metagRoot

F454366

General Info

Members	Datasets	Scaffolds	Average Seq Length
493	258	481	302

Family's Representative Sequence

Representative Sequence	3300001979\|JGI24740J21852_10002637\|JGI24740J21852_100026376
Length	341
Sequence	MTQGCQKERPGEHVNSXPTPGIIIQPIKRRPNGKPINEEILMSYKYLLVDTFDDGTIMRITLNRPDARNAQNRGLLVELGDAFEEAEKDDAVRVVILAAAGKIFSSGHDMGSRQQIADVRPGPDQLESARTKGGSRXATEKRVLQEWHYFXQNTLRWRNLRKITVAQVHGQVLSAGLMLAWCCDLIVAAEDTIFCDVVGARIGMCGMEYFAHPWEFGPRKTKELMLTGDAIDAEEAWRLGMVSKIYPADDLAEKTLAFARRIANVPTMAALMIKESVNQTVDCMGFFNALQASFTLHQLNHAHWAHVHAGTEHDGLPYALPSDGGVDWRDAPPIKLARKDD

Samples

	Sample ID	Description	Type	Environment
1	2508501039	Frankia saprophytica CN3	Isolate	Nodule
2	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
3	2675902999	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
4	2687453743	Frankia colletiae Cc1.17	Isolate	Nodule
5	2773857921	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
6	2773857922	Frankia sp. CcI49	Isolate	Nodule
7	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
8	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
9	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
10	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
11	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
12	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
13	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
14	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
15	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
16	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
17	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
18	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
19	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
20	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
21	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
24	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
25	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
26	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
27	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
28	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
29	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
30	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
31	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
32	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
33	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
34	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
35	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
36	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
37	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
38	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
41	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
46	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
47	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
48	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
51	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
52	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
53	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
54	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
55	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
56	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
57	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
58	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
59	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
60	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
61	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
62	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
63	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
64	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
65	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
66	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
67	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
70	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
71	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
72	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
74	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
76	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
79	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
80	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
81	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
84	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
85	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
86	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
87	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
88	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
89	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
90	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
91	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
127	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
131	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
132	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
133	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
134	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
135	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
136	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
137	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
138	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
139	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
140	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
141	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
142	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
143	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
144	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
145	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
146	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
147	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
148	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
149	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
150	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
151	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
152	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
153	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
154	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
155	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
156	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
157	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
158	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
159	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
160	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
161	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
162	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
163	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
164	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
165	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
166	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
167	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
168	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
169	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
170	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
171	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
172	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
173	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
174	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
175	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
176	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
177	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
178	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
179	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
180	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
181	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
182	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
183	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
184	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
185	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
186	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
187	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
188	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
189	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
190	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
191	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
192	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
193	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
194	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
195	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
196	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
197	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
198	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
199	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
200	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
201	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
202	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
203	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
204	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
205	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
206	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
207	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
208	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
209	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
210	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
211	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
212	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
213	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
214	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
215	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
216	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
220	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
223	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
227	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
235	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
236	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
237	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
238	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
239	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
240	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
241	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
242	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
243	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
244	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
245	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
246	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
247	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
248	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
249	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
250	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
251	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
252	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
253	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
254	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
255	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
256	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
257	8002775197	Frankia nepalensis CN7	Isolate	Nodule
258	8002784119	Frankia sp. AgB1.9	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	96.96
Metatranscriptomes	0.61
Isolates	2.43

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.21
Nodule	1.83
Rhizoplane	6.09
Rhizosphere	71.2
Stem	0
Stem Tuber	0
Unclassified	5.68

