F454295

General Info

Members Datasets Scaffolds Average Seq Length
492 148 984 278

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0092383|Ga0395898_0092383_1613_2542
Length 309
Sequence MAFVPTTRSRVIPFPMSKPLLHFTHGNSYPSGSYSRLLDDLRRDFDVRTTDMLGHDPRYPVRDNWHTLIDELIAQLEAYGQPVILVGHSLGGAVGMLAAHRRPDLARCVVMLDSPVVAGWRAQVWRFVKLLGLRERLSPGALAARRRNVWPSRAAAHEHFMAKPIFQAWAPGALDDYLDHGLKPHPDGVQLRFDRDVEAAIYSTLPHDMDRVLRAPYPVPVGFIAGTDSLELRQAGLHGTRRLVGDNFVTIEGTHLYPMEQPTLTAQLTREIIARLLAQADEKRRAAPRRFSRKIAGLLSPFFGKEAQR

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
32 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
33 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
34 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
35 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
36 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
37 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
38 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
39 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
40 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
41 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
53 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
59 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
63 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
72 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
73 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
74 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
75 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
79 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
116 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 2643221556 Massilia sp. Root1485 Isolate Unclassified
146 2643221684 Massilia sp. Root133 Isolate Unclassified
147 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
148 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 5.49
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0092383 3300037466 Bacteria 2910
2 Ga0055525_1000008 3300003759 Bacteria 604287
3 Ga0065165_1012753 3300005262 Bacteria 3398
4 Ga0070658_10059204 3300005327 Bacteria 3119
5 Ga0070658_10080035 3300005327 Bacteria 2683
6 Ga0070660_100074138 3300005339 Bacteria 2662
7 Ga0070660_100074441 3300005339 Bacteria 2657
8 Ga0070660_100343496 3300005339 Bacteria 1228
9 Ga0070661_100135864 3300005344 Bacteria 1850
10 Ga0070661_100459480 3300005344 Bacteria 1014
11 Ga0070659_100068742 3300005366 Bacteria 2810
12 Ga0070706_100564737 3300005467 Bacteria 1058
13 Ga0068855_100120300 3300005563 Bacteria 3005
14 Ga0068855_100330491 3300005563 Bacteria 1683
15 Ga0070664_100033886 3300005564 Bacteria 4281
16 Ga0070664_100156432 3300005564 Bacteria 2014
17 Ga0070664_100396776 3300005564 Bacteria 1261
18 Ga0068852_100285134 3300005616 Bacteria 1593
19 Ga0105245_10248719 3300009098 Bacteria 1726
20 Ga0105241_10098854 3300009174 Bacteria 2316
21 Ga0105239_10275334 3300010375 Bacteria 1894
22 Ga0105246_10412462 3300011119 Bacteria 1125
23 Ga0157371_10001021 3300013102 Bacteria 30696
24 Ga0157369_10249008 3300013105 Bacteria 1855
25 Ga0157372_10868793 3300013307 Bacteria 1047
26 Ga0182008_10006667 3300014497 Bacteria 6430
27 Ga0209563_100003 3300025230 Bacteria 1932942
28 Ga0209677_102278 3300025253 Bacteria 7410
29 Ga0209148_1000576 3300025254 Bacteria 34082
