga0207687_10014982	3300025927	Bacteria	5078
237	Ga0207687_10047083	3300025927	Bacteria	2988
238	Ga0207687_10076960	3300025927	Bacteria	2398
239	Ga0207700_10001411	3300025928	Bacteria	13629
240	Ga0207700_10002103	3300025928	Bacteria	11371
241	Ga0207700_10011053	3300025928	Bacteria	5737
242	Ga0207700_10011816	3300025928	Bacteria	5590
243	Ga0207700_10022957	3300025928	Bacteria	4290
244	Ga0207700_10049186	3300025928	Bacteria	3135
245	Ga0207700_10068186	3300025928	Bacteria	2726
246	Ga0207664_10000630	3300025929	Bacteria	24451
247	Ga0207664_10002379	3300025929	Bacteria	12437
248	Ga0207664_10005268	3300025929	Bacteria	8833
249	Ga0207664_10022598	3300025929	Bacteria	4700
250	Ga0207664_10033767	3300025929	Bacteria	3935
251	Ga0207664_10100928	3300025929	Bacteria	2383
252	Ga0207664_10137152	3300025929	Bacteria	2065
253	Ga0207664_10160121	3300025929	Bacteria	1919
254	Ga0207644_10141420	3300025931	Bacteria	1853
255	Ga0207690_10135306	3300025932	Bacteria	1809
256	Ga0207706_10014738	3300025933	Bacteria	7079
257	Ga0207706_10025704	3300025933	Bacteria	5274
258	Ga0207665_10000208	3300025939	Bacteria	39520
259	Ga0207665_10011853	3300025939	Bacteria	5724
260	Ga0207665_10052844	3300025939	Bacteria	2738
261	Ga0207691_10018919	3300025940	Bacteria	6525
262	Ga0207711_10069385	3300025941	Bacteria	3055
263	Ga0207689_10005874	3300025942	Bacteria	10872
264	Ga0207661_10000303	3300025944	Bacteria	31267
265	Ga0207661_10131236	3300025944	Bacteria	2146
266	Ga0207712_10088443	3300025961	Bacteria	2274
267	Ga0207712_10186215	3300025961	Bacteria	1635
268	Ga0207677_10158325	3300026023	Bacteria	1756
269	Ga0207639_10085774	3300026041	Bacteria	2505
270	Ga0207678_10002379	3300026067	Bacteria	17073
271	Ga0207708_10014079	3300026075	Bacteria	5977
272	Ga0207702_10001525	3300026078	Bacteria	22924
273	Ga0207702_10019851	3300026078	Bacteria	5566
274	Ga0207648_10027555	3300026089	Bacteria	5044
275	Ga0207648_10078227	3300026089	Bacteria	2885
276	Ga0207676_10028982	3300026095	Bacteria	4140
277	Ga0207674_10000808	3300026116	Bacteria	40727
278	Ga0207674_10015408	3300026116	Bacteria	8398
279	Ga0207675_100027279	3300026118	Bacteria	5319
280	Ga0207683_10005348	3300026121	Bacteria	11014
281	Ga0207683_10103560	3300026121	Bacteria	2543
282	Ga0207698_10123735	3300026142	Bacteria	2195
283	Ga0207698_10242361	3300026142	Bacteria	1644
284	Ga0209588_1005004	3300027671	Bacteria	3772
285	Ga0209966_1005553	3300027695	Bacteria	2166
286	Ga0207428_10008677	3300027907	Bacteria	9180
287	Ga0268264_10047044	3300028381	Bacteria	3586
288	Ga0268264_10099516	3300028381	Bacteria	2523
289	Ga0265326_10000647	3300028558	Bacteria	12921
290	Ga0265319_1000995	3300028563	Bacteria	17753
291	Ga0265319_1002387	3300028563	Bacteria	10311
292	Ga0265338_10003311	3300028800	Bacteria	22817
293	Ga0265338_10004893	3300028800	Bacteria	17839
294	Ga0265324_10026239	3300029957	Bacteria	2063
295	Ga0265332_10007984	3300031238	Bacteria	4769
296	Ga0265320_10002585	3300031240	Bacteria	12570
297	Ga0265320_10071989	3300031240	Bacteria	1627
298	Ga0265325_10000193	3300031241	Bacteria	43575
299	Ga0265325_10015308	3300031241	Bacteria	4315
300	Ga0265340_10000075	3300031247	Bacteria	47375
301	Ga0265339_10004226	3300031249	Bacteria	9840
302	Ga0265316_10079037	3300031344	Bacteria	2524
303	Ga0265316_10148424	3300031344	Bacteria	1757
304	Ga0265314_10006144	3300031711	Bacteria	10673
305	Ga0265342_10002252	3300031712	Bacteria	16856
306	Ga0307405_10003471	3300031731	Bacteria	7244
307	Ga0307413_10131778	3300031824	Bacteria	1712
308	Ga0307410_10001420	3300031852	Bacteria	10773
309	Ga0307407_10012021	3300031903	Bacteria	4147
310	Ga0307412_10010533	3300031911	Bacteria	5326
311	Ga0307414_10003638	3300032004	Bacteria	8257
312	Ga0307415_100034954	3300032126	Bacteria	3277
313	Ga0373958_0015096	3300034819	Bacteria	1359
314	Ga0373926_0000152	3300035083	Bacteria	15163
315	Ga0373926_0012267	3300035083	Bacteria	2896
316	Ga0373934_0001204	3300035086	Bacteria	9384
317	Ga0373934_0009761	3300035086	Bacteria	3600
318	Ga0373934_0086786	3300035086	Bacteria	1259
319	Ga0373940_0010378	3300035088	Bacteria	2187
320	Ga0373944_0003287	3300035089	Bacteria	4162
321	Ga0373932_0035682	3300035112	Bacteria	1407
322	Ga0373936_0002891	3300035113	Bacteria	6412
323	Ga0373936_0005940	3300035113	Bacteria	4595
324	Ga0373936_0006901	3300035113	Bacteria	4273
325	Ga0373936_0007178	3300035113	Bacteria	4195
326	Ga0373945_0065884	3300035116	Bacteria	1361
327	Ga0373953_0003957	3300035117	Bacteria	4670
328	Ga0373953_0019435	3300035117	Bacteria	2527
329	Ga0373954_0012627	3300035118	Bacteria	3757
330	Ga0373956_0007605	3300035119	Bacteria	4365
331	Ga0373956_0048049	3300035119	Bacteria	1910
332	Ga0373956_0129453	3300035119	Bacteria	1181
333	Ga0373957_0009643	3300035120	Bacteria	3164
334	Ga0373957_0060896	3300035120	Bacteria	1462
335	Ga0373946_0018748	3300035171	Bacteria	2659
336	Ga0373946_0041590	3300035171	Bacteria	1886
337	Ga0373955_0007545	3300035172	Bacteria	5003
338	Ga0373942_0013453	3300035207	Bacteria	1968
339	Ga0373961_0050024	3300035241	Bacteria	1237
340	Ga0373924_0004110	3300035410	Bacteria	5063
341	Ga0373935_0007028	3300035692	Bacteria	6719
342	Ga0373935_0020476	3300035692	Bacteria	4043
343	Ga0373927_0019163	3300035695	Bacteria	4488
344	Ga0373933_0022132	3300035724	Bacteria	3617
345	Ga0373933_0025863	3300035724	Bacteria	3367
346	Ga0373933_0026872	3300035724	Bacteria	3309
347	Ga0373933_0120532	3300035724	Bacteria	1642
348	Ga0373947_0000586	3300035725	Bacteria	21404
349	Ga0373947_0004026	3300035725	Bacteria	8636
350	Ga0373937_0052562	3300036401	Bacteria	3735
351	Ga0373937_0064452	3300036401	Bacteria	3370
352	Ga0373937_0254169	3300036401	Bacteria	1656
353	Ga0373925_0006822	3300037068	Bacteria	8362
354	Ga0373925_0046430	3300037068	Bacteria	3229
355	Ga0395900_0026113	3300037418	Bacteria	5980
356	Ga0395900_0036720	3300037418	Bacteria	5051
357	Ga0395900_0108400	3300037418	Bacteria	2853
358	Ga0395900_0138278	3300037418	Bacteria	2495
359	Ga0395900_0373204	3300037418	Bacteria	1396
360	Ga0395900_0479656	3300037418	Bacteria	1196
361	Ga0395898_0006383	3300037466	Bacteria	12598
362	Ga0395898_0025300	3300037466	Bacteria	5984