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24736J21556_1000153	3300001904	Bacteria	12089
2	JGI24740J21852_10002637	3300001979	Bacteria	8078
3	JGI24740J21852_10041877	3300001979	Unclassified	1376
4	JGI24739J22299_10000099	3300001989	Bacteria	25801
5	JGI24739J22299_10027722	3300001989	Unclassified	1978
6	JGI24737J22298_10002688	3300001990	Bacteria	6285
7	JGI24735J21928_10018184	3300002067	Bacteria	2168
8	rootH2_10160694	3300003320	Bacteria	6999
9	Ga0055540_1004584	3300003792	Bacteria	6144
10	Ga0055540_1016001	3300003792	Bacteria	2154
11	Ga0065704_10018967	3300005289	Bacteria	1744
12	Ga0065704_10116149	3300005289	Bacteria	1859
13	Ga0070658_10000492	3300005327	Bacteria	34327
14	Ga0070683_100409511	3300005329	Bacteria	1293
15	Ga0070670_100158842	3300005331	Bacteria	1959
16	Ga0070666_10025881	3300005335	Bacteria	3827
17	Ga0070680_100000318	3300005336	Bacteria	32327
18	Ga0068868_100321272	3300005338	Bacteria	1319
19	Ga0070660_100012549	3300005339	Bacteria	6053
20	Ga0070689_100557572	3300005340	Bacteria	988
21	Ga0070661_100006224	3300005344	Bacteria	8227
22	Ga0070668_100051176	3300005347	Bacteria	3182
23	Ga0070668_100058935	3300005347	Bacteria	2972
24	Ga0070669_100000266	3300005353	Bacteria	42790
25	Ga0070669_100003802	3300005353	Bacteria	10907
26	Ga0070675_100396159	3300005354	Bacteria	1231
27	Ga0070671_100000005	3300005355	Bacteria	256547
28	Ga0070659_100023990	3300005366	Bacteria	4673
29	Ga0070659_100166572	3300005366	Bacteria	1803
30	Ga0070667_100000669	3300005367	Bacteria	33217
31	Ga0070667_100003928	3300005367	Bacteria	12628
32	Ga0070709_10336060	3300005434	Bacteria	1112
33	Ga0070714_100018305	3300005435	Bacteria	5688
34	Ga0070713_100143553	3300005436	Bacteria	2117
35	Ga0070713_100369686	3300005436	Bacteria	1334
36	Ga0070713_100450703	3300005436	Bacteria	1208
37	Ga0070711_100019001	3300005439	Bacteria	4399
38	Ga0070662_100038359	3300005457	Bacteria	3403
39	Ga0070662_100082199	3300005457	Bacteria	2402
40	Ga0070681_10000185	3300005458	Bacteria	48054
41	Ga0070681_10303785	3300005458	Bacteria	1505
42	Ga0070685_10058235	3300005466	Bacteria	2251
43	Ga0070698_100200866	3300005471	Bacteria	1929
44	Ga0070679_100000187	3300005530	Bacteria	49927
45	Ga0068853_100001070	3300005539	Bacteria	19335
46	Ga0068853_100033511	3300005539	Bacteria	4359
47	Ga0068853_100045826	3300005539	Bacteria	3747
48	Ga0070665_100005188	3300005548	Bacteria	13481
49	Ga0070665_100015836	3300005548	Bacteria	7570
50	Ga0068855_100016038	3300005563	Bacteria	9013
51	Ga0068855_100093678	3300005563	Bacteria	3464
52	Ga0070664_100008406	3300005564	Bacteria	8345
53	Ga0070664_100052214	3300005564	Bacteria	3462
54	Ga0068854_100000516	3300005578	Bacteria	23436
55	Ga0068854_100004329	3300005578	Bacteria	8946
56	Ga0068854_100085840	3300005578	Unclassified	2332
57	Ga0068856_100002709	3300005614	Bacteria	18162
58	Ga0068856_100003650	3300005614	Bacteria	15458
59	Ga0068856_100140762	3300005614	Bacteria	2420
60	Ga0070702_100271897	3300005615	Bacteria	1159
61	Ga0068852_100000087	3300005616	Bacteria	64872
62	Ga0068852_100004798	3300005616	Bacteria	9603
63	Ga0068852_100027458	3300005616	Bacteria	4640
64	Ga0068852_100076522	3300005616	Bacteria	2955
65	Ga0068852_100803208	3300005616	Bacteria	955
66	Ga0068859_100000081	3300005617	Bacteria	87606
67	Ga0068859_100355949	3300005617	Bacteria	1559
68	Ga0068851_10010490	3300005834	Bacteria	4328
69	Ga0068863_100023108	3300005841	Bacteria	5942
70	Ga0068863_100410525	3300005841	Bacteria	1325
71	Ga0068858_100003099	3300005842	Bacteria	16634
72	Ga0068858_100076146	3300005842	Bacteria	3116
73	Ga0068860_100000227	3300005843	Bacteria	87278
74	Ga0068860_100061064	3300005843	Bacteria	3581
75	Ga0068860_100170239	3300005843	Bacteria	2103
76	Ga0068860_100278510	3300005843	Bacteria	1634
77	Ga0068862_100022738	3300005844	Bacteria	5246
78	Ga0068862_100279103	3300005844	Bacteria	1531
79	Ga0081455_10004911	3300005937	Bacteria	14814
80	Ga0081455_10096900	3300005937	Bacteria	2378
81	Ga0081539_10007548	3300005985	Bacteria	9849
82	Ga0070717_10035961	3300006028	Bacteria	4014
83	Ga0075365_10000839	3300006038	Bacteria	12730
84	Ga0075365_10002340	3300006038	Bacteria	9234
85	Ga0075365_10003566	3300006038	Bacteria	8054
86	Ga0075365_10017346	3300006038	Bacteria	4403
87	Ga0075365_10017945	3300006038	Bacteria	4342
88	Ga0075365_10063891	3300006038	Bacteria	2465
89	Ga0075365_10131668	3300006038	Bacteria	1731
90	Ga0075365_10131837	3300006038	Bacteria	1730
91	Ga0075365_10157207	3300006038	Bacteria	1583
92	Ga0075363_100000148	3300006048	Bacteria	17343
93	Ga0075363_100000731	3300006048	Bacteria	11153
94	Ga0075363_100015432	3300006048	Bacteria	3755
95	Ga0075363_100015898	3300006048	Bacteria	3707
96	Ga0075363_100104029	3300006048	Bacteria	1573
97	Ga0075364_10000921	3300006051	Bacteria	15546
98	Ga0075364_10000936	3300006051	Bacteria	15411
99	Ga0075364_10022557	3300006051	Bacteria	3977
100	Ga0075364_10101849	3300006051	Bacteria	1912
101	Ga0075364_10103656	3300006051	Bacteria	1895
102	Ga0075364_10105310	3300006051	Bacteria	1879
103	Ga0075364_10130164	3300006051	Bacteria	1689
104	Ga0070716_100284971	3300006173	Bacteria	1142
105	Ga0070712_100458879	3300006175	Bacteria	1062
106	Ga0075362_10049234	3300006177	Bacteria	1882
107	Ga0075367_10000806	3300006178	Bacteria	12370
108	Ga0075367_10012501	3300006178	Bacteria	4531
109	Ga0075367_10063494	3300006178	Bacteria	2208
110	Ga0075367_10119557	3300006178	Bacteria	1623
111	Ga0075367_10166308	3300006178	Bacteria	1373
112	Ga0075369_10000220	3300006186	Bacteria	16849
113	Ga0075369_10011833	3300006186	Bacteria	3437
114	Ga0075369_10016444	3300006186	Bacteria	2985
115	Ga0075369_10029674	3300006186	Bacteria	2299
116	Ga0075366_10023812	3300006195	Bacteria	3568
117	Ga0075370_10000207	3300006353	Bacteria	20820
118	Ga0075370_10015865	3300006353	Bacteria	4043
119	Ga0075370_10036686	3300006353	Bacteria	2754
120	Ga0075370_10157975	3300006353	Bacteria	1330
121	Ga0075428_100079695	3300006844	Bacteria	3574
122	Ga0075430_100019872	3300006846	Bacteria	5715
123	Ga0075430_100271226	3300006846	Bacteria	1404
124	Ga0075431_100001364	3300006847	Bacteria	22400
125	Ga0075431_100205561	3300006847	Bacteria	2013
126	Ga0075429_100002833	3300006880	Bacteria	14677
127	Ga0075429_100041225	3300006880	Bacteria	4021
128	Ga0075429_100074284	3300006880	Bacteria	2961
129	Ga0097620_100000081	3300006931	Bacteria	87606
130	Ga0097620_100355946	3300006931	Bacteria	1559
131	Ga0105240_10002301	3300009093	Bacteria	30895
132	Ga0105240_10046431	3300009093	Bacteria	5503
133	Ga0105240_10118548	3300009093	Bacteria	3189
134	Ga0105240_10454469	3300009093	Bacteria	1432
135	Ga0111539_10023883	3300009094	Bacteria	7511
136	Ga0111539_10089448	3300009094	Bacteria	3618
137	Ga0111539_10216301	3300009094	Bacteria	2232
138	Ga0105247_10000007	3300009101	Bacteria	409490
139	Ga0105247_10000011	3300009101	Bacteria	296480
140	Ga0105247_10072475	3300009101	Bacteria	2156
141	Ga0114129_10046226	3300009147	Bacteria	6119
142	Ga0114129_10065005	3300009147	Bacteria	5092
143	Ga0114129_10472721	3300009147	Bacteria	1641
144	Ga0114129_10486218	3300009147	Bacteria	1614
145	Ga0105241_10000181	3300009174	Bacteria	47075
146	Ga0105248_10000350	3300009177	Bacteria	53933
147	Ga0105248_10045548	3300009177	Bacteria	4918
148	Ga0105248_10162589	3300009177	Bacteria	2517
149	Ga0105237_10003098	3300009545	Bacteria	20036
150	Ga0105238_10000902	3300009551	Bacteria	30562
151	Ga0105238_10026413	3300009551	Bacteria	5920
152	Ga0105249_10000077	3300009553	Bacteria	141905
153	Ga0105249_10019947	3300009553	Bacteria	5986
154	Ga0105249_10133750	3300009553	Bacteria	2370
155	Ga0105239_10011269	3300010375	Bacteria	9973
156	Ga0157370_10115455	3300013104	Bacteria	2508
157	Ga0157369_10008297	3300013105	Bacteria	11907
158	Ga0157369_10219061	3300013105	Bacteria	1993
159	Ga0163163_10096188	3300014325	Bacteria	2982
160	Ga0157380_10659421	3300014326	Bacteria	1045
161	Ga0206354_11255371	3300020081	Bacteria	1250
162	Ga0213876_10014622	3300021384	Bacteria	4158
163	Ga0213875_10049437	3300021388	Bacteria	1971
164	Ga0224712_10083198	3300022467	Bacteria	1326
165	Ga0209051_1000558	3300025303	Bacteria	45355
166	Ga0209051_1000657	3300025303	Bacteria	39033
167	Ga0209051_1008038	3300025303	Bacteria	5652
168	Ga0207697_10106380	3300025315	Bacteria	1199
169	Ga0207710_10000006	3300025900	Bacteria	538831
170	Ga0207710_10000013	3300025900	Bacteria	409402
171	Ga0207710_10077474	3300025900	Bacteria	1536
172	Ga0207647_10000033	3300025904	Bacteria	100573
173	Ga0207647_10058008	3300025904	Bacteria	2372
174	Ga0207699_10163440	3300025906	Bacteria	1484
175	Ga0207699_10390680	3300025906	Bacteria	989
176	Ga0207705_10000073	3300025909	Bacteria	124226
177	Ga0207705_10086821	3300025909	Bacteria	2287
178	Ga0207654_10001628	3300025911	Bacteria	11732
179	Ga0207707_10000339	3300025912	Bacteria	49412
180	Ga0207707_10285411	3300025912	Bacteria	1429
181	Ga0207695_10000455	3300025913	Bacteria	89158
182	Ga0207695_10008997	3300025913	Bacteria	12425
183	Ga0207671_10015018	3300025914	Bacteria	6087
184	Ga0207663_10239675	3300025916	Bacteria	1330