30 Ga0207705_10004607 3300025909 Bacteria 10404
31 Ga0207705_10064056 3300025909 Bacteria 2656
32 Ga0207654_10119246 3300025911 Bacteria 1654
33 Ga0207657_10072829 3300025919 Bacteria 2905
34 Ga0207657_10086975 3300025919 Bacteria 2615
35 Ga0207657_10159962 3300025919 Bacteria 1830
36 Ga0207690_10178669 3300025932 Bacteria 1596
37 Ga0207706_10261419 3300025933 Bacteria 1511
38 Ga0207679_10114243 3300025945 Bacteria 2137
39 Ga0207679_10156480 3300025945 Bacteria 1861
40 Ga0207667_10047696 3300025949 Bacteria 4533
41 Ga0207667_10276248 3300025949 Bacteria 1717
42 Ga0207667_10331276 3300025949 Bacteria 1554
43 Ga0207698_10359469 3300026142 Bacteria 1378
44 Ga0316180_1103205 3300030736 Bacteria 2178
45 Ga0316182_1397066 3300030745 Bacteria 3047
46 Ga0395899_0004157 3300037312 Bacteria 11368
47 Ga0395899_0027459 3300037312 Bacteria 4292
48 Ga0395899_0031351 3300037312 Bacteria 3994
49 Ga0395900_0000028 3300037418 Bacteria 285042
50 Ga0395900_0003173 3300037418 Bacteria 17823
51 Ga0395900_0016881 3300037418 Bacteria 7451
52 Ga0395900_0051830 3300037418 Bacteria 4225
53 Ga0395900_0063351 3300037418 Bacteria 3800
54 Ga0395900_0137921 3300037418 Bacteria 2499
55 Ga0395900_0242024 3300037418 Bacteria 1809
56 Ga0395900_0686201 3300037418 Bacteria 958
57 Ga0395898_0113842 3300037466 Bacteria 2592
58 Ga0395898_0126151 3300037466 Bacteria 2452
59 Ga0395905_0036653 3300037471 Bacteria 4607
60 Ga0395905_0049521 3300037471 Bacteria 3937
61 Ga0395905_0117618 3300037471 Bacteria 2498
62 Ga0395905_0157921 3300037471 Bacteria 2132
63 Ga0395905_0161250 3300037471 Bacteria 2107
64 Ga0395905_0258467 3300037471 Bacteria 1626
65 Ga0395905_0359023 3300037471 Bacteria 1350
66 Ga0395901_0000025 3300038443 Bacteria 263463
67 Ga0395901_0006376 3300038443 Bacteria 11954
68 Ga0395901_0353414 3300038443 Bacteria 1516
69 Ga0395901_0390681 3300038443 Bacteria 1430
70 Ga0395901_0456250 3300038443 Bacteria 1306
71 Ga0395901_0552792 3300038443 Bacteria 1166
72 Ga0439448_0014565 3300042005 Bacteria 2373
73 Ga0439449_0007337 3300042007 Bacteria 4189
74 Ga0439450_020830 3300042008 Bacteria 1402
75 Ga0466969_0070068 3300044656 Bacteria 1687
76 Ga0466969_0136511 3300044656 Bacteria 1135
77 Ga0466972_0007333 3300044658 Bacteria 5538
78 Ga0466965_0007268 3300044683 Bacteria 5076
79 Ga0466965_0049443 3300044683 Bacteria 2084
80 Ga0466965_0254083 3300044683 Bacteria 943
81 Ga0466966_0061803 3300044684 Bacteria 2362
82 Ga0466966_0074939 3300044684 Bacteria 2114
83 Ga0466961_0060335 3300044693 Bacteria 2412
84 Ga0466961_0088503 3300044693 Bacteria 1956
85 Ga0466961_0088572 3300044693 Bacteria 1955
86 Ga0466964_0020437 3300044706 Bacteria 2550
87 Ga0466968_0003376 3300044735 Bacteria 5901
88 Ga0466970_0247236 3300044765 Bacteria 999
89 Ga0466957_0003369 3300044842 Bacteria 8774
90 Ga0466957_0031062 3300044842 Bacteria 3191
91 Ga0466957_0148133 3300044842 Bacteria 1516
92 Ga0466957_0291203 3300044842 Bacteria 1095
93 Ga0466959_0091283 3300045049 Bacteria 2187
94 Ga0466959_0122962 3300045049 Bacteria 1843
95 Ga0466958_0094947 3300045836 Bacteria 1848
96 Ga0466958_0104503 3300045836 Bacteria 1764
97 Ga0466958_0239957 3300045836 Bacteria 1158
98 Ga0466958_0289067 3300045836 Bacteria 1051
99 Ga0466967_0081653 3300045976 Bacteria 2920
100 Ga0495617_000012 3300046452 Bacteria 295916