363	Ga0395898_0047949	3300037466	Bacteria	4190
364	Ga0395898_0072345	3300037466	Bacteria	3331
365	Ga0395905_0007726	3300037471	Bacteria	10671
366	Ga0395905_0025211	3300037471	Bacteria	5608
367	Ga0395901_0004213	3300038443	Bacteria	14493
368	Ga0395901_0006692	3300038443	Bacteria	11649
369	Ga0395901_0030953	3300038443	Bacteria	5516
370	Ga0395901_0037756	3300038443	Bacteria	4995
371	Ga0395901_0067931	3300038443	Bacteria	3713
372	Ga0395901_0178770	3300038443	Bacteria	2225
373	Ga0439458_0009352	3300042157	Bacteria	2182
374	Ga0466961_0216981	3300044693	Bacteria	1180
375	Ga0466963_0015460	3300044694	Bacteria	4726
376	Ga0466963_0058164	3300044694	Bacteria	2577
377	Ga0466963_0073828	3300044694	Bacteria	2300
378	Ga0466960_0069411	3300044901	Bacteria	1751
379	Ga0466967_0013131	3300045976	Bacteria	6382
380	Ga0466967_0201859	3300045976	Bacteria	1884
381	Ga0495592_0020223	3300046454	Bacteria	5064
382	Ga0495603_0078743	3300046455	Bacteria	1932
383	Ga0495629_0008949	3300046459	Bacteria	7353
384	Ga0495629_0013530	3300046459	Bacteria	5885
385	Ga0495651_0011551	3300046462	Bacteria	6784
386	Ga0495653_0001059	3300046463	Bacteria	21186
387	Ga0495653_0018043	3300046463	Bacteria	5737
388	Ga0495653_0063987	3300046463	Bacteria	2772
389	Ga0495580_0025701	3300046472	Bacteria	4302
390	Ga0495582_0003425	3300046473	Bacteria	8933
391	Ga0495582_0003927	3300046473	Bacteria	8349
392	Ga0495639_0002044	3300046475	Bacteria	8931
393	Ga0495639_0006453	3300046475	Bacteria	5047
394	Ga0495662_0002486	3300046476	Bacteria	9286
395	Ga0495662_0010038	3300046476	Bacteria	4644
396	Ga0495664_0005744	3300046477	Bacteria	6831
397	Ga0495594_0021795	3300046499	Bacteria	3421
398	Ga0495608_0020376	3300046511	Bacteria	4557
399	Ga0495608_0025421	3300046511	Bacteria	4042
400	Ga0495608_0095246	3300046511	Bacteria	1923
401	Ga0495618_0031539	3300046514	Bacteria	3315
402	Ga0495628_0027937	3300046516	Bacteria	4587
403	Ga0495628_0079792	3300046516	Bacteria	2544
404	Ga0495652_0065700	3300046529	Bacteria	3046
405	Ga0495652_0137869	3300046529	Bacteria	1922
406	Ga0495665_0020418	3300046531	Bacteria	3558
407	Ga0495640_0029136	3300046533	Bacteria	3967
408	Ga0495586_0004489	3300046535	Bacteria	7453
409	Ga0495586_0026351	3300046535	Bacteria	3110
410	Ga0495587_0014969	3300046536	Bacteria	4851
411	Ga0495587_0058307	3300046536	Bacteria	2268
412	Ga0495645_0010637	3300046543	Bacteria	6459
413	Ga0495645_0022907	3300046543	Bacteria	4520
414	Ga0495645_0027836	3300046543	Bacteria	4107
415	Ga0495634_0007688	3300046642	Bacteria	8065
416	Ga0495635_0022930	3300046663	Bacteria	4351
417	Ga0495635_0033043	3300046663	Bacteria	3589
418	Ga0495657_0009765	3300046675	Bacteria	7246
419	Ga0495657_0021980	3300046675	Bacteria	4573
420	Ga0495599_0028431	3300046678	Bacteria	3504
421	Ga0495599_0090547	3300046678	Bacteria	1908
422	Ga0495623_0041946	3300046679	Bacteria	2916
423	Ga0495646_0006993	3300046680	Bacteria	7163
424	Ga0495646_0018889	3300046680	Bacteria	4365
425	Ga0495647_0006587	3300046681	Bacteria	3853
426	Ga0495658_0002703	3300046683	Bacteria	8936
427	Ga0495658_0005669	3300046683	Bacteria	6134
428	Ga0495613_0037224	3300046689	Bacteria	3607
429	Ga0495624_0005148	3300046690	Bacteria	9443
430	Ga0495624_0012051	3300046690	Bacteria	5923
431	Ga0495600_0001696	3300046809	Bacteria	12304
432	Ga0495600_0038124	3300046809	Bacteria	3126
433	Ga0495581_0016678	3300047315	Bacteria	4270
434	Ga0495581_0029136	3300047315	Bacteria	3200
435	Ga0495604_0004804	3300047317	Bacteria	10713
436	Ga0495604_0011619	3300047317	Bacteria	7000
437	Ga0495674_0039307	3300047319	Bacteria	4242
438	Ga0495674_0044554	3300047319	Bacteria	3944
439	Ga0495674_0222325	3300047319	Bacteria	1560
440	Ga0495680_0001542	3300047322	Bacteria	24662
441	Ga0495680_0013319	3300047322	Bacteria	7180
442	Ga0495680_0033130	3300047322	Bacteria	4186
443	Ga0495680_0035457	3300047322	Bacteria	4018
444	Ga0495675_0008789	3300047444	Bacteria	6270
445	Ga0495675_0030871	3300047444	Bacteria	3419
446	Ga0495684_0013331	3300047471	Bacteria	6331
447	Ga0495684_0047695	3300047471	Bacteria	3276
448	Ga0495684_0134812	3300047471	Bacteria	1853
449	Ga0495593_0009425	3300047673	Bacteria	5664
450	Ga0495593_0009515	3300047673	Bacteria	5638
451	Ga0495602_0040874	3300048088	Bacteria	4242
452	Ga0495614_0008161	3300048089	Bacteria	4656
453	Ga0496100_0049353	3300048903	Bacteria	2721
454	Ga0496101_0098795	3300048904	Bacteria	2181
455	Ga0496102_0086292	3300048905	Bacteria	2898
456	Ga0496102_0139333	3300048905	Bacteria	2274
457	Ga0496103_0100263	3300048906	Bacteria	1832
458	Ga0496104_0076633	3300048907	Bacteria	3185
459	Ga0496104_0272172	3300048907	Bacteria	1606
460	Ga0496106_0079314	3300048909	Bacteria	2520
461	Ga0496106_0242459	3300048909	Bacteria	1440
462	Ga0496107_0015410	3300048910	Bacteria	5356
463	Ga0496107_0020668	3300048910	Bacteria	4651
464	Ga0496110_0081367	3300048913	Bacteria	2887
465	Ga0496110_0135172	3300048913	Bacteria	2228
466	Ga0496110_0259707	3300048913	Bacteria	1581
467	Ga0496111_0059528	3300048914	Bacteria	2767
468	Ga0496112_0000865	3300048915	Bacteria	21683
469	Ga0496113_0196184	3300048916	Bacteria	1603
470	Ga0496115_0024235	3300048918	Bacteria	4714
471	Ga0496115_0037021	3300048918	Bacteria	3865
472	Ga0496126_0005410	3300048929	Bacteria	14571
473	Ga0501042_0011766	3300049578	Bacteria	5911
474	Ga0501047_0004868	3300049581	Bacteria	12610
475	nmdc:mga0yw44_56876_c1	3300050492	Bacteria	2385
476	nmdc:mga08y16_106344_c1	3300050511	Bacteria	2921
477	nmdc:mga0n895_219701_c1	3300050512	Bacteria	1929
478	nmdc:mga0rr50_2829_c1	3300050513	Bacteria	9868
479	nmdc:mga0rr50_73218_c1	3300050513	Bacteria	2619
480	nmdc:mga0rr50_86887_c1	3300050513	Bacteria	2427
481	nmdc:mga08x19_11424_c1	3300050514	Bacteria	5344
482	nmdc:mga08x19_19689_c1	3300050514	Bacteria	4145
483	nmdc:mga08x19_69506_c1	3300050514	Bacteria	2294
484	nmdc:mga08x19_74053_c1	3300050514	Bacteria	2225
485	nmdc:mga0a205_132811_c1	3300050515	Bacteria	2390
486	nmdc:mga0a205_89123_c1	3300050515	Bacteria	2982
487	Ga0495601_0001113	3300053077	Bacteria	14732
488	Ga0495601_0004001	3300053077	Bacteria	8485
489	Ga0495601_0035321	3300053077	Bacteria	3119
490	Ga0495612_0000404	3300053078	Bacteria	17304