185	Ga0207660_10000176	3300025917	Bacteria	40967
186	Ga0207657_10115259	3300025919	Bacteria	2215
187	Ga0207652_10000316	3300025921	Bacteria	49842
188	Ga0207681_10000247	3300025923	Bacteria	41199
189	Ga0207681_10001782	3300025923	Bacteria	13828
190	Ga0207681_10002805	3300025923	Bacteria	11027
191	Ga0207694_10000591	3300025924	Bacteria	32736
192	Ga0207694_10028198	3300025924	Bacteria	4280
193	Ga0207650_10120799	3300025925	Bacteria	2040
194	Ga0207664_10118877	3300025929	Bacteria	2209
195	Ga0207644_10000008	3300025931	Bacteria	354219
196	Ga0207690_10017122	3300025932	Bacteria	4421
197	Ga0207706_10045873	3300025933	Bacteria	3871
198	Ga0207706_10116364	3300025933	Bacteria	2351
199	Ga0207665_10048419	3300025939	Bacteria	2853
200	Ga0207711_10000050	3300025941	Bacteria	141052
201	Ga0207711_10020144	3300025941	Bacteria	5558
202	Ga0207711_10102640	3300025941	Bacteria	2532
203	Ga0207667_10002221	3300025949	Bacteria	24376
204	Ga0207667_10332049	3300025949	Bacteria	1552
205	Ga0207712_10046031	3300025961	Bacteria	3023
206	Ga0207668_10000078	3300025972	Bacteria	73213
207	Ga0207640_10001459	3300025981	Bacteria	12792
208	Ga0207640_10002739	3300025981	Bacteria	9430
209	Ga0207640_10186238	3300025981	Bacteria	1561
210	Ga0207640_10240186	3300025981	Unclassified	1399
211	Ga0207658_10000222	3300025986	Bacteria	59649
212	Ga0207658_10010949	3300025986	Bacteria	6175
213	Ga0207658_10011491	3300025986	Bacteria	6027
214	Ga0207658_10055634	3300025986	Bacteria	2933
215	Ga0207658_10066869	3300025986	Bacteria	2705
216	Ga0207658_10412925	3300025986	Bacteria	1189
217	Ga0207703_10003268	3300026035	Bacteria	13604
218	Ga0207639_10006640	3300026041	Bacteria	7867
219	Ga0207639_10052454	3300026041	Bacteria	3108
220	Ga0207702_10002566	3300026078	Bacteria	17086
221	Ga0207702_10009596	3300026078	Bacteria	8125
222	Ga0207641_10040590	3300026088	Bacteria	3898
223	Ga0207641_10150213	3300026088	Bacteria	2109
224	Ga0207648_10167365	3300026089	Bacteria	1942
225	Ga0207676_10243300	3300026095	Bacteria	1615
226	Ga0207698_10000308	3300026142	Bacteria	29436
227	Ga0207698_10000889	3300026142	Bacteria	17338
228	Ga0207698_10054949	3300026142	Bacteria	3066
229	Ga0207428_10008749	3300027907	Bacteria	9131
230	Ga0207428_10047603	3300027907	Bacteria	3443
231	Ga0268266_10017671	3300028379	Bacteria	6081
232	Ga0268266_10035068	3300028379	Bacteria	4267
233	Ga0268266_10543172	3300028379	Bacteria	1113
234	Ga0268265_10033881	3300028380	Bacteria	3717
235	Ga0268265_10122964	3300028380	Bacteria	2142
236	Ga0268264_10000152	3300028381	Bacteria	157374
237	Ga0265338_10003981	3300028800	Bacteria	20335
238	Ga0265327_10001233	3300031251	Bacteria	34340
239	Ga0265327_10012790	3300031251	Bacteria	5631
240	Ga0265327_10016196	3300031251	Bacteria	4755
241	Ga0265327_10037072	3300031251	Bacteria	2674
242	Ga0265327_10060127	3300031251	Bacteria	1943
243	Ga0307408_100000218	3300031548	Bacteria	61214
244	Ga0316579_10133867	3300031691	Bacteria	1194
245	Ga0316576_10002061	3300031727	Bacteria	11281
246	Ga0316578_10015618	3300031728	Bacteria	4087
247	Ga0307405_10000164	3300031731	Bacteria	24420
248	Ga0316577_10014182	3300031733	Bacteria	4375
249	Ga0307406_10411993	3300031901	Bacteria	1074
250	Ga0307412_10000510	3300031911	Bacteria	23221
251	Ga0307412_10203591	3300031911	Bacteria	1505
252	Ga0307414_10222140	3300032004	Bacteria	1552
253	Ga0307411_10160697	3300032005	Bacteria	1682
254	Ga0316585_10071558	3300032137	Bacteria	1126
255	Ga0316214_1001037	3300033545	Bacteria	3104
256	Ga0373955_0097466	3300035172	Bacteria	1684
257	Ga0316574_0068230	3300035398	Bacteria	2242
258	Ga0373933_0060919	3300035724	Bacteria	2276
259	Ga0373937_0007419	3300036401	Bacteria	9492
260	Ga0373937_0010059	3300036401	Bacteria	8248
261	Ga0373937_0560169	3300036401	Bacteria	1086
262	Ga0372808_012483	3300036459	Bacteria	1206
263	Ga0316582_0079977	3300036647	Bacteria	2132
264	Ga0316584_0008993	3300036712	Bacteria	6909
265	Ga0316584_0010196	3300036712	Bacteria	6560
266	Ga0316584_0052548	3300036712	Bacteria	3048
267	Ga0316584_0356414	3300036712	Bacteria	1049
268	Ga0395905_0342975	3300037471	Bacteria	1385
269	Ga0436364_0510194	3300037853	Bacteria	7107
270	Ga0436364_0897091	3300037853	Bacteria	3853
271	Ga0436364_1072357	3300037853	Bacteria	1846
272	Ga0436365_1863563	3300039437	Bacteria	3788
273	Ga0436363_0752110	3300039450	Bacteria	824
274	Ga0436363_1018007	3300039450	Bacteria	1223
275	Ga0439465_0000163	3300041413	Bacteria	16851
276	Ga0439465_0017197	3300041413	Bacteria	2257
277	Ga0451795_1421576	3300041456	Bacteria	1537
278	Ga0451837_0159079	3300041494	Bacteria	2332
279	Ga0439431_0064081	3300041997	Bacteria	971
280	Ga0439434_0003196	3300042435	Bacteria	4810
281	Ga0466958_0191486	3300045836	Bacteria	1300
282	Ga0495603_0192912	3300046455	Bacteria	1178
283	Ga0495641_0206087	3300046461	Bacteria	881
284	Ga0495651_0027399	3300046462	Bacteria	4438
285	Ga0495651_0083620	3300046462	Bacteria	2406
286	Ga0495653_0053396	3300046463	Bacteria	3092
287	Ga0495653_0171358	3300046463	Bacteria	1498
288	Ga0495582_0077227	3300046473	Bacteria	1847
289	Ga0495639_0153442	3300046475	Bacteria	1112
290	Ga0495608_0115234	3300046511	Bacteria	1725
291	Ga0495608_0194967	3300046511	Bacteria	1278
292	Ga0495616_0090254	3300046513	Bacteria	1452
293	Ga0495618_0062290	3300046514	Bacteria	2367
294	Ga0495618_0063092	3300046514	Bacteria	2352
295	Ga0495628_0005768	3300046516	Bacteria	10848
296	Ga0495628_0063561	3300046516	Bacteria	2891
297	Ga0495628_0317682	3300046516	Bacteria	1150
298	Ga0495630_0049182	3300046517	Bacteria	3155
299	Ga0495630_0131396	3300046517	Bacteria	1901
300	Ga0495666_0091843	3300046526	Bacteria	1432
301	Ga0495652_0096968	3300046529	Bacteria	2400
302	Ga0495640_0008850	3300046533	Bacteria	7869
303	Ga0495640_0088768	3300046533	Bacteria	2043
304	Ga0495640_0127536	3300046533	Bacteria	1649
305	Ga0495586_0015082	3300046535	Bacteria	4110
306	Ga0495587_0013474	3300046536	Bacteria	5138
307	Ga0495587_0236375	3300046536	Bacteria	1029
308	Ga0495667_0008664	3300046559	Bacteria	6905
309	Ga0495667_0015420	3300046559	Bacteria	5162
310	Ga0495667_0091674	3300046559	Bacteria	1968
311	Ga0495667_0096617	3300046559	Bacteria	1912
312	Ga0495634_0006042	3300046642	Bacteria	9236
313	Ga0495657_0004257	3300046675	Bacteria	11444
314	Ga0495657_0006036	3300046675	Bacteria	9512
315	Ga0495657_0028749	3300046675	Bacteria	3906
316	Ga0495657_0061456	3300046675	Bacteria	2485
317	Ga0495657_0173382	3300046675	Bacteria	1327
318	Ga0495599_0200277	3300046678	Bacteria	1227
319	Ga0495623_0016954	3300046679	Bacteria	4705
320	Ga0495623_0032096	3300046679	Bacteria	3376
321	Ga0495647_0016212	3300046681	Bacteria	2621
322	Ga0495613_0000365	3300046689	Bacteria	39454
323	Ga0495624_0077770	3300046690	Bacteria	2058
324	Ga0495624_0127679	3300046690	Bacteria	1560
325	Ga0495600_0013817	3300046809	Bacteria	5085
326	Ga0495600_0036771	3300046809	Bacteria	3182
327	Ga0495600_0057903	3300046809	Bacteria	2531
328	Ga0495581_0103675	3300047315	Bacteria	1653
329	Ga0495604_0140716	3300047317	Bacteria	1724
330	Ga0495604_0154780	3300047317	Bacteria	1625
331	Ga0495604_0297703	3300047317	Bacteria	1084
332	Ga0495674_0166310	3300047319	Bacteria	1843
333	Ga0495674_0175050	3300047319	Bacteria	1789
334	Ga0495674_0347040	3300047319	Bacteria	1205
335	Ga0495676_0233123	3300047321	Bacteria	1264
336	Ga0495680_0026264	3300047322	Bacteria	4804
337	Ga0495680_0034190	3300047322	Bacteria	4109
338	Ga0495680_0056330	3300047322	Bacteria	3044
339	Ga0495680_0067130	3300047322	Bacteria	2743
340	Ga0495680_0095128	3300047322	Bacteria	2228
341	Ga0495687_001096	3300047443	Bacteria	26465
342	Ga0495684_0045913	3300047471	Bacteria	3342
343	Ga0495602_0051769	3300048088	Bacteria	3654
344	Ga0495602_0413237	3300048088	Bacteria	960
345	Ga0496100_0055640	3300048903	Bacteria	2585
346	Ga0496100_0056639	3300048903	Bacteria	2565
347	Ga0496100_0227362	3300048903	Bacteria	1371
348	Ga0496101_0042650	3300048904	Bacteria	3239
349	Ga0496101_0053543	3300048904	Bacteria	2912
350	Ga0496101_0139401	3300048904	Bacteria	1847
351	Ga0496101_0335772	3300048904	Bacteria	1186
352	Ga0496102_0000171	3300048905	Bacteria	87903
353	Ga0496102_0026393	3300048905	Bacteria	5181
354	Ga0496102_0035192	3300048905	Bacteria	4506
355	Ga0496102_0573810	3300048905	Bacteria	1051
356	Ga0496103_0057381	3300048906	Bacteria	2417
357	Ga0496104_0060681	3300048907	Bacteria	3583
358	Ga0496105_0053004	3300048908	Bacteria	3350
359	Ga0496106_0003537	3300048909	Bacteria	11629
360	Ga0496106_0363341	3300048909	Bacteria	1163
361	Ga0496107_0000222	3300048910	Bacteria	30025
362	Ga0496107_0029947	3300048910	Bacteria	3877
363	Ga0496108_0126257	3300048911	Bacteria	2196
364	Ga0496108_0172427	3300048911	Bacteria	1872
365	Ga0496109_0146484	3300048912	Bacteria	2210
366	Ga0496109_0251205	3300048912	Bacteria	1665
367	Ga0496112_0037528	3300048915	Bacteria	4728
368	Ga0496112_0197232	3300048915	Bacteria	1973
369	Ga0496112_0211781	3300048915	Bacteria	1895
370	Ga0496113_0092892	3300048916	Bacteria	2328
371	Ga0496113_0208891	3300048916	Bacteria	1553
372	Ga0496113_0465457	3300048916	Bacteria	1016
373	Ga0496115_0095177	3300048918	Bacteria	2437