101 Ga0495627_000298 3300046453 Bacteria 49186
102 Ga0495627_032709 3300046453 Bacteria 1635
103 Ga0495603_0028745 3300046455 Bacteria 3354
104 Ga0495590_0000203 3300046457 Bacteria 33318
105 Ga0495590_0007711 3300046457 Bacteria 4136
106 Ga0495590_0110206 3300046457 Bacteria 982
107 Ga0495591_000577 3300046458 Bacteria 27941
108 Ga0495591_010110 3300046458 Bacteria 3687
109 Ga0495638_0027237 3300046460 Bacteria 3701
110 Ga0495638_0113753 3300046460 Bacteria 1605
111 Ga0495653_0008555 3300046463 Bacteria 8389
112 Ga0495653_0303083 3300046463 Bacteria 1041
113 Ga0495650_0001604 3300046471 Bacteria 21152
114 Ga0495582_0002923 3300046473 Bacteria 9551
115 Ga0495582_0017654 3300046473 Bacteria 3903
116 Ga0495605_0000070 3300046474 Bacteria 135755
117 Ga0495605_0000419 3300046474 Bacteria 38606
118 Ga0495605_0009976 3300046474 Bacteria 5322
119 Ga0495605_0044935 3300046474 Bacteria 2180
120 Ga0495605_0051891 3300046474 Bacteria 1995
121 Ga0495605_0055829 3300046474 Bacteria 1906
122 Ga0495605_0058932 3300046474 Bacteria 1844
123 Ga0495605_0107306 3300046474 Bacteria 1277
124 Ga0495584_0000369 3300046491 Bacteria 31064
125 Ga0495584_0003778 3300046491 Bacteria 8253
126 Ga0495584_0006695 3300046491 Bacteria 6027
127 Ga0495584_0015874 3300046491 Bacteria 3842
128 Ga0495584_0026735 3300046491 Bacteria 2924
129 Ga0495584_0035419 3300046491 Bacteria 2523
130 Ga0495584_0060198 3300046491 Bacteria 1909
131 Ga0495584_0070224 3300046491 Bacteria 1760
132 Ga0495584_0106213 3300046491 Bacteria 1419
133 Ga0495584_0110967 3300046491 Bacteria 1387
134 Ga0495585_0000755 3300046492 Bacteria 28681
135 Ga0495585_0002590 3300046492 Bacteria 12791
136 Ga0495585_0009411 3300046492 Bacteria 5860
137 Ga0495585_0036441 3300046492 Bacteria 2774
138 Ga0495585_0046112 3300046492 Bacteria 2431
139 Ga0495585_0048447 3300046492 Bacteria 2362
140 Ga0495585_0081558 3300046492 Bacteria 1752
141 Ga0495585_0163780 3300046492 Bacteria 1152
142 Ga0495594_0006776 3300046499 Bacteria 5891
143 Ga0495594_0047869 3300046499 Bacteria 2348
144 Ga0495594_0087088 3300046499 Bacteria 1747
145 Ga0495594_0109307 3300046499 Bacteria 1558
146 Ga0495596_0001170 3300046500 Bacteria 15393
147 Ga0495596_0001215 3300046500 Bacteria 15053
148 Ga0495596_0003411 3300046500 Bacteria 8056
149 Ga0495596_0012248 3300046500 Bacteria 3677
150 Ga0495596_0013707 3300046500 Bacteria 3431
151 Ga0495596_0014627 3300046500 Bacteria 3303
152 Ga0495596_0018177 3300046500 Bacteria 2901
153 Ga0495596_0028220 3300046500 Bacteria 2254
154 Ga0495596_0040618 3300046500 Bacteria 1836
155 Ga0495596_0069701 3300046500 Bacteria 1366
156 Ga0495607_0001216 3300046501 Bacteria 23172
157 Ga0495607_0001460 3300046501 Bacteria 21054
158 Ga0495607_0001736 3300046501 Bacteria 18660
159 Ga0495607_0006527 3300046501 Bacteria 8199
160 Ga0495607_0011508 3300046501 Bacteria 5887
161 Ga0495607_0016564 3300046501 Bacteria 4755
162 Ga0495607_0021698 3300046501 Bacteria 4038
163 Ga0495607_0023238 3300046501 Bacteria 3881
164 Ga0495607_0025276 3300046501 Bacteria 3695
165 Ga0495607_0274409 3300046501 Bacteria 802
166 Ga0495583_0000704 3300046506 Bacteria 43065
167 Ga0495583_0000895 3300046506 Bacteria 35617
168 Ga0495583_0001086 3300046506 Bacteria 30132
169 Ga0495583_0001654 3300046506 Bacteria 21647