491	Ga0495612_0003261	3300053078	Bacteria	6731
492	Ga0495595_0011690	3300053084	Bacteria	3674
493	Ga0495595_0075582	3300053084	Bacteria	1598
494	Ga0495619_0016787	3300053085	Bacteria	4635
495	Ga0495619_0034064	3300053085	Bacteria	3310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035086	Ga0373934_0086786	Ga0373934_0086786_44_1102	318
2	3300035119	Ga0373956_0129453	Ga0373956_0129453_21_1079	318
3	3300013306	Ga0163162_10296038	Ga0163162_102960382	336
4	3300009553	Ga0105249_10095587	Ga0105249_100955872	340
5	3300005549	Ga0070704_100022153	Ga0070704_1000221532	341
6	3300005563	Ga0068855_100171672	Ga0068855_1001716722	341
7	3300005843	Ga0068860_100049011	Ga0068860_1000490113	341
8	3300025961	Ga0207712_10186215	Ga0207712_101862151	341
9	3300028381	Ga0268264_10099516	Ga0268264_100995162	341
10	3300035724	Ga0373933_0022132	Ga0373933_0022132_168_1364	343
11	3300036401	Ga0373937_0064452	Ga0373937_0064452_1863_3059	344
12	3300035120	Ga0373957_0060896	Ga0373957_0060896_196_1419	347
13	3300048913	Ga0496110_0081367	Ga0496110_0081367_74_1141	353
14	3300005445	Ga0070708_100017018	Ga0070708_1000170184	354
15	3300005467	Ga0070706_100001541	Ga0070706_10000154115	354
16	3300005471	Ga0070698_100005994	Ga0070698_10000599417	354
17	3300005536	Ga0070697_100049996	Ga0070697_1000499963	354
18	3300006028	Ga0070717_10005588	Ga0070717_1000558810	354
19	3300025910	Ga0207684_10015395	Ga0207684_100153951	354
20	3300025922	Ga0207646_10003432	Ga0207646_1000343212	354
21	3300037418	Ga0395900_0138278	Ga0395900_0138278_316_1383	354
22	3300038443	Ga0395901_0067931	Ga0395901_0067931_331_1398	354
23	3300053078	Ga0495612_0000404	Ga0495612_0000404_3735_5021	355
24	3300038443	Ga0395901_0030953	Ga0395901_0030953_88_1260	357
25	3300005435	Ga0070714_100029653	Ga0070714_1000296532	358
26	3300005468	Ga0070707_100133298	Ga0070707_1001332981	359
27	3300025922	Ga0207646_10006252	Ga0207646_1000625215	359
28	3300045976	Ga0466967_0201859	Ga0466967_0201859_475_1659	359
29	3300053085	Ga0495619_0034064	Ga0495619_0034064_1871_3043	361
30	3300006038	Ga0075365_10030433	Ga0075365_100304332	362
31	3300050492	nmdc:mga0yw44_56876_c1	nmdc:mga0yw44_56876_c1_702_1871	362
32	3300026078	Ga0207702_10001525	Ga0207702_1000152517	363
33	3300037418	Ga0395900_0026113	Ga0395900_0026113_752_1921	363
34	3300038443	Ga0395901_0037756	Ga0395901_0037756_2070_3239	363
35	3300048903	Ga0496100_0049353	Ga0496100_0049353_592_1770	363
36	3300048904	Ga0496101_0098795	Ga0496101_0098795_31_1209	363
37	3300048909	Ga0496106_0079314	Ga0496106_0079314_188_1366	363
38	3300048910	Ga0496107_0020668	Ga0496107_0020668_2174_3352	363
39	3300048918	Ga0496115_0024235	Ga0496115_0024235_2323_3501	363
40	3300005354	Ga0070675_100144816	Ga0070675_1001448162	364
41	3300005445	Ga0070708_100098364	Ga0070708_1000983643	364
42	3300005467	Ga0070706_100050587	Ga0070706_1000505872	364
43	3300005468	Ga0070707_100044488	Ga0070707_1000444884	364
44	3300005536	Ga0070697_100081857	Ga0070697_1000818572	364
45	3300013308	Ga0157375_10301809	Ga0157375_103018092	364
46	3300025910	Ga0207684_10010114	Ga0207684_100101144	364
47	3300025922	Ga0207646_10004842	Ga0207646_100048423	364
48	3300027671	Ga0209588_1005004	Ga0209588_10050042	364
49	3300035241	Ga0373961_0050024	Ga0373961_0050024_11_1162	364
50	3300044694	Ga0466963_0073828	Ga0466963_0073828_387_1598	364
51	3300045976	Ga0466967_0013131	Ga0466967_0013131_1811_3022	364
52	3300048913	Ga0496110_0259707	Ga0496110_0259707_174_1391	364
53	3300049578	Ga0501042_0011766	Ga0501042_0011766_1182_2396	364
54	3300005439	Ga0070711_100068324	Ga0070711_1000683243	365
55	3300005518	Ga0070699_100080034	Ga0070699_1000800343	365
56	3300005843	Ga0068860_100346396	Ga0068860_1003463961	365
57	3300009553	Ga0105249_10080730	Ga0105249_100807302	365
58	3300013307	Ga0157372_10366722	Ga0157372_103667222	365
59	3300014969	Ga0157376_10186969	Ga0157376_101869691	365
60	3300025913	Ga0207695_10249397	Ga0207695_102493972	365
61	3300025915	Ga0207693_10069220	Ga0207693_100692202	365
62	3300025922	Ga0207646_10008547	Ga0207646_100085472	365
63	3300025961	Ga0207712_10088443	Ga0207712_100884432	365
64	3300037418	Ga0395900_0036720	Ga0395900_0036720_42_1244	365
65	3300037466	Ga0395898_0025300	Ga0395898_0025300_1780_2982	365
66	3300037471	Ga0395905_0007726	Ga0395905_0007726_9368_10570	365
67	3300038443	Ga0395901_0004213	Ga0395901_0004213_11866_13068	365
68	3300044693	Ga0466961_0216981	Ga0466961_0216981_25_1131	365
69	3300048907	Ga0496104_0076633	Ga0496104_0076633_1952_3163	365
70	3300048915	Ga0496112_0000865	Ga0496112_0000865_20029_21216	365
71	3300050514	nmdc:mga08x19_11424_c1	nmdc:mga08x19_11424_c1_1286_2458	365
72	3300009148	Ga0105243_10059277	Ga0105243_100592773	366
73	3300013102	Ga0157371_10008996	Ga0157371_100089965	366
74	3300013306	Ga0163162_10420144	Ga0163162_104201442	366
75	3300014325	Ga0163163_10130303	Ga0163163_101303032	366
76	3300053078	Ga0495612_0003261	Ga0495612_0003261_2864_4057	366
77	3300005436	Ga0070713_100110805	Ga0070713_1001108052	367
78	3300005437	Ga0070710_10027221	Ga0070710_100272212	367
79	3300005468	Ga0070707_100089112	Ga0070707_1000891122	367
80	3300006028	Ga0070717_10178928	Ga0070717_101789282	367
81	3300025922	Ga0207646_10040994	Ga0207646_100409943	367
82	3300025929	Ga0207664_10022598	Ga0207664_100225984	367
83	3300037466	Ga0395898_0072345	Ga0395898_0072345_1309_2574	367
84	3300005467	Ga0070706_100006185	Ga0070706_1000061852	368
85	3300005468	Ga0070707_100000293	Ga0070707_10000029333	368
86	3300005471	Ga0070698_100000106	Ga0070698_10000010633	368
87	3300006028	Ga0070717_10002005	Ga0070717_100020056	368
88	3300025910	Ga0207684_10000571	Ga0207684_100005718	368
89	3300025922	Ga0207646_10000050	Ga0207646_1000005025	368
90	3300044694	Ga0466963_0015460	Ga0466963_0015460_1290_2408	368
91	3300046690	Ga0495624_0012051	Ga0495624_0012051_284_1501	368
92	3300006914	Ga0075436_100058132	Ga0075436_1000581322	369
93	3300025910	Ga0207684_10060549	Ga0207684_100605492	369
94	3300037418	Ga0395900_0108400	Ga0395900_0108400_1630_2748	369
95	3300037418	Ga0395900_0479656	Ga0395900_0479656_53_1168	369
96	3300037466	Ga0395898_0006383	Ga0395898_0006383_9188_10306	369
97	3300038443	Ga0395901_0178770	Ga0395901_0178770_280_1398	369