374	Ga0496116_0049348	3300048919	Bacteria	2816
375	Ga0496117_0000149	3300048920	Bacteria	149137
376	Ga0496117_0035174	3300048920	Bacteria	3764
377	Ga0496118_0000049	3300048921	Bacteria	251875
378	Ga0496118_0000194	3300048921	Bacteria	107296
379	Ga0496119_0004736	3300048922	Bacteria	13371
380	Ga0496120_0015586	3300048923	Bacteria	5006
381	Ga0496121_0000172	3300048924	Bacteria	143849
382	Ga0496121_0018489	3300048924	Bacteria	7023
383	Ga0496124_0000330	3300048927	Bacteria	87622
384	Ga0496125_0009028	3300048928	Bacteria	10325
385	Ga0496125_0020360	3300048928	Bacteria	6224
386	Ga0496126_0000180	3300048929	Bacteria	142694
387	Ga0496126_0028334	3300048929	Bacteria	5339
388	Ga0501034_0000146	3300049571	Bacteria	132818
389	Ga0501034_0000361	3300049571	Bacteria	77566
390	Ga0501034_0004292	3300049571	Bacteria	15883
391	Ga0501034_0014597	3300049571	Bacteria	8087
392	Ga0501034_0074496	3300049571	Bacteria	3402
393	Ga0501036_0105247	3300049572	Bacteria	2386
394	Ga0501037_0032681	3300049573	Bacteria	3843
395	Ga0501037_0213401	3300049573	Bacteria	1360
396	Ga0501038_0140749	3300049574	Bacteria	1974
397	Ga0501043_0039114	3300049579	Bacteria	3728
398	Ga0501046_0004567	3300049580	Bacteria	12532
399	Ga0501047_0003640	3300049581	Bacteria	14524
400	Ga0501047_0040294	3300049581	Bacteria	4517
401	Ga0501068_0000583	3300049584	Bacteria	18501
402	Ga0501070_0002616	3300049586	Bacteria	15722
403	Ga0501070_0005775	3300049586	Bacteria	10555
404	Ga0501070_0012211	3300049586	Bacteria	7248
405	Ga0501070_0172730	3300049586	Bacteria	1780
406	Ga0501070_0430485	3300049586	Bacteria	1065
407	Ga0501071_0004599	3300049587	Bacteria	8754
408	Ga0501072_0000513	3300049588	Bacteria	27844
409	Ga0501073_0001818	3300049589	Bacteria	15876
410	Ga0501073_0003035	3300049589	Bacteria	12589
411	Ga0501073_0121657	3300049589	Bacteria	1809
412	Ga0501073_0366122	3300049589	Bacteria	996
413	Ga0501074_0002125	3300049590	Bacteria	13689
414	Ga0501074_0004463	3300049590	Bacteria	10013
415	Ga0501076_0029003	3300049592	Bacteria	4301
416	Ga0501079_0000038	3300049741	Bacteria	56523
417	Ga0501079_0306390	3300049741	Bacteria	1243
418	Ga0501080_0001092	3300049742	Bacteria	22354
419	Ga0501080_0007112	3300049742	Bacteria	10103
420	Ga0501080_0025341	3300049742	Bacteria	5503
421	Ga0501080_0259963	3300049742	Bacteria	1582
422	Ga0501080_0412310	3300049742	Bacteria	1214
423	Ga0501083_0001183	3300049744	Bacteria	17620
424	Ga0501083_0020766	3300049744	Bacteria	4566
425	Ga0501044_0001182	3300049823	Bacteria	30912
426	Ga0501044_0036228	3300049823	Bacteria	5162
427	Ga0501044_0096720	3300049823	Bacteria	2974
428	nmdc:mga03683_2011_c1	3300050489	Bacteria	6220
429	nmdc:mga03n38_55733_c1	3300050490	Bacteria	1782
430	nmdc:mga03n38_58519_c1	3300050490	Bacteria	1746
431	nmdc:mga03n38_69770_c1	3300050490	Bacteria	1624
432	nmdc:mga00v17_18579_c1	3300050491	Bacteria	3952
433	nmdc:mga00v17_20730_c1	3300050491	Bacteria	3770
434	nmdc:mga00v17_2857_c1	3300050491	Bacteria	8855
435	nmdc:mga00v17_33772_c1	3300050491	Bacteria	3034
436	nmdc:mga00v17_61267_c1	3300050491	Bacteria	2312
437	nmdc:mga00v17_86260_c1	3300050491	Bacteria	1967
438	nmdc:mga0yw44_1221_c1	3300050492	Bacteria	8244
439	nmdc:mga0yw44_153325_c1	3300050492	Bacteria	1504
440	nmdc:mga0yw44_5339_c1	3300050492	Bacteria	6049
441	nmdc:mga0yw44_83302_c1	3300050492	Bacteria	2009
442	nmdc:mga0yw44_92977_c1	3300050492	Bacteria	1909
443	nmdc:mga06z11_1106_c1	3300050494	Bacteria	9845
444	nmdc:mga06z11_200749_c1	3300050494	Bacteria	1158
445	nmdc:mga06z11_47777_c1	3300050494	Bacteria	2175
446	nmdc:mga07m45_12930_c1	3300050496	Bacteria	4417
447	nmdc:mga07m45_25334_c1	3300050496	Bacteria	3253
448	nmdc:mga07m45_41334_c1	3300050496	Bacteria	2582
449	nmdc:mga05p37_23195_c1	3300050507	Bacteria	7529
450	nmdc:mga05p37_367661_c1	3300050507	Bacteria	1689
451	nmdc:mga05p37_517952_c1	3300050507	Bacteria	1365
452	nmdc:mga0qj67_21069_c1	3300050509	Bacteria	4997
453	nmdc:mga0qj67_6605_c1	3300050509	Bacteria	8521
454	nmdc:mga0qj67_98803_c1	3300050509	Bacteria	2352
455	nmdc:mga06r32_19915_c1	3300050510	Bacteria	6168
456	nmdc:mga06r32_22812_c1	3300050510	Bacteria	5790
457	nmdc:mga06r32_71778_c1	3300050510	Bacteria	3351
458	nmdc:mga08y16_143867_c1	3300050511	Bacteria	2479
459	nmdc:mga08y16_28457_c1	3300050511	Bacteria	5892
460	nmdc:mga08y16_79563_c1	3300050511	Bacteria	3416
461	nmdc:mga0sz30_11195_c1	3300050516	Bacteria	3456
462	nmdc:mga0sz30_526_c1	3300050516	Bacteria	14293
463	nmdc:mga0sz30_6526_c1	3300050516	Bacteria	4334
464	nmdc:mga0sz30_91_c2	3300050516	Bacteria	15836
465	Ga0495601_0051953	3300053077	Bacteria	2587
466	Ga0495601_0193365	3300053077	Bacteria	1330
467	Ga0495595_0007765	3300053084	Bacteria	4393
468	Ga0495619_0045910	3300053085	Bacteria	2871
469	Ga0495619_0091458	3300053085	Bacteria	2060
470	Ga0495619_0109140	3300053085	Bacteria	1889
471	Ga0500643_004742	3300053087	Bacteria	6038
472	Ga0500566_0115430	3300053094	Bacteria	1454
473	Ga0500562_000637	3300053108	Bacteria	8476
474	Ga0500562_013667	3300053108	Bacteria	2076
475	Ga0500562_019782	3300053108	Bacteria	1744
476	Ga0500652_000161	3300053131	Bacteria	25766
477	Ga0500559_0027469	3300053136	Bacteria	2429
478	Ga0500604_0044943	3300053151	Bacteria	1346
479	Ga0500616_0001970	3300053153	Bacteria	18263
480	Ga0501084_0000675	3300054114	Bacteria	26009
481	Ga0501082_0201041	3300060353	Bacteria	1734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300039450	Ga0436363_0752110	Ga0436363_0752110_21_812	255
2	3300050494	nmdc:mga06z11_200749_c1	nmdc:mga06z11_200749_c1_29_847	259
3	3300048916	Ga0496113_0092892	Ga0496113_0092892_1495_2301	263
4	3300048916	Ga0496113_0465457	Ga0496113_0465457_199_1005	263
5	3300050491	nmdc:mga00v17_86260_c1	nmdc:mga00v17_86260_c1_1134_1940	263
6	3300046461	Ga0495641_0206087	Ga0495641_0206087_15_860	276
7	3300042435	Ga0439434_0003196	Ga0439434_0003196_1704_2606	283
8	3300046475	Ga0495639_0153442	Ga0495639_0153442_19_885	283
9	3300046517	Ga0495630_0049182	Ga0495630_0049182_1272_2186	285
10	3300037853	Ga0436364_0510194	Ga0436364_0510194_630_1520	291
11	3300039437	Ga0436365_1863563	Ga0436365_1863563_1840_2730	291
12	3300005458	Ga0070681_10303785	Ga0070681_103037852	292
13	3300006038	Ga0075365_10131668	Ga0075365_101316682	292
14	3300006051	Ga0075364_10101849	Ga0075364_101018492	292
15	3300006178	Ga0075367_10119557	Ga0075367_101195572	292
16	3300009093	Ga0105240_10118548	Ga0105240_101185484	292
17	3300014326	Ga0157380_10659421	Ga0157380_106594212	292
18	3300025912	Ga0207707_10285411	Ga0207707_102854112	292
19	3300037471	Ga0395905_0342975	Ga0395905_0342975_301_1194	292
20	3300050494	nmdc:mga06z11_47777_c1	nmdc:mga06z11_47777_c1_709_1608	292
21	3300006038	Ga0075365_10017945	Ga0075365_100179454	293
22	3300006048	Ga0075363_100015898	Ga0075363_1000158981	293
23	3300006051	Ga0075364_10000936	Ga0075364_100009367	293
24	3300006178	Ga0075367_10166308	Ga0075367_101663082	293
25	3300025981	Ga0207640_10186238	Ga0207640_101862381	293
26	3300031251	Ga0265327_10001233	Ga0265327_100012337	293
27	3300031901	Ga0307406_10411993	Ga0307406_104119931	293
28	3300032004	Ga0307414_10222140	Ga0307414_102221402	293
29	3300035172	Ga0373955_0097466	Ga0373955_0097466_450_1352	293
30	3300035724	Ga0373933_0060919	Ga0373933_0060919_1286_2188	293
31	3300036401	Ga0373937_0010059	Ga0373937_0010059_3184_4086	293
32	3300036712	Ga0316584_0356414	Ga0316584_0356414_14_919	293
33	3300041494	Ga0451837_0159079	Ga0451837_0159079_924_1820	293
34	3300046462	Ga0495651_0027399	Ga0495651_0027399_3279_4181	293
35	3300046511	Ga0495608_0194967	Ga0495608_0194967_258_1160	293
36	3300046533	Ga0495640_0088768	Ga0495640_0088768_549_1445	293
37	3300046535	Ga0495586_0015082	Ga0495586_0015082_2650_3546	293
38	3300046559	Ga0495667_0008664	Ga0495667_0008664_1737_2639	293
39	3300046642	Ga0495634_0006042	Ga0495634_0006042_1249_2145	293
40	3300046675	Ga0495657_0006036	Ga0495657_0006036_2635_3537	293
41	3300046679	Ga0495623_0016954	Ga0495623_0016954_3184_4086	293
42	3300046689	Ga0495613_0000365	Ga0495613_0000365_26601_27497	293
43	3300046690	Ga0495624_0127679	Ga0495624_0127679_113_1012	293
44	3300046809	Ga0495600_0013817	Ga0495600_0013817_1983_2885	293
45	3300047315	Ga0495581_0103675	Ga0495581_0103675_234_1133	293
46	3300047317	Ga0495604_0154780	Ga0495604_0154780_593_1495	293
47	3300047321	Ga0495676_0233123	Ga0495676_0233123_101_1000	293
48	3300047322	Ga0495680_0026264	Ga0495680_0026264_1238_2140	293
49	3300047322	Ga0495680_0034190	Ga0495680_0034190_468_1364	293
50	3300048088	Ga0495602_0051769	Ga0495602_0051769_313_1215	293
51	3300049571	Ga0501034_0000146	Ga0501034_0000146_47782_48678	293
52	3300049573	Ga0501037_0032681	Ga0501037_0032681_1513_2409	293
53	3300049584	Ga0501068_0000583	Ga0501068_0000583_6137_7033	293
54	3300049586	Ga0501070_0002616	Ga0501070_0002616_13276_14172	293
55	3300049587	Ga0501071_0004599	Ga0501071_0004599_7033_7929	293
56	3300049588	Ga0501072_0000513	Ga0501072_0000513_25157_26053	293
57	3300049589	Ga0501073_0001818	Ga0501073_0001818_13103_13999	293
58	3300049589	Ga0501073_0003035	Ga0501073_0003035_1986_2882	293