170 Ga0495583_0005731 3300046506 Bacteria 8331
171 Ga0495583_0008390 3300046506 Bacteria 6323
172 Ga0495583_0025155 3300046506 Bacteria 2979
173 Ga0495583_0115972 3300046506 Bacteria 1131
174 Ga0495606_0048357 3300046507 Bacteria 2798
175 Ga0495606_0094289 3300046507 Bacteria 1835
176 Ga0495606_0169419 3300046507 Bacteria 1268
177 Ga0495610_0001066 3300046512 Bacteria 25220
178 Ga0495616_0000264 3300046513 Bacteria 42334
179 Ga0495616_0000530 3300046513 Bacteria 28838
180 Ga0495616_0001413 3300046513 Bacteria 16714
181 Ga0495616_0004752 3300046513 Bacteria 8512
182 Ga0495616_0018326 3300046513 Bacteria 3844
183 Ga0495616_0019508 3300046513 Bacteria 3700
184 Ga0495616_0029446 3300046513 Bacteria 2899
185 Ga0495616_0046072 3300046513 Bacteria 2203
186 Ga0495616_0049758 3300046513 Bacteria 2099
187 Ga0495616_0132951 3300046513 Bacteria 1138
188 Ga0495616_0142110 3300046513 Bacteria 1092
189 Ga0495631_0000356 3300046518 Bacteria 31531
190 Ga0495631_0000786 3300046518 Bacteria 20328
191 Ga0495631_0006083 3300046518 Bacteria 6265
192 Ga0495631_0008813 3300046518 Bacteria 5065
193 Ga0495631_0010599 3300046518 Bacteria 4557
194 Ga0495631_0012918 3300046518 Bacteria 4065
195 Ga0495631_0039844 3300046518 Bacteria 2082
196 Ga0495631_0046998 3300046518 Bacteria 1896
197 Ga0495631_0053791 3300046518 Bacteria 1757
198 Ga0495632_0000044 3300046519 Bacteria 141051
199 Ga0495632_0000066 3300046519 Bacteria 115170
200 Ga0495632_0000319 3300046519 Bacteria 46342
201 Ga0495632_0001624 3300046519 Bacteria 18447
202 Ga0495632_0003640 3300046519 Bacteria 10830
203 Ga0495632_0112484 3300046519 Bacteria 1277
204 Ga0495637_0000891 3300046520 Bacteria 19260
205 Ga0495637_0040077 3300046520 Bacteria 2018
206 Ga0495637_0047303 3300046520 Bacteria 1816
207 Ga0495643_0000270 3300046522 Bacteria 75265
208 Ga0495643_0000808 3300046522 Bacteria 34481
209 Ga0495643_0001952 3300046522 Bacteria 17344
210 Ga0495643_0009737 3300046522 Bacteria 5944
211 Ga0495643_0021440 3300046522 Bacteria 3706
212 Ga0495643_0049988 3300046522 Bacteria 2253
213 Ga0495643_0107191 3300046522 Bacteria 1425
214 Ga0495644_0007951 3300046523 Bacteria 4082
215 Ga0495644_0008476 3300046523 Bacteria 3959
216 Ga0495644_0011098 3300046523 Bacteria 3472
217 Ga0495644_0030481 3300046523 Bacteria 2036
218 Ga0495644_0046047 3300046523 Bacteria 1639
219 Ga0495648_0000106 3300046524 Bacteria 105647
220 Ga0495648_0002974 3300046524 Bacteria 15212
221 Ga0495648_0019518 3300046524 Bacteria 4763
222 Ga0495648_0032175 3300046524 Bacteria 3446
223 Ga0495648_0033494 3300046524 Bacteria 3354
224 Ga0495648_0041574 3300046524 Bacteria 2901
225 Ga0495648_0042393 3300046524 Bacteria 2863
226 Ga0495666_0002973 3300046526 Bacteria 8499
227 Ga0495666_0017828 3300046526 Bacteria 3536
228 Ga0495666_0031784 3300046526 Bacteria 2586
229 Ga0495642_0000053 3300046528 Bacteria 70172
230 Ga0495642_0000300 3300046528 Bacteria 27947
231 Ga0495642_0000343 3300046528 Bacteria 25275
232 Ga0495642_0009380 3300046528 Bacteria 3747
233 Ga0495642_0021188 3300046528 Bacteria 2555
234 Ga0495642_0038146 3300046528 Bacteria 1946
235 Ga0495642_0113833 3300046528 Bacteria 1158
236 Ga0495654_0012195 3300046530 Bacteria 4623
237 Ga0495654_0015418 3300046530 Bacteria 4057
238 Ga0495654_0048610 3300046530 Bacteria 2080