98	3300049581	Ga0501047_0004868	Ga0501047_0004868_18_1133	369
99	3300005345	Ga0070692_10054660	Ga0070692_100546602	370
100	3300005356	Ga0070674_100090824	Ga0070674_1000908242	370
101	3300005366	Ga0070659_100129274	Ga0070659_1001292742	370
102	3300005438	Ga0070701_10004123	Ga0070701_100041236	370
103	3300005444	Ga0070694_100036114	Ga0070694_1000361143	370
104	3300005457	Ga0070662_100052972	Ga0070662_1000529722	370
105	3300005544	Ga0070686_100058859	Ga0070686_1000588592	370
106	3300005563	Ga0068855_100205242	Ga0068855_1002052422	370
107	3300005615	Ga0070702_100017792	Ga0070702_1000177922	370
108	3300006028	Ga0070717_10000009	Ga0070717_10000009107	370
109	3300009148	Ga0105243_10015286	Ga0105243_100152862	370
110	3300009176	Ga0105242_10060398	Ga0105242_100603983	370
111	3300009553	Ga0105249_10083366	Ga0105249_100833662	370
112	3300013102	Ga0157371_10046440	Ga0157371_100464401	370
113	3300013297	Ga0157378_10036474	Ga0157378_100364742	370
114	3300013308	Ga0157375_10011528	Ga0157375_100115286	370
115	3300025899	Ga0207642_10039777	Ga0207642_100397772	370
116	3300025901	Ga0207688_10085291	Ga0207688_100852912	370
117	3300025907	Ga0207645_10116321	Ga0207645_101163212	370
118	3300025927	Ga0207687_10047083	Ga0207687_100470833	370
119	3300025929	Ga0207664_10100928	Ga0207664_101009282	370
120	3300025932	Ga0207690_10135306	Ga0207690_101353061	370
121	3300025933	Ga0207706_10014738	Ga0207706_100147386	370
122	3300025939	Ga0207665_10052844	Ga0207665_100528442	370
123	3300026075	Ga0207708_10014079	Ga0207708_100140792	370
124	3300026089	Ga0207648_10078227	Ga0207648_100782272	370
125	3300026121	Ga0207683_10103560	Ga0207683_101035602	370
126	3300026142	Ga0207698_10123735	Ga0207698_101237352	370
127	3300028381	Ga0268264_10047044	Ga0268264_100470443	370
128	3300028800	Ga0265338_10004893	Ga0265338_100048935	370
129	3300031240	Ga0265320_10071989	Ga0265320_100719891	370
130	3300031241	Ga0265325_10000193	Ga0265325_1000019333	370
131	3300031247	Ga0265340_10000075	Ga0265340_1000007535	370
132	3300031249	Ga0265339_10004226	Ga0265339_100042265	370
133	3300031344	Ga0265316_10079037	Ga0265316_100790373	370
134	3300044901	Ga0466960_0069411	Ga0466960_0069411_313_1506	370
135	3300047319	Ga0495674_0044554	Ga0495674_0044554_1693_2874	370
136	3300048905	Ga0496102_0139333	Ga0496102_0139333_825_2012	370
137	3300048906	Ga0496103_0100263	Ga0496103_0100263_603_1790	370
138	3300048909	Ga0496106_0242459	Ga0496106_0242459_225_1412	370
139	3300050512	nmdc:mga0n895_219701_c1	nmdc:mga0n895_219701_c1_450_1670	370
140	3300050513	nmdc:mga0rr50_73218_c1	nmdc:mga0rr50_73218_c1_709_1881	370
141	3300050514	nmdc:mga08x19_69506_c1	nmdc:mga08x19_69506_c1_43_1215	370
142	3300050515	nmdc:mga0a205_89123_c1	nmdc:mga0a205_89123_c1_1267_2439	370
143	3300005445	Ga0070708_100010970	Ga0070708_1000109706	371
144	3300005468	Ga0070707_100072150	Ga0070707_1000721501	371
145	3300005471	Ga0070698_100130500	Ga0070698_1001305002	371
146	3300005536	Ga0070697_100002322	Ga0070697_10000232210	371
147	3300009147	Ga0114129_10276776	Ga0114129_102767762	371
148	3300025922	Ga0207646_10000079	Ga0207646_10000079113	371
149	3300037418	Ga0395900_0373204	Ga0395900_0373204_61_1251	371
150	3300037466	Ga0395898_0047949	Ga0395898_0047949_182_1375	371
151	3300037471	Ga0395905_0025211	Ga0395905_0025211_370_1563	371
152	3300038443	Ga0395901_0006692	Ga0395901_0006692_4276_5469	371
153	3300005336	Ga0070680_100051226	Ga0070680_1000512263	372
154	3300005435	Ga0070714_100041152	Ga0070714_1000411523	372
155	3300005436	Ga0070713_100014232	Ga0070713_1000142326	372
156	3300005437	Ga0070710_10000538	Ga0070710_1000053813	372
157	3300005456	Ga0070678_100027277	Ga0070678_1000272772	372
158	3300005467	Ga0070706_100044336	Ga0070706_1000443364	372
159	3300005468	Ga0070707_100008457	Ga0070707_1000084574	372
160	3300005471	Ga0070698_100000862	Ga0070698_10000086238	372
161	3300005530	Ga0070679_100151124	Ga0070679_1001511242	372
162	3300005536	Ga0070697_100061646	Ga0070697_1000616463	372
163	3300005547	Ga0070693_100141609	Ga0070693_1001416092	372
164	3300005578	Ga0068854_100064556	Ga0068854_1000645562	372
165	3300005614	Ga0068856_100057176	Ga0068856_1000571764	372
166	3300006028	Ga0070717_10127288	Ga0070717_101272881	372
167	3300006173	Ga0070716_100043677	Ga0070716_1000436771	372
168	3300006175	Ga0070712_100041550	Ga0070712_1000415502	372
169	3300009174	Ga0105241_10075988	Ga0105241_100759882	372
170	3300025910	Ga0207684_10011586	Ga0207684_100115864	372
171	3300025915	Ga0207693_10016039	Ga0207693_100160392	372
172	3300025916	Ga0207663_10043979	Ga0207663_100439792	372
173	3300025922	Ga0207646_10000567	Ga0207646_100005673	372
174	3300025922	Ga0207646_10005615	Ga0207646_100056154	372
175	3300025928	Ga0207700_10001411	Ga0207700_100014119	372
176	3300025929	Ga0207664_10000630	Ga0207664_1000063019	372
177	3300025939	Ga0207665_10011853	Ga0207665_100118533	372
178	3300031731	Ga0307405_10003471	Ga0307405_100034718	372
179	3300031824	Ga0307413_10131778	Ga0307413_101317781	372
180	3300031852	Ga0307410_10001420	Ga0307410_100014204	372
181	3300031903	Ga0307407_10012021	Ga0307407_100120213	372
182	3300031911	Ga0307412_10010533	Ga0307412_100105333	372
183	3300032004	Ga0307414_10003638	Ga0307414_100036385	372
184	3300032126	Ga0307415_100034954	Ga0307415_1000349542	372
185	3300035083	Ga0373926_0000152	Ga0373926_0000152_1094_2290	372
186	3300035692	Ga0373935_0007028	Ga0373935_0007028_156_1352	372
187	3300035725	Ga0373947_0000586	Ga0373947_0000586_13173_14369	372
188	3300046809	Ga0495600_0038124	Ga0495600_0038124_31_1248	372
189	3300005983	Ga0081540_1027076	Ga0081540_10270762	373
190	3300025906	Ga0207699_10000794	Ga0207699_100007942	373
191	3300035113	Ga0373936_0005940	Ga0373936_0005940_523_1737	373
192	3300035724	Ga0373933_0026872	Ga0373933_0026872_548_1762	373
193	3300046462	Ga0495651_0011551	Ga0495651_0011551_1855_3069	373
194	3300046463	Ga0495653_0001059	Ga0495653_0001059_143_1357	373
195	3300046529	Ga0495652_0137869	Ga0495652_0137869_512_1726	373
196	3300046663	Ga0495635_0033043	Ga0495635_0033043_269_1483	373
197	3300046675	Ga0495657_0009765	Ga0495657_0009765_5847_7061	373