59	3300049590	Ga0501074_0004463	Ga0501074_0004463_4961_5857	293
60	3300049592	Ga0501076_0029003	Ga0501076_0029003_3325_4221	293
61	3300049742	Ga0501080_0001092	Ga0501080_0001092_14569_15465	293
62	3300049744	Ga0501083_0001183	Ga0501083_0001183_13404_14300	293
63	3300049744	Ga0501083_0020766	Ga0501083_0020766_3349_4245	293
64	3300050491	nmdc:mga00v17_20730_c1	nmdc:mga00v17_20730_c1_2130_3050	293
65	3300050492	nmdc:mga0yw44_83302_c1	nmdc:mga0yw44_83302_c1_948_1868	293
66	3300053094	Ga0500566_0115430	Ga0500566_0115430_422_1318	293
67	3300054114	Ga0501084_0000675	Ga0501084_0000675_17000_17896	293
68	3300060353	Ga0501082_0201041	Ga0501082_0201041_470_1366	293
69	iso_pu_bacteria	2523231044	2523384303	293
70	iso_pu_bacteria	2675902999	2676199820	293
71	iso_pu_bacteria	2773857921	2774844398	293
72	iso_pu_bacteria	2902837492	2902838332	293
73	3300049574	Ga0501038_0140749	Ga0501038_0140749_153_1052	294
74	iso_pu_bacteria	2902799365	2902804583	294
75	3300025909	Ga0207705_10086821	Ga0207705_100868212	295
76	3300031691	Ga0316579_10133867	Ga0316579_101338672	295
77	3300031727	Ga0316576_10002061	Ga0316576_100020619	295
78	3300031728	Ga0316578_10015618	Ga0316578_100156184	295
79	3300031733	Ga0316577_10014182	Ga0316577_100141822	295
80	3300032137	Ga0316585_10071558	Ga0316585_100715581	295
81	3300035398	Ga0316574_0068230	Ga0316574_0068230_1278_2168	295
82	3300036647	Ga0316582_0079977	Ga0316582_0079977_53_943	295
83	3300036712	Ga0316584_0008993	Ga0316584_0008993_4466_5356	295
84	3300036712	Ga0316584_0010196	Ga0316584_0010196_4466_5356	295
85	iso_pu_bacteria	2508501039	2508676416	295
86	iso_pu_bacteria	2675902999	2676198466	295
87	iso_pu_bacteria	2687453743	2689991481	295
88	iso_pu_bacteria	2773857921	2774843044	295
89	iso_pu_bacteria	8002775197	8002775345	295
90	iso_pu_bacteria	8002784119	8002788194	295
91	3300005338	Ga0068868_100321272	Ga0068868_1003212721	296
92	3300005616	Ga0068852_100803208	Ga0068852_1008032081	296
93	3300005841	Ga0068863_100410525	Ga0068863_1004105252	296
94	3300005842	Ga0068858_100003099	Ga0068858_10000309917	296
95	3300005843	Ga0068860_100278510	Ga0068860_1002785101	296
96	3300006038	Ga0075365_10131837	Ga0075365_101318372	296
97	3300020081	Ga0206354_11255371	Ga0206354_112553712	296
98	3300022467	Ga0224712_10083198	Ga0224712_100831982	296
99	3300026035	Ga0207703_10003268	Ga0207703_100032683	296
100	3300026088	Ga0207641_10040590	Ga0207641_100405903	296
101	3300037853	Ga0436364_1072357	Ga0436364_1072357_213_1124	296
102	3300046513	Ga0495616_0090254	Ga0495616_0090254_216_1121	296
103	3300046681	Ga0495647_0016212	Ga0495647_0016212_1655_2560	296
104	3300048905	Ga0496102_0573810	Ga0496102_0573810_106_1011	296
105	3300048911	Ga0496108_0172427	Ga0496108_0172427_747_1649	296
106	3300049571	Ga0501034_0014597	Ga0501034_0014597_1889_2845	296
107	3300003320	rootH2_10160694	rootH2_101606944	297
108	3300003792	Ga0055540_1016001	Ga0055540_10160012	297
109	3300005329	Ga0070683_100409511	Ga0070683_1004095111	297
110	3300005347	Ga0070668_100058935	Ga0070668_1000589352	297
111	3300005353	Ga0070669_100003802	Ga0070669_1000038028	297
112	3300005367	Ga0070667_100000669	Ga0070667_1000006691	297
113	3300005434	Ga0070709_10336060	Ga0070709_103360602	297
114	3300005435	Ga0070714_100018305	Ga0070714_1000183054	297
115	3300005436	Ga0070713_100369686	Ga0070713_1003696862	297
116	3300005436	Ga0070713_100450703	Ga0070713_1004507032	297
117	3300005439	Ga0070711_100019001	Ga0070711_1000190011	297
118	3300005471	Ga0070698_100200866	Ga0070698_1002008662	297
119	3300005548	Ga0070665_100015836	Ga0070665_1000158363	297
120	3300005617	Ga0068859_100000081	Ga0068859_1000000812	297
121	3300005843	Ga0068860_100000227	Ga0068860_1000002272	297
122	3300005843	Ga0068860_100061064	Ga0068860_1000610642	297
123	3300005937	Ga0081455_10004911	Ga0081455_1000491112	297
124	3300005937	Ga0081455_10096900	Ga0081455_100969002	297
125	3300006028	Ga0070717_10035961	Ga0070717_100359614	297
126	3300006038	Ga0075365_10000839	Ga0075365_1000083911	297
127	3300006038	Ga0075365_10002340	Ga0075365_100023409	297
128	3300006038	Ga0075365_10017346	Ga0075365_100173463	297
129	3300006038	Ga0075365_10157207	Ga0075365_101572071	297
130	3300006048	Ga0075363_100000148	Ga0075363_10000014810	297
131	3300006048	Ga0075363_100000731	Ga0075363_1000007318	297
132	3300006048	Ga0075363_100015432	Ga0075363_1000154324	297
133	3300006048	Ga0075363_100104029	Ga0075363_1001040292	297
134	3300006051	Ga0075364_10000921	Ga0075364_100009218	297
135	3300006051	Ga0075364_10103656	Ga0075364_101036562	297
136	3300006051	Ga0075364_10105310	Ga0075364_101053102	297
137	3300006051	Ga0075364_10130164	Ga0075364_101301642	297
138	3300006173	Ga0070716_100284971	Ga0070716_1002849711	297
139	3300006175	Ga0070712_100458879	Ga0070712_1004588792	297
140	3300006177	Ga0075362_10049234	Ga0075362_100492342	297
141	3300006178	Ga0075367_10000806	Ga0075367_100008063	297
142	3300006178	Ga0075367_10012501	Ga0075367_100125014	297
143	3300006178	Ga0075367_10063494	Ga0075367_100634941	297
144	3300006186	Ga0075369_10000220	Ga0075369_100002204	297
145	3300006186	Ga0075369_10011833	Ga0075369_100118332	297
146	3300006186	Ga0075369_10016444	Ga0075369_100164442	297
147	3300006186	Ga0075369_10029674	Ga0075369_100296742	297
148	3300006195	Ga0075366_10023812	Ga0075366_100238121	297
149	3300006353	Ga0075370_10000207	Ga0075370_100002079	297
150	3300006353	Ga0075370_10015865	Ga0075370_100158653	297
151	3300006353	Ga0075370_10036686	Ga0075370_100366862	297
152	3300006353	Ga0075370_10157975	Ga0075370_101579752	297
153	3300006844	Ga0075428_100079695	Ga0075428_1000796954	297
154	3300006846	Ga0075430_100019872	Ga0075430_1000198723	297
155	3300006846	Ga0075430_100271226	Ga0075430_1002712263	297
156	3300006847	Ga0075431_100001364	Ga0075431_10000136415	297
157	3300006847	Ga0075431_100205561	Ga0075431_1002055612	297
158	3300006880	Ga0075429_100002833	Ga0075429_1000028333	297
159	3300006880	Ga0075429_100074284	Ga0075429_1000742841	297
160	3300006931	Ga0097620_100000081	Ga0097620_1000000812	297
161	3300009093	Ga0105240_10454469	Ga0105240_104544692	297
162	3300009094	Ga0111539_10023883	Ga0111539_100238833	297
163	3300009094	Ga0111539_10089448	Ga0111539_100894481	297
164	3300009094	Ga0111539_10216301	Ga0111539_102163012	297
165	3300009101	Ga0105247_10000007	Ga0105247_10000007350	297
166	3300009147	Ga0114129_10046226	Ga0114129_100462266	297
167	3300009147	Ga0114129_10472721	Ga0114129_104727212	297
168	3300009177	Ga0105248_10000350	Ga0105248_100003502	297
169	3300009553	Ga0105249_10000077	Ga0105249_1000007756	297
170	3300009553	Ga0105249_10019947	Ga0105249_100199473	297
171	3300013105	Ga0157369_10219061	Ga0157369_102190613	297
172	3300021384	Ga0213876_10014622	Ga0213876_100146223	297
173	3300021388	Ga0213875_10049437	Ga0213875_100494372	297
174	3300025303	Ga0209051_1000657	Ga0209051_100065733	297
175	3300025303	Ga0209051_1008038	Ga0209051_10080381	297
176	3300025900	Ga0207710_10000013	Ga0207710_10000013349	297
177	3300025906	Ga0207699_10163440	Ga0207699_101634402	297
178	3300025906	Ga0207699_10390680	Ga0207699_103906801	297
179	3300025916	Ga0207663_10239675	Ga0207663_102396752	297
180	3300025923	Ga0207681_10001782	Ga0207681_100017823	297
181	3300025929	Ga0207664_10118877	Ga0207664_101188772	297
182	3300025939	Ga0207665_10048419	Ga0207665_100484193	297
183	3300025941	Ga0207711_10000050	Ga0207711_1000005030	297
184	3300025961	Ga0207712_10046031	Ga0207712_100460313	297
185	3300025986	Ga0207658_10000222	Ga0207658_100002222	297
186	3300025986	Ga0207658_10011491	Ga0207658_100114912	297
187	3300025986	Ga0207658_10055634	Ga0207658_100556342	297
188	3300025986	Ga0207658_10066869	Ga0207658_100668693	297
189	3300026088	Ga0207641_10150213	Ga0207641_101502132	297
190	3300027907	Ga0207428_10008749	Ga0207428_100087498	297
191	3300027907	Ga0207428_10047603	Ga0207428_100476033	297
192	3300028379	Ga0268266_10035068	Ga0268266_100350683	297
193	3300028381	Ga0268264_10000152	Ga0268264_1000015292	297
194	3300032005	Ga0307411_10160697	Ga0307411_101606972	297
195	3300033545	Ga0316214_1001037	Ga0316214_10010372	297
196	3300036459	Ga0372808_012483	Ga0372808_012483_263_1180	297
197	3300036712	Ga0316584_0052548	Ga0316584_0052548_544_1446	297
198	3300037853	Ga0436364_0897091	Ga0436364_0897091_2076_2984	297
199	3300039450	Ga0436363_1018007	Ga0436363_1018007_296_1204	297
200	3300041413	Ga0439465_0000163	Ga0439465_0000163_3795_4703	297
201	3300041413	Ga0439465_0017197	Ga0439465_0017197_424_1332	297
202	3300041456	Ga0451795_1421576	Ga0451795_1421576_321_1247	297
203	3300041997	Ga0439431_0064081	Ga0439431_0064081_42_950	297
204	3300046463	Ga0495653_0171358	Ga0495653_0171358_369_1274	297
205	3300046517	Ga0495630_0131396	Ga0495630_0131396_574_1488	297
206	3300047317	Ga0495604_0140716	Ga0495604_0140716_124_1032	297
207	3300047317	Ga0495604_0297703	Ga0495604_0297703_64_969	297
208	3300047443	Ga0495687_001096	Ga0495687_001096_17602_18510	297
209	3300048088	Ga0495602_0413237	Ga0495602_0413237_23_928	297
210	3300048903	Ga0496100_0056639	Ga0496100_0056639_161_1063	297