198	3300047322	Ga0495680_0001542	Ga0495680_0001542_5741_6955	373
199	3300048907	Ga0496104_0272172	Ga0496104_0272172_15_1271	373
200	3300005435	Ga0070714_100143961	Ga0070714_1001439611	374
201	3300005436	Ga0070713_100044725	Ga0070713_1000447253	374
202	3300005445	Ga0070708_100000037	Ga0070708_10000003736	374
203	3300005467	Ga0070706_100000073	Ga0070706_10000007376	374
204	3300005468	Ga0070707_100000040	Ga0070707_10000004051	374
205	3300005518	Ga0070699_100000120	Ga0070699_10000012029	374
206	3300005549	Ga0070704_100002317	Ga0070704_1000023173	374
207	3300005937	Ga0081455_10005512	Ga0081455_100055126	374
208	3300005983	Ga0081540_1002348	Ga0081540_100234814	374
209	3300005983	Ga0081540_1077990	Ga0081540_10779902	374
210	3300006058	Ga0075432_10029848	Ga0075432_100298482	374
211	3300006847	Ga0075431_100180072	Ga0075431_1001800722	374
212	3300006914	Ga0075436_100007268	Ga0075436_1000072684	374
213	3300007076	Ga0075435_100073329	Ga0075435_1000733293	374
214	3300009094	Ga0111539_10150476	Ga0111539_101504762	374
215	3300009098	Ga0105245_10038537	Ga0105245_100385374	374
216	3300009147	Ga0114129_10062499	Ga0114129_100624994	374
217	3300010375	Ga0105239_10137882	Ga0105239_101378822	374
218	3300022467	Ga0224712_10038730	Ga0224712_100387302	374
219	3300025910	Ga0207684_10000156	Ga0207684_1000015677	374
220	3300025922	Ga0207646_10000100	Ga0207646_1000010077	374
221	3300025928	Ga0207700_10011816	Ga0207700_100118165	374
222	3300025929	Ga0207664_10005268	Ga0207664_100052687	374
223	3300027695	Ga0209966_1005553	Ga0209966_10055532	374
224	3300027907	Ga0207428_10008677	Ga0207428_100086775	374
225	3300028563	Ga0265319_1002387	Ga0265319_100238711	374
226	3300042157	Ga0439458_0009352	Ga0439458_0009352_142_1329	374
227	3300050511	nmdc:mga08y16_106344_c1	nmdc:mga08y16_106344_c1_914_2104	374
228	3300050513	nmdc:mga0rr50_86887_c1	nmdc:mga0rr50_86887_c1_635_1825	374
229	3300050514	nmdc:mga08x19_19689_c1	nmdc:mga08x19_19689_c1_268_1458	374
230	3300050515	nmdc:mga0a205_132811_c1	nmdc:mga0a205_132811_c1_818_2008	374
231	3300005468	Ga0070707_100004651	Ga0070707_1000046519	375
232	3300005536	Ga0070697_100004782	Ga0070697_1000047822	375
233	3300005545	Ga0070695_100002484	Ga0070695_1000024848	375
234	3300005937	Ga0081455_10020435	Ga0081455_100204352	375
235	3300025912	Ga0207707_10151885	Ga0207707_101518852	375
236	3300025919	Ga0207657_10038704	Ga0207657_100387043	375
237	3300025921	Ga0207652_10132202	Ga0207652_101322023	375
238	3300025922	Ga0207646_10036749	Ga0207646_100367493	375
239	3300034819	Ga0373958_0015096	Ga0373958_0015096_23_1237	375
240	3300035724	Ga0373933_0025863	Ga0373933_0025863_2029_3285	375
241	3300036401	Ga0373937_0254169	Ga0373937_0254169_95_1312	375
242	3300047471	Ga0495684_0047695	Ga0495684_0047695_1222_2457	375
243	3300047471	Ga0495684_0134812	Ga0495684_0134812_14_1231	375
244	3300053077	Ga0495601_0001113	Ga0495601_0001113_11905_13140	375
245	3300053084	Ga0495595_0075582	Ga0495595_0075582_257_1492	375
246	3300025910	Ga0207684_10073625	Ga0207684_100736253	376
247	3300048913	Ga0496110_0135172	Ga0496110_0135172_836_1999	376
248	3300005467	Ga0070706_100000687	Ga0070706_1000006873	377
249	3300005468	Ga0070707_100027783	Ga0070707_1000277833	377
250	3300005471	Ga0070698_100024582	Ga0070698_1000245822	377
251	3300005983	Ga0081540_1001377	Ga0081540_10013778	377
252	3300025910	Ga0207684_10000151	Ga0207684_100001517	377
253	3300025922	Ga0207646_10001122	Ga0207646_100011223	377
254	3300025922	Ga0207646_10208374	Ga0207646_102083741	377
255	3300050514	nmdc:mga08x19_74053_c1	nmdc:mga08x19_74053_c1_460_1638	377
256	3300005329	Ga0070683_100000759	Ga0070683_10000075919	378
257	3300005435	Ga0070714_100096798	Ga0070714_1000967982	378
258	3300005535	Ga0070684_100017975	Ga0070684_1000179752	378
259	3300005564	Ga0070664_100054562	Ga0070664_1000545622	378
260	3300005577	Ga0068857_100000846	Ga0068857_1000008469	378
261	3300005614	Ga0068856_100003521	Ga0068856_1000035213	378
262	3300025928	Ga0207700_10011053	Ga0207700_100110533	378
263	3300025929	Ga0207664_10137152	Ga0207664_101371522	378
264	3300025944	Ga0207661_10000303	Ga0207661_1000030326	378
265	3300026116	Ga0207674_10000808	Ga0207674_100008086	378
266	3300035113	Ga0373936_0007178	Ga0373936_0007178_1717_2973	378
267	3300035117	Ga0373953_0003957	Ga0373953_0003957_1663_2859	378
268	3300035117	Ga0373953_0019435	Ga0373953_0019435_394_1650	378
269	3300035118	Ga0373954_0012627	Ga0373954_0012627_1685_2941	378
270	3300035119	Ga0373956_0048049	Ga0373956_0048049_627_1883	378
271	3300035171	Ga0373946_0041590	Ga0373946_0041590_604_1800	378
272	3300036401	Ga0373937_0052562	Ga0373937_0052562_232_1428	378
273	3300046459	Ga0495629_0008949	Ga0495629_0008949_6022_7218	378
274	3300046463	Ga0495653_0018043	Ga0495653_0018043_3387_4643	378
275	3300046476	Ga0495662_0010038	Ga0495662_0010038_1625_2821	378
276	3300046511	Ga0495608_0025421	Ga0495608_0025421_1224_2480	378
277	3300046516	Ga0495628_0027937	Ga0495628_0027937_84_1340	378
278	3300046529	Ga0495652_0065700	Ga0495652_0065700_1836_3032	378
279	3300046536	Ga0495587_0014969	Ga0495587_0014969_2419_3675	378
280	3300046536	Ga0495587_0058307	Ga0495587_0058307_1023_2219	378
281	3300046543	Ga0495645_0010637	Ga0495645_0010637_1023_2219	378
282	3300046543	Ga0495645_0027836	Ga0495645_0027836_2138_3364	378
283	3300046642	Ga0495634_0007688	Ga0495634_0007688_2405_3601	378
284	3300046675	Ga0495657_0021980	Ga0495657_0021980_1620_2876	378
285	3300046690	Ga0495624_0005148	Ga0495624_0005148_6096_7292	378
286	3300046809	Ga0495600_0001696	Ga0495600_0001696_1663_2859	378
287	3300047317	Ga0495604_0004804	Ga0495604_0004804_6599_7855	378
288	3300047319	Ga0495674_0222325	Ga0495674_0222325_158_1414	378
289	3300047322	Ga0495680_0013319	Ga0495680_0013319_5007_6263	378
290	3300047322	Ga0495680_0033130	Ga0495680_0033130_1663_2859	378
291	3300047444	Ga0495675_0030871	Ga0495675_0030871_1959_3215	378
292	3300047471	Ga0495684_0013331	Ga0495684_0013331_1363_2619	378
293	3300053084	Ga0495595_0011690	Ga0495595_0011690_1315_2511	378
294	3300005436	Ga0070713_100003035	Ga0070713_1000030354	379
295	3300005436	Ga0070713_100032696	Ga0070713_1000326962	379
296	3300025916	Ga0207663_10155160	Ga0207663_101551602	379
297	3300025922	Ga0207646_10064972	Ga0207646_100649722	379
298	3300025928	Ga0207700_10022957	Ga0207700_100229572	379
299	3300025929	Ga0207664_10160121	Ga0207664_101601212	379
300	3300025910	Ga0207684_10008878	Ga0207684_100088782	380
301	3300037068	Ga0373925_0006822	Ga0373925_0006822_1629_2885	380
302	3300009098	Ga0105245_10016172	Ga0105245_100161725	381
303	3300014745	Ga0157377_10092128	Ga0157377_100921282	381
304	3300025927	Ga0207687_10014982	Ga0207687_100149823	381
305	3300029957	Ga0265324_10026239	Ga0265324_100262391	381
306	3300048918	Ga0496115_0037021	Ga0496115_0037021_361_1635	381
307	3300005435	Ga0070714_100031732	Ga0070714_1000317322	382
308	3300005445	Ga0070708_100221648	Ga0070708_1002216482	382
309	3300005467	Ga0070706_100031772	Ga0070706_1000317722	382
310	3300025910	Ga0207684_10103070	Ga0207684_101030702	382
311	3300025922	Ga0207646_10076120	Ga0207646_100761202	382
312	3300044694	Ga0466963_0058164	Ga0466963_0058164_1046_2302	382
313	3300048929	Ga0496126_0005410	Ga0496126_0005410_1549_2814	382
314	3300005445	Ga0070708_100004321	Ga0070708_10000432110	383
315	3300005467	Ga0070706_100000752	Ga0070706_10000075239	383
316	3300005467	Ga0070706_100136820	Ga0070706_1001368201	383
317	3300005468	Ga0070707_100050479	Ga0070707_1000504792	383
318	3300005471	Ga0070698_100229100	Ga0070698_1002291002	383
319	3300005518	Ga0070699_100000071	Ga0070699_10000007158	383
320	3300005518	Ga0070699_100020242	Ga0070699_1000202422	383
321	3300005549	Ga0070704_100032098	Ga0070704_1000320983	383
322	3300009098	Ga0105245_10015728	Ga0105245_100157283	383
323	3300009148	Ga0105243_10049192	Ga0105243_100491923	383
324	3300013297	Ga0157378_10234453	Ga0157378_102344532	383
325	3300025910	Ga0207684_10000003	Ga0207684_10000003745	383
326	3300025910	Ga0207684_10132506	Ga0207684_101325062	383
327	3300025910	Ga0207684_10145231	Ga0207684_101452312	383
328	3300025922	Ga0207646_10000779	Ga0207646_100007799	383
329	3300005437	Ga0070710_10067421	Ga0070710_100674211	384
330	3300025906	Ga0207699_10016962	Ga0207699_100169623	384
331	3300025916	Ga0207663_10065297	Ga0207663_100652972	384
332	3300025928	Ga0207700_10068186	Ga0207700_100681863	384
333	3300028558	Ga0265326_10000647	Ga0265326_1000064714	384
334	3300028563	Ga0265319_1000995	Ga0265319_10009952	384
335	3300028800	Ga0265338_10003311	Ga0265338_1000331117	384
336	3300031238	Ga0265332_10007984	Ga0265332_100079842	384
337	3300031240	Ga0265320_10002585	Ga0265320_1000258510	384
338	3300031241	Ga0265325_10015308	Ga0265325_100153082	384
339	3300031344	Ga0265316_10148424	Ga0265316_101484242	384
340	3300031711	Ga0265314_10006144	Ga0265314_100061442	384
341	3300031712	Ga0265342_10002252	Ga0265342_1000225213	384
342	3300035113	Ga0373936_0002891	Ga0373936_0002891_1413_2636	384
343	3300005435	Ga0070714_100268050	Ga0070714_1002680501	385
344	3300024225	Ga0224572_1002095	Ga0224572_10020954	385
345	3300005437	Ga0070710_10000208	Ga0070710_1000020827	386
346	3300005439	Ga0070711_100000269	Ga0070711_1000002696	386
347	3300006028	Ga0070717_10026163	Ga0070717_100261633	386
348	3300006173	Ga0070716_100000693	Ga0070716_10000069313	386
349	3300006175	Ga0070712_100150245	Ga0070712_1001502452	386
350	3300006852	Ga0075433_10010923	Ga0075433_100109232	386
351	3300006871	Ga0075434_100132680	Ga0075434_1001326802	386
352	3300007076	Ga0075435_100076707	Ga0075435_1000767072	386
353	3300025906	Ga0207699_10000697	Ga0207699_1000069710	386
354	3300025915	Ga0207693_10006607	Ga0207693_100066077	386
355	3300025915	Ga0207693_10036660	Ga0207693_100366604	386
356	3300025916	Ga0207663_10023417	Ga0207663_100234173	386
357	3300025928	Ga0207700_10002103	Ga0207700_100021035	386
358	3300025929	Ga0207664_10002379	Ga0207664_100023794	386
359	3300025939	Ga0207665_10000208	Ga0207665_1000020811	386
360	3300035086	Ga0373934_0001204	Ga0373934_0001204_299_1522	386
361	3300035086	Ga0373934_0009761	Ga0373934_0009761_1876_3138	386
362	3300035116	Ga0373945_0065884	Ga0373945_0065884_35_1258	386
363	3300035119	Ga0373956_0007605	Ga0373956_0007605_2120_3343	386
364	3300035120	Ga0373957_0009643	Ga0373957_0009643_1047_2270	386
365	3300035410	Ga0373924_0004110	Ga0373924_0004110_1888_3111	386
366	3300035692	Ga0373935_0020476	Ga0373935_0020476_1022_2245	386
367	3300035724	Ga0373933_0120532	Ga0373933_0120532_121_1344	386
368	3300046463	Ga0495653_0063987	Ga0495653_0063987_249_1472	386
369	3300046473	Ga0495582_0003927	Ga0495582_0003927_4748_5971	386
370	3300046475	Ga0495639_0006453	Ga0495639_0006453_2069_3292	386
371	3300046477	Ga0495664_0005744	Ga0495664_0005744_3096_4319	386
372	3300046511	Ga0495608_0020376	Ga0495608_0020376_3130_4353	386
373	3300046514	Ga0495618_0031539	Ga0495618_0031539_1408_2631	386
374	3300046516	Ga0495628_0079792	Ga0495628_0079792_1023_2246	386
375	3300046531	Ga0495665_0020418	Ga0495665_0020418_2087_3310	386
376	3300046535	Ga0495586_0004489	Ga0495586_0004489_5090_6313	386
377	3300046663	Ga0495635_0022930	Ga0495635_0022930_750_1973	386
378	3300046678	Ga0495599_0028431	Ga0495599_0028431_685_1908	386
379	3300046680	Ga0495646_0018889	Ga0495646_0018889_2845_4068	386
380	3300046681	Ga0495647_0006587	Ga0495647_0006587_597_1859	386
381	3300046683	Ga0495658_0002703	Ga0495658_0002703_7066_8289	386
382	3300046689	Ga0495613_0037224	Ga0495613_0037224_1380_2603	386
383	3300047315	Ga0495581_0016678	Ga0495581_0016678_1176_2399	386
384	3300047319	Ga0495674_0039307	Ga0495674_0039307_2771_3994	386
385	3300047444	Ga0495675_0008789	Ga0495675_0008789_1278_2501	386
386	3300047673	Ga0495593_0009515	Ga0495593_0009515_1785_3008	386
387	3300048088	Ga0495602_0040874	Ga0495602_0040874_2027_3250	386
388	3300050513	nmdc:mga0rr50_2829_c1	nmdc:mga0rr50_2829_c1_7247_8473	386
389	3300053077	Ga0495601_0004001	Ga0495601_0004001_2033_3256	386
390	3300053085	Ga0495619_0016787	Ga0495619_0016787_2033_3256	386
391	3300005334	Ga0068869_100040059	Ga0068869_1000400591	387
392	3300005355	Ga0070671_100065383	Ga0070671_1000653832	387
393	3300005366	Ga0070659_100019583	Ga0070659_1000195835	387
394	3300005444	Ga0070694_100058944	Ga0070694_1000589442	387
395	3300009553	Ga0105249_10070665	Ga0105249_100706652	387