211	3300048904	Ga0496101_0335772	Ga0496101_0335772_91_996	297
212	3300048905	Ga0496102_0000171	Ga0496102_0000171_86458_87360	297
213	3300048905	Ga0496102_0035192	Ga0496102_0035192_814_1719	297
214	3300048906	Ga0496103_0057381	Ga0496103_0057381_65_967	297
215	3300048907	Ga0496104_0060681	Ga0496104_0060681_1488_2396	297
216	3300048908	Ga0496105_0053004	Ga0496105_0053004_74_979	297
217	3300048910	Ga0496107_0029947	Ga0496107_0029947_2778_3680	297
218	3300048915	Ga0496112_0037528	Ga0496112_0037528_1757_2665	297
219	3300048915	Ga0496112_0211781	Ga0496112_0211781_256_1164	297
220	3300048918	Ga0496115_0095177	Ga0496115_0095177_324_1229	297
221	3300048919	Ga0496116_0049348	Ga0496116_0049348_114_1016	297
222	3300048920	Ga0496117_0000149	Ga0496117_0000149_54503_55405	297
223	3300048920	Ga0496117_0035174	Ga0496117_0035174_2367_3269	297
224	3300048921	Ga0496118_0000049	Ga0496118_0000049_196471_197373	297
225	3300048921	Ga0496118_0000194	Ga0496118_0000194_46714_47616	297
226	3300048924	Ga0496121_0000172	Ga0496121_0000172_102338_103240	297
227	3300048927	Ga0496124_0000330	Ga0496124_0000330_86608_87510	297
228	3300048928	Ga0496125_0009028	Ga0496125_0009028_5697_6599	297
229	3300048929	Ga0496126_0000180	Ga0496126_0000180_101186_102088	297
230	3300049571	Ga0501034_0004292	Ga0501034_0004292_4880_5791	297
231	3300049572	Ga0501036_0105247	Ga0501036_0105247_200_1111	297
232	3300049573	Ga0501037_0213401	Ga0501037_0213401_324_1235	297
233	3300049579	Ga0501043_0039114	Ga0501043_0039114_2429_3340	297
234	3300049581	Ga0501047_0003640	Ga0501047_0003640_5280_6191	297
235	3300049586	Ga0501070_0012211	Ga0501070_0012211_393_1304	297
236	3300049586	Ga0501070_0172730	Ga0501070_0172730_403_1311	297
237	3300049586	Ga0501070_0430485	Ga0501070_0430485_129_1043	297
238	3300049589	Ga0501073_0366122	Ga0501073_0366122_29_922	297
239	3300049741	Ga0501079_0306390	Ga0501079_0306390_283_1194	297
240	3300049742	Ga0501080_0025341	Ga0501080_0025341_2158_3069	297
241	3300049742	Ga0501080_0259963	Ga0501080_0259963_321_1229	297
242	3300049823	Ga0501044_0036228	Ga0501044_0036228_3814_4725	297
243	3300050489	nmdc:mga03683_2011_c1	nmdc:mga03683_2011_c1_5174_6082	297
244	3300050490	nmdc:mga03n38_55733_c1	nmdc:mga03n38_55733_c1_53_961	297
245	3300050490	nmdc:mga03n38_58519_c1	nmdc:mga03n38_58519_c1_461_1369	297
246	3300050490	nmdc:mga03n38_69770_c1	nmdc:mga03n38_69770_c1_236_1144	297
247	3300050491	nmdc:mga00v17_33772_c1	nmdc:mga00v17_33772_c1_1071_1979	297
248	3300050491	nmdc:mga00v17_61267_c1	nmdc:mga00v17_61267_c1_451_1359	297
249	3300050492	nmdc:mga0yw44_1221_c1	nmdc:mga0yw44_1221_c1_697_1605	297
250	3300050492	nmdc:mga0yw44_153325_c1	nmdc:mga0yw44_153325_c1_150_1061	297
251	3300050494	nmdc:mga06z11_1106_c1	nmdc:mga06z11_1106_c1_585_1493	297
252	3300050496	nmdc:mga07m45_12930_c1	nmdc:mga07m45_12930_c1_2313_3221	297
253	3300050496	nmdc:mga07m45_25334_c1	nmdc:mga07m45_25334_c1_708_1616	297
254	3300050496	nmdc:mga07m45_41334_c1	nmdc:mga07m45_41334_c1_1089_1997	297
255	3300050507	nmdc:mga05p37_23195_c1	nmdc:mga05p37_23195_c1_2787_3695	297
256	3300050507	nmdc:mga05p37_517952_c1	nmdc:mga05p37_517952_c1_405_1316	297
257	3300050509	nmdc:mga0qj67_6605_c1	nmdc:mga0qj67_6605_c1_4332_5240	297
258	3300050509	nmdc:mga0qj67_98803_c1	nmdc:mga0qj67_98803_c1_975_1883	297
259	3300050510	nmdc:mga06r32_19915_c1	nmdc:mga06r32_19915_c1_843_1751	297
260	3300050510	nmdc:mga06r32_22812_c1	nmdc:mga06r32_22812_c1_2740_3648	297
261	3300050510	nmdc:mga06r32_71778_c1	nmdc:mga06r32_71778_c1_1297_2208	297
262	3300050511	nmdc:mga08y16_143867_c1	nmdc:mga08y16_143867_c1_276_1184	297
263	3300050511	nmdc:mga08y16_28457_c1	nmdc:mga08y16_28457_c1_3403_4311	297
264	3300050511	nmdc:mga08y16_79563_c1	nmdc:mga08y16_79563_c1_1231_2139	297
265	3300050516	nmdc:mga0sz30_11195_c1	nmdc:mga0sz30_11195_c1_312_1220	297
266	3300050516	nmdc:mga0sz30_526_c1	nmdc:mga0sz30_526_c1_9420_10328	297
267	3300050516	nmdc:mga0sz30_6526_c1	nmdc:mga0sz30_6526_c1_141_1049	297
268	3300053085	Ga0495619_0109140	Ga0495619_0109140_701_1615	297
269	3300053087	Ga0500643_004742	Ga0500643_004742_5064_5966	297
270	3300053108	Ga0500562_013667	Ga0500562_013667_286_1194	297
271	3300053108	Ga0500562_019782	Ga0500562_019782_779_1687	297
272	3300053131	Ga0500652_000161	Ga0500652_000161_10937_11854	297
273	3300053136	Ga0500559_0027469	Ga0500559_0027469_1417_2325	297
274	3300053153	Ga0500616_0001970	Ga0500616_0001970_9239_10141	297
275	3300005289	Ga0065704_10116149	Ga0065704_101161491	298
276	3300005336	Ga0070680_100000318	Ga0070680_10000031824	298
277	3300005458	Ga0070681_10000185	Ga0070681_1000018526	298
278	3300005530	Ga0070679_100000187	Ga0070679_10000018724	298
279	3300005615	Ga0070702_100271897	Ga0070702_1002718971	298
280	3300005985	Ga0081539_10007548	Ga0081539_100075483	298
281	3300006038	Ga0075365_10003566	Ga0075365_100035666	298
282	3300006038	Ga0075365_10063891	Ga0075365_100638912	298
283	3300006880	Ga0075429_100041225	Ga0075429_1000412252	298
284	3300009147	Ga0114129_10065005	Ga0114129_100650054	298
285	3300025912	Ga0207707_10000339	Ga0207707_1000033923	298
286	3300025917	Ga0207660_10000176	Ga0207660_100001768	298
287	3300025921	Ga0207652_10000316	Ga0207652_1000031625	298
288	3300026089	Ga0207648_10167365	Ga0207648_101673652	298
289	3300031251	Ga0265327_10060127	Ga0265327_100601272	298
290	3300036401	Ga0373937_0560169	Ga0373937_0560169_124_1032	298
291	3300046463	Ga0495653_0053396	Ga0495653_0053396_2119_3030	298
292	3300046473	Ga0495582_0077227	Ga0495582_0077227_473_1384	298
293	3300046514	Ga0495618_0062290	Ga0495618_0062290_1032_1943	298
294	3300046514	Ga0495618_0063092	Ga0495618_0063092_744_1655	298
295	3300046516	Ga0495628_0005768	Ga0495628_0005768_6566_7477	298
296	3300046516	Ga0495628_0063561	Ga0495628_0063561_187_1098	298
297	3300046516	Ga0495628_0317682	Ga0495628_0317682_189_1106	298
298	3300046526	Ga0495666_0091843	Ga0495666_0091843_227_1138	298
299	3300046533	Ga0495640_0008850	Ga0495640_0008850_2328_3239	298
300	3300046533	Ga0495640_0127536	Ga0495640_0127536_467_1378	298
301	3300046536	Ga0495587_0236375	Ga0495587_0236375_61_969	298
302	3300046559	Ga0495667_0091674	Ga0495667_0091674_816_1727	298
303	3300046559	Ga0495667_0096617	Ga0495667_0096617_316_1227	298
304	3300046675	Ga0495657_0028749	Ga0495657_0028749_1269_2180	298
305	3300046675	Ga0495657_0061456	Ga0495657_0061456_1462_2373	298
306	3300046675	Ga0495657_0173382	Ga0495657_0173382_324_1232	298
307	3300046678	Ga0495599_0200277	Ga0495599_0200277_259_1170	298
308	3300046690	Ga0495624_0077770	Ga0495624_0077770_446_1357	298
309	3300046809	Ga0495600_0036771	Ga0495600_0036771_1218_2129	298
310	3300047319	Ga0495674_0166310	Ga0495674_0166310_94_1002	298
311	3300047319	Ga0495674_0347040	Ga0495674_0347040_215_1126	298
312	3300047322	Ga0495680_0056330	Ga0495680_0056330_30_941	298
313	3300047322	Ga0495680_0067130	Ga0495680_0067130_1277_2185	298
314	3300047322	Ga0495680_0095128	Ga0495680_0095128_1220_2128	298
315	3300047471	Ga0495684_0045913	Ga0495684_0045913_656_1567	298
316	3300050491	nmdc:mga00v17_2857_c1	nmdc:mga00v17_2857_c1_2931_3842	298
317	3300050492	nmdc:mga0yw44_5339_c1	nmdc:mga0yw44_5339_c1_3635_4546	298
318	3300050492	nmdc:mga0yw44_92977_c1	nmdc:mga0yw44_92977_c1_711_1631	298
319	3300050507	nmdc:mga05p37_367661_c1	nmdc:mga05p37_367661_c1_725_1636	298
320	3300050509	nmdc:mga0qj67_21069_c1	nmdc:mga0qj67_21069_c1_1070_1981	298
321	3300050516	nmdc:mga0sz30_91_c2	nmdc:mga0sz30_91_c2_8699_9610	298
322	3300053077	Ga0495601_0051953	Ga0495601_0051953_243_1154	298
323	3300053084	Ga0495595_0007765	Ga0495595_0007765_1223_2134	298
324	3300053085	Ga0495619_0045910	Ga0495619_0045910_1889_2800	298
325	3300053085	Ga0495619_0091458	Ga0495619_0091458_1126_2034	298
326	3300053108	Ga0500562_000637	Ga0500562_000637_1174_2085	298
327	3300028800	Ga0265338_10003981	Ga0265338_1000398121	299
328	3300031251	Ga0265327_10012790	Ga0265327_100127904	299
329	3300036401	Ga0373937_0007419	Ga0373937_0007419_2574_3497	299
330	3300046455	Ga0495603_0192912	Ga0495603_0192912_48_965	299
331	3300046462	Ga0495651_0083620	Ga0495651_0083620_958_1881	299
332	3300046511	Ga0495608_0115234	Ga0495608_0115234_375_1298	299
333	3300046529	Ga0495652_0096968	Ga0495652_0096968_508_1431	299
334	3300046536	Ga0495587_0013474	Ga0495587_0013474_1403_2326	299
335	3300046559	Ga0495667_0015420	Ga0495667_0015420_1410_2333	299
336	3300046675	Ga0495657_0004257	Ga0495657_0004257_9217_10140	299
337	3300046679	Ga0495623_0032096	Ga0495623_0032096_1015_1938	299
338	3300046809	Ga0495600_0057903	Ga0495600_0057903_411_1334	299
339	3300047319	Ga0495674_0175050	Ga0495674_0175050_741_1664	299
340	3300049571	Ga0501034_0000361	Ga0501034_0000361_44605_45543	299
341	3300049571	Ga0501034_0074496	Ga0501034_0074496_2449_3363	299
342	3300049580	Ga0501046_0004567	Ga0501046_0004567_5693_6607	299
343	3300049581	Ga0501047_0040294	Ga0501047_0040294_494_1408	299
344	3300049586	Ga0501070_0005775	Ga0501070_0005775_7193_8107	299
345	3300049742	Ga0501080_0412310	Ga0501080_0412310_101_1015	299
346	3300049823	Ga0501044_0096720	Ga0501044_0096720_1360_2274	299
347	3300053077	Ga0495601_0193365	Ga0495601_0193365_73_996	299
348	3300001979	JGI24740J21852_10041877	JGI24740J21852_100418772	300
349	3300001989	JGI24739J22299_10000099	JGI24739J22299_1000009913	300
350	3300001989	JGI24739J22299_10027722	JGI24739J22299_100277222	300
351	3300001990	JGI24737J22298_10002688	JGI24737J22298_100026883	300
352	3300005289	Ga0065704_10018967	Ga0065704_100189671	300
353	3300005327	Ga0070658_10000492	Ga0070658_1000049217	300
354	3300005331	Ga0070670_100158842	Ga0070670_1001588423	300
355	3300005335	Ga0070666_10025881	Ga0070666_100258811	300
356	3300005340	Ga0070689_100557572	Ga0070689_1005575721	300
357	3300005344	Ga0070661_100006224	Ga0070661_1000062248	300
358	3300005353	Ga0070669_100000266	Ga0070669_10000026626	300
359	3300005354	Ga0070675_100396159	Ga0070675_1003961591	300
360	3300005355	Ga0070671_100000005	Ga0070671_100000005270	300
361	3300005366	Ga0070659_100023990	Ga0070659_1000239901	300
362	3300005367	Ga0070667_100003928	Ga0070667_1000039285	300
363	3300005457	Ga0070662_100038359	Ga0070662_1000383593	300
364	3300005466	Ga0070685_10058235	Ga0070685_100582352	300
365	3300005539	Ga0068853_100001070	Ga0068853_10000107018	300
366	3300005539	Ga0068853_100033511	Ga0068853_1000335111	300
367	3300005539	Ga0068853_100045826	Ga0068853_1000458263	300
368	3300005548	Ga0070665_100005188	Ga0070665_1000051885	300
369	3300005563	Ga0068855_100016038	Ga0068855_1000160386	300
370	3300005563	Ga0068855_100093678	Ga0068855_1000936782	300
371	3300005564	Ga0070664_100008406	Ga0070664_1000084063	300
372	3300005564	Ga0070664_100052214	Ga0070664_1000522141	300
373	3300005578	Ga0068854_100000516	Ga0068854_10000051610	300
374	3300005578	Ga0068854_100004329	Ga0068854_1000043292	300
375	3300005578	Ga0068854_100085840	Ga0068854_1000858403	300
376	3300005614	Ga0068856_100002709	Ga0068856_10000270919	300
377	3300005614	Ga0068856_100003650	Ga0068856_1000036502	300
378	3300005614	Ga0068856_100140762	Ga0068856_1001407622	300
379	3300005616	Ga0068852_100000087	Ga0068852_10000008737	300
380	3300005616	Ga0068852_100004798	Ga0068852_1000047988	300
381	3300005616	Ga0068852_100027458	Ga0068852_1000274584	300
382	3300005616	Ga0068852_100076522	Ga0068852_1000765222	300
383	3300005617	Ga0068859_100355949	Ga0068859_1003559492	300
384	3300005834	Ga0068851_10010490	Ga0068851_100104904	300
385	3300005841	Ga0068863_100023108	Ga0068863_1000231085	300
386	3300005842	Ga0068858_100076146	Ga0068858_1000761462	300
387	3300005843	Ga0068860_100170239	Ga0068860_1001702391	300
388	3300005844	Ga0068862_100022738	Ga0068862_1000227383	300
389	3300005844	Ga0068862_100279103	Ga0068862_1002791031	300
390	3300006931	Ga0097620_100355946	Ga0097620_1003559462	300
391	3300009093	Ga0105240_10002301	Ga0105240_1000230120	300
392	3300009101	Ga0105247_10072475	Ga0105247_100724752	300
393	3300009174	Ga0105241_10000181	Ga0105241_1000018138	300
394	3300009177	Ga0105248_10045548	Ga0105248_100455484	300
395	3300009545	Ga0105237_10003098	Ga0105237_100030989	300
396	3300009551	Ga0105238_10000902	Ga0105238_1000090223	300
397	3300009551	Ga0105238_10026413	Ga0105238_100264135	300
398	3300009553	Ga0105249_10133750	Ga0105249_101337502	300
399	3300013104	Ga0157370_10115455	Ga0157370_101154552	300
400	3300014325	Ga0163163_10096188	Ga0163163_100961883	300
401	3300025315	Ga0207697_10106380	Ga0207697_101063801	300
402	3300025900	Ga0207710_10077474	Ga0207710_100774742	300
403	3300025904	Ga0207647_10000033	Ga0207647_1000003384	300
404	3300025904	Ga0207647_10058008	Ga0207647_100580082	300
405	3300025909	Ga0207705_10000073	Ga0207705_100000733	300
406	3300025911	Ga0207654_10001628	Ga0207654_100016287	300
407	3300025913	Ga0207695_10000455	Ga0207695_1000045571	300
408	3300025913	Ga0207695_10008997	Ga0207695_1000899710	300
409	3300025914	Ga0207671_10015018	Ga0207671_100150183	300
410	3300025923	Ga0207681_10000247	Ga0207681_100002476	300
411	3300025924	Ga0207694_10000591	Ga0207694_100005914	300
412	3300025924	Ga0207694_10028198	Ga0207694_100281985	300
413	3300025925	Ga0207650_10120799	Ga0207650_101207992	300
414	3300025931	Ga0207644_10000008	Ga0207644_1000000855	300
415	3300025941	Ga0207711_10020144	Ga0207711_100201445	300
416	3300025941	Ga0207711_10102640	Ga0207711_101026403	300
417	3300025949	Ga0207667_10002221	Ga0207667_1000222119	300
418	3300025949	Ga0207667_10332049	Ga0207667_103320492	300
419	3300025972	Ga0207668_10000078	Ga0207668_1000007827	300
420	3300025981	Ga0207640_10001459	Ga0207640_100014596	300
421	3300025981	Ga0207640_10002739	Ga0207640_100027393	300
422	3300025981	Ga0207640_10240186	Ga0207640_102401861	300
423	3300025986	Ga0207658_10010949	Ga0207658_100109495	300
424	3300025986	Ga0207658_10412925	Ga0207658_104129251	300
425	3300026041	Ga0207639_10006640	Ga0207639_100066404	300
426	3300026041	Ga0207639_10052454	Ga0207639_100524542	300
427	3300026078	Ga0207702_10002566	Ga0207702_100025666	300
428	3300026078	Ga0207702_10009596	Ga0207702_100095962	300
429	3300026095	Ga0207676_10243300	Ga0207676_102433001	300
430	3300026142	Ga0207698_10000308	Ga0207698_1000030810	300
431	3300026142	Ga0207698_10000889	Ga0207698_100008898	300
432	3300026142	Ga0207698_10054949	Ga0207698_100549493	300
433	3300028379	Ga0268266_10017671	Ga0268266_100176712	300
434	3300028379	Ga0268266_10543172	Ga0268266_105431722	300
435	3300028380	Ga0268265_10033881	Ga0268265_100338812	300
436	3300028380	Ga0268265_10122964	Ga0268265_101229641	300
437	3300031251	Ga0265327_10037072	Ga0265327_100370722	300
438	3300031548	Ga0307408_100000218	Ga0307408_10000021826	300
439	3300031731	Ga0307405_10000164	Ga0307405_1000016413	300
440	3300031911	Ga0307412_10000510	Ga0307412_1000051010	300
441	3300031911	Ga0307412_10203591	Ga0307412_102035911	300
442	3300048903	Ga0496100_0055640	Ga0496100_0055640_596_1504	300
443	3300048904	Ga0496101_0053543	Ga0496101_0053543_979_1887	300
444	3300048909	Ga0496106_0003537	Ga0496106_0003537_6551_7459	300
445	3300048910	Ga0496107_0000222	Ga0496107_0000222_25679_26587	300
446	3300048911	Ga0496108_0126257	Ga0496108_0126257_600_1508	300
447	3300048912	Ga0496109_0251205	Ga0496109_0251205_112_1020	300
448	3300048915	Ga0496112_0197232	Ga0496112_0197232_163_1071	300
449	3300048916	Ga0496113_0208891	Ga0496113_0208891_323_1231	300
450	3300049589	Ga0501073_0121657	Ga0501073_0121657_202_1119	300
451	3300049590	Ga0501074_0002125	Ga0501074_0002125_1573_2490	300
452	3300049741	Ga0501079_0000038	Ga0501079_0000038_14258_15175	300
453	3300049742	Ga0501080_0007112	Ga0501080_0007112_5896_6813	300
454	3300005436	Ga0070713_100143553	Ga0070713_1001435532	301
455	3300048903	Ga0496100_0227362	Ga0496100_0227362_15_932	301
456	3300048904	Ga0496101_0139401	Ga0496101_0139401_270_1187	301
457	3300048905	Ga0496102_0026393	Ga0496102_0026393_1241_2158	301
458	3300048909	Ga0496106_0363341	Ga0496106_0363341_217_1134	301
459	3300048912	Ga0496109_0146484	Ga0496109_0146484_639_1556	301
460	3300053151	Ga0500604_0044943	Ga0500604_0044943_207_1124	301
461	3300005366	Ga0070659_100166572	Ga0070659_1001665722	302
462	3300005457	Ga0070662_100082199	Ga0070662_1000821993	302
463	3300009147	Ga0114129_10486218	Ga0114129_104862182	302
464	3300025919	Ga0207657_10115259	Ga0207657_101152592	302
465	3300025933	Ga0207706_10116364	Ga0207706_101163641	302
466	3300048922	Ga0496119_0004736	Ga0496119_0004736_11412_12326	302
467	3300048923	Ga0496120_0015586	Ga0496120_0015586_2332_3246	302
468	3300003792	Ga0055540_1004584	Ga0055540_10045842	303
469	3300006051	Ga0075364_10022557	Ga0075364_100225572	303
470	3300009101	Ga0105247_10000011	Ga0105247_10000011310	303
471	3300025303	Ga0209051_1000558	Ga0209051_100055817	303
472	3300025900	Ga0207710_10000006	Ga0207710_10000006178	303
473	3300025923	Ga0207681_10002805	Ga0207681_100028052	303
474	3300048904	Ga0496101_0042650	Ga0496101_0042650_1216_2151	303
475	3300048924	Ga0496121_0018489	Ga0496121_0018489_2618_3553	303
476	3300048928	Ga0496125_0020360	Ga0496125_0020360_1132_2067	303
477	3300048929	Ga0496126_0028334	Ga0496126_0028334_3471_4406	303
478	3300050491	nmdc:mga00v17_18579_c1	nmdc:mga00v17_18579_c1_1812_2744	303
479	3300031251	Ga0265327_10016196	Ga0265327_100161963	306
480	3300045836	Ga0466958_0191486	Ga0466958_0191486_70_1020	307
481	3300005347	Ga0070668_100051176	Ga0070668_1000511762	314
482	3300009177	Ga0105248_10162589	Ga0105248_101625892	314
483	iso_pu_bacteria	2773857922	2774857631	316
484	3300001904	JGI24736J21556_1000153	JGI24736J21556_100015311	325
485	3300001979	JGI24740J21852_10002637	JGI24740J21852_100026376	325
486	3300002067	JGI24735J21928_10018184	JGI24735J21928_100181842	325
487	3300005339	Ga0070660_100012549	Ga0070660_1000125493	325
488	3300009093	Ga0105240_10046431	Ga0105240_100464314	325
489	3300010375	Ga0105239_10011269	Ga0105239_100112697	325
490	3300013105	Ga0157369_10008297	Ga0157369_100082977	325
491	3300025932	Ga0207690_10017122	Ga0207690_100171224	325
492	3300025933	Ga0207706_10045873	Ga0207706_100458734	325
493	3300049823	Ga0501044_0001182	Ga0501044_0001182_17737_18750	325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