396	3300010375	Ga0105239_10372093	Ga0105239_103720932	387
397	3300025898	Ga0207692_10083837	Ga0207692_100838372	387
398	3300025908	Ga0207643_10023428	Ga0207643_100234283	387
399	3300026089	Ga0207648_10027555	Ga0207648_100275554	387
400	3300026118	Ga0207675_100027279	Ga0207675_1000272792	387
401	3300035112	Ga0373932_0035682	Ga0373932_0035682_129_1385	387
402	3300048905	Ga0496102_0086292	Ga0496102_0086292_813_2069	387
403	3300005339	Ga0070660_100033824	Ga0070660_1000338242	388
404	3300005834	Ga0068851_10070864	Ga0068851_100708642	388
405	3300035083	Ga0373926_0012267	Ga0373926_0012267_790_2052	388
406	3300035089	Ga0373944_0003287	Ga0373944_0003287_2099_3361	388
407	3300035113	Ga0373936_0006901	Ga0373936_0006901_831_2093	388
408	3300035171	Ga0373946_0018748	Ga0373946_0018748_764_2026	388
409	3300035172	Ga0373955_0007545	Ga0373955_0007545_628_1890	388
410	3300035695	Ga0373927_0019163	Ga0373927_0019163_2642_3904	388
411	3300035725	Ga0373947_0004026	Ga0373947_0004026_4224_5486	388
412	3300037068	Ga0373925_0046430	Ga0373925_0046430_712_1974	388
413	3300046454	Ga0495592_0020223	Ga0495592_0020223_593_1855	388
414	3300046455	Ga0495603_0078743	Ga0495603_0078743_657_1919	388
415	3300046459	Ga0495629_0013530	Ga0495629_0013530_1639_2901	388
416	3300046472	Ga0495580_0025701	Ga0495580_0025701_2136_3398	388
417	3300046473	Ga0495582_0003425	Ga0495582_0003425_4694_5956	388
418	3300046475	Ga0495639_0002044	Ga0495639_0002044_1815_3077	388
419	3300046476	Ga0495662_0002486	Ga0495662_0002486_4033_5295	388
420	3300046499	Ga0495594_0021795	Ga0495594_0021795_101_1363	388
421	3300046511	Ga0495608_0095246	Ga0495608_0095246_14_1276	388
422	3300046533	Ga0495640_0029136	Ga0495640_0029136_845_2107	388
423	3300046535	Ga0495586_0026351	Ga0495586_0026351_876_2138	388
424	3300046543	Ga0495645_0022907	Ga0495645_0022907_2620_3882	388
425	3300046678	Ga0495599_0090547	Ga0495599_0090547_584_1846	388
426	3300046679	Ga0495623_0041946	Ga0495623_0041946_250_1512	388
427	3300046680	Ga0495646_0006993	Ga0495646_0006993_2000_3262	388
428	3300046683	Ga0495658_0005669	Ga0495658_0005669_1707_2969	388
429	3300047315	Ga0495581_0029136	Ga0495581_0029136_14_1276	388
430	3300047317	Ga0495604_0011619	Ga0495604_0011619_2588_3850	388
431	3300047322	Ga0495680_0035457	Ga0495680_0035457_1972_3234	388
432	3300047673	Ga0495593_0009425	Ga0495593_0009425_2493_3755	388
433	3300048089	Ga0495614_0008161	Ga0495614_0008161_693_1955	388
434	3300053077	Ga0495601_0035321	Ga0495601_0035321_1274_2536	388
435	3300005327	Ga0070658_10116650	Ga0070658_101166502	389
436	3300005329	Ga0070683_100021989	Ga0070683_1000219895	389
437	3300005336	Ga0070680_100027117	Ga0070680_1000271173	389
438	3300005340	Ga0070689_100053962	Ga0070689_1000539623	389
439	3300005344	Ga0070661_100059848	Ga0070661_1000598481	389
440	3300005345	Ga0070692_10126295	Ga0070692_101262951	389
441	3300005406	Ga0070703_10035945	Ga0070703_100359451	389
442	3300005456	Ga0070678_100035586	Ga0070678_1000355862	389
443	3300005457	Ga0070662_100050393	Ga0070662_1000503932	389
444	3300005535	Ga0070684_100014981	Ga0070684_1000149816	389
445	3300005536	Ga0070697_100071148	Ga0070697_1000711482	389
446	3300005539	Ga0068853_100092211	Ga0068853_1000922112	389
447	3300005543	Ga0070672_100049046	Ga0070672_1000490463	389
448	3300005544	Ga0070686_100016734	Ga0070686_1000167343	389
449	3300005545	Ga0070695_100057290	Ga0070695_1000572902	389
450	3300005546	Ga0070696_100121037	Ga0070696_1001210372	389
451	3300005547	Ga0070693_100087813	Ga0070693_1000878132	389
452	3300005549	Ga0070704_100098855	Ga0070704_1000988552	389
453	3300005564	Ga0070664_100021631	Ga0070664_1000216315	389
454	3300005578	Ga0068854_100034668	Ga0068854_1000346683	389
455	3300005615	Ga0070702_100039688	Ga0070702_1000396882	389
456	3300005617	Ga0068859_100076245	Ga0068859_1000762452	389
457	3300005618	Ga0068864_100241051	Ga0068864_1002410512	389
458	3300005719	Ga0068861_100126606	Ga0068861_1001266062	389
459	3300005841	Ga0068863_100294461	Ga0068863_1002944611	389
460	3300006163	Ga0070715_10033654	Ga0070715_100336542	389
461	3300006881	Ga0068865_100049006	Ga0068865_1000490062	389
462	3300006931	Ga0097620_100076245	Ga0097620_1000762453	389
463	3300009036	Ga0105244_10074979	Ga0105244_100749792	389
464	3300011119	Ga0105246_10058504	Ga0105246_100585042	389
465	3300013100	Ga0157373_10040894	Ga0157373_100408942	389
466	3300013105	Ga0157369_10219981	Ga0157369_102199812	389
467	3300025900	Ga0207710_10016238	Ga0207710_100162382	389
468	3300025904	Ga0207647_10066845	Ga0207647_100668451	389
469	3300025907	Ga0207645_10017703	Ga0207645_100177033	389
470	3300025916	Ga0207663_10035476	Ga0207663_100354761	389
471	3300025918	Ga0207662_10006227	Ga0207662_100062272	389
472	3300025919	Ga0207657_10008369	Ga0207657_100083698	389
473	3300025920	Ga0207649_10034192	Ga0207649_100341923	389
474	3300025927	Ga0207687_10076960	Ga0207687_100769602	389
475	3300025928	Ga0207700_10049186	Ga0207700_100491862	389
476	3300025929	Ga0207664_10033767	Ga0207664_100337674	389
477	3300025931	Ga0207644_10141420	Ga0207644_101414202	389
478	3300025933	Ga0207706_10025704	Ga0207706_100257045	389
479	3300025940	Ga0207691_10018919	Ga0207691_100189194	389
480	3300025941	Ga0207711_10069385	Ga0207711_100693853	389
481	3300025942	Ga0207689_10005874	Ga0207689_100058745	389
482	3300025944	Ga0207661_10131236	Ga0207661_101312361	389
483	3300026023	Ga0207677_10158325	Ga0207677_101583252	389
484	3300026041	Ga0207639_10085774	Ga0207639_100857743	389
485	3300026067	Ga0207678_10002379	Ga0207678_100023799	389
486	3300026078	Ga0207702_10019851	Ga0207702_100198515	389
487	3300026095	Ga0207676_10028982	Ga0207676_100289822	389
488	3300026116	Ga0207674_10015408	Ga0207674_100154086	389
489	3300026121	Ga0207683_10005348	Ga0207683_100053487	389
490	3300026142	Ga0207698_10242361	Ga0207698_102423612	389
491	3300035088	Ga0373940_0010378	Ga0373940_0010378_869_2131	389
492	3300035207	Ga0373942_0013453	Ga0373942_0013453_30_1292	389
493	3300048910	Ga0496107_0015410	Ga0496107_0015410_1008_2270	389
494	3300048914	Ga0496111_0059528	Ga0496111_0059528_1446_2708	389
495	3300048916	Ga0496113_0196184	Ga0496113_0196184_330_1592	389