53

312

0.8 PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

57

306

0.78 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3ome-assembly1.cif.gz_A	crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis	0.968	30	302
3ome-assembly1.cif.gz_B	crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis	0.9662	30	302
3ome-assembly1.cif.gz_F	crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis	0.9623	29	304
3ome-assembly1.cif.gz_E	crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis	0.962	29	302
3t3w-assembly1.cif.gz_B	crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile	0.958	30	291

ID	Description	Score	Start	End	Superfamily
af_P95279_25_296_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9908	29	304	3.90.226.10
af_P95279_25_296_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9872	29	304	3.90.226.10
3omeC00	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9646	30	302	3.90.226.10
3omeC00	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9417	30	302	3.90.226.10
3rsiC01	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;	0.9289	30	84	3.30.300.220

ID	Description	Score	Start	End	GO Terms
AF-A0A7G1I6N5-F1-model_v4	Enoyl-CoA hydratase	0.9788	124	325	GO:0006635
AF-A0A7G1I6N5-F1-model_v4	Enoyl-CoA hydratase	0.9644	124	325	GO:0006635
AF-A0A2S8LNH3-F1-model_v4	deleted	0.9536	30	122
AF-A0A1J0W2E0-F1-model_v4	Enoyl-CoA hydratase	0.9534	30	304	GO:0006635
AF-A0A429FQW0-F1-model_v4	Enoyl-CoA hydratase (EC 4.2.1.17)	0.9516	30	308	GO:0004300 GO:0006635

Feature Viewer

pLDDT	pTM	Quality
87.41	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F454366

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

53

312

0.8

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

57

306

0.78

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map