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

107

387

0.88 PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

144

389

0.84 PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

100

361

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6nlp-assembly2.cif.gz_B	the crystal structure of an abc transporter periplasmic binding protein ydcs from escherichia coli bw25113	0.8712	46	388
4gl0-assembly1.cif.gz_A	putative spermidine/putrescine abc transporter from listeria monocytogenes	0.8535	46	385
2v84-assembly1.cif.gz_A	crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum	0.8525	48	389
6nlp-assembly2.cif.gz_B	the crystal structure of an abc transporter periplasmic binding protein ydcs from escherichia coli bw25113	0.8482	46	388
2v84-assembly1.cif.gz_A	crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum	0.8426	48	389

ID	Description	Score	Start	End	Superfamily
af_P76108_147_279_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9755	157	281	3.40.190.10
af_P76108_33_144_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9398	46	149	3.40.190.10
af_P76108_147_279_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.911	157	281	3.40.190.10
af_Q2G2A8_33_356_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8952	47	387	3.40.190.10
af_P31133_32_136_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8755	49	132	3.40.190.10

ID	Description	Score	Start	End
AF-A0A530M4X2-F1-model_v4	Spermidine/putrescine ABC transporter substrate-binding protein	0.9755	161	269
AF-A0A6J6E1K5-F1-model_v4	Unannotated protein	0.9606	94	385
AF-A0A6J6E1K5-F1-model_v4	Unannotated protein	0.9383	94	385
AF-A0A536BGT0-F1-model_v4	Extracellular solute-binding protein	0.9349	109	389
AF-A0A428WY88-F1-model_v4	Spermidine/putrescine ABC transporter substrate-binding protein	0.9342	168	389

Feature Viewer

pLDDT	pTM	Quality
90.93	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F454674

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

107

387

0.88

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

144

389

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

100

361

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map