239 Ga0495665_0001565 3300046531 Bacteria 12217
240 Ga0495665_0065719 3300046531 Bacteria 1914
241 Ga0495665_0148866 3300046531 Bacteria 1222
242 Ga0495586_0012203 3300046535 Bacteria 4562
243 Ga0495586_0036443 3300046535 Bacteria 2640
244 Ga0495586_0037118 3300046535 Bacteria 2615
245 Ga0495586_0045294 3300046535 Bacteria 2370
246 Ga0495586_0245894 3300046535 Bacteria 1020
247 Ga0495587_0109641 3300046536 Bacteria 1586
248 Ga0495587_0156568 3300046536 Bacteria 1297
249 Ga0495609_0000001 3300046538 Bacteria 1060094
250 Ga0495609_0002078 3300046538 Bacteria 12599
251 Ga0495609_0002082 3300046538 Bacteria 12582
252 Ga0495609_0031311 3300046538 Bacteria 2418
253 Ga0495609_0115019 3300046538 Bacteria 1159
254 Ga0495597_0000504 3300046542 Bacteria 32462
255 Ga0495597_0000658 3300046542 Bacteria 28082
256 Ga0495597_0008283 3300046542 Bacteria 5213
257 Ga0495597_0014490 3300046542 Bacteria 3753
258 Ga0495597_0026776 3300046542 Bacteria 2648
259 Ga0495597_0047430 3300046542 Bacteria 1901
260 Ga0495597_0053757 3300046542 Bacteria 1770
261 Ga0495622_0005090 3300046557 Bacteria 6090
262 Ga0495622_0010867 3300046557 Bacteria 4199
263 Ga0495622_0023292 3300046557 Bacteria 2885
264 Ga0495633_0001156 3300046558 Bacteria 21188
265 Ga0495633_0001930 3300046558 Bacteria 15095
266 Ga0495633_0006374 3300046558 Bacteria 7007
267 Ga0495633_0022973 3300046558 Bacteria 3093
268 Ga0495656_0011492 3300046615 Bacteria 3251
269 Ga0495668_0000166 3300046616 Bacteria 97647
270 Ga0495668_0000717 3300046616 Bacteria 39917
271 Ga0495668_0001640 3300046616 Bacteria 20874
272 Ga0495668_0020913 3300046616 Bacteria 3758
273 Ga0495668_0024551 3300046616 Bacteria 3428
274 Ga0495668_0059057 3300046616 Bacteria 2116
275 Ga0495668_0063907 3300046616 Bacteria 2026
276 Ga0495668_0064553 3300046616 Bacteria 2015
277 Ga0495668_0197379 3300046616 Bacteria 1102
278 Ga0495634_0012137 3300046642 Bacteria 6244
279 Ga0495611_0001640 3300046648 Bacteria 10856
280 Ga0495611_0008264 3300046648 Bacteria 4413
281 Ga0495611_0086329 3300046648 Bacteria 1447
282 Ga0495611_0087901 3300046648 Bacteria 1434
283 Ga0495625_0020053 3300046660 Bacteria 5168
284 Ga0495625_0149600 3300046660 Bacteria 1570
285 Ga0495625_0164539 3300046660 Bacteria 1484
286 Ga0495625_0208244 3300046660 Bacteria 1286
287 Ga0495635_0003814 3300046663 Bacteria 10471
288 Ga0495661_0000069 3300046665 Bacteria 125790
289 Ga0495661_0000318 3300046665 Bacteria 53289
290 Ga0495661_0002959 3300046665 Bacteria 12831
291 Ga0495661_0006139 3300046665 Bacteria 8459
292 Ga0495661_0013541 3300046665 Bacteria 5474
293 Ga0495661_0035584 3300046665 Bacteria 3122
294 Ga0495661_0039874 3300046665 Bacteria 2916
295 Ga0495661_0045898 3300046665 Bacteria 2669
296 Ga0495661_0047647 3300046665 Bacteria 2608
297 Ga0495661_0048346 3300046665 Bacteria 2584
298 Ga0495661_0059626 3300046665 Bacteria 2270
299 Ga0495661_0067348 3300046665 Bacteria 2103
300 Ga0495661_0099690 3300046665 Bacteria 1637
301 Ga0495661_0104588 3300046665 Bacteria 1587
302 Ga0495588_0000041 3300046674 Bacteria 377896
303 Ga0495588_0005789 3300046674 Bacteria 5525
304 Ga0495588_0006370 3300046674 Bacteria 5313
305 Ga0495588_0012281 3300046674 Bacteria 4042
306 Ga0495588_0014270 3300046674 Bacteria 3800
307 Ga0495588_0014797 3300046674 Bacteria 3742
308 Ga0495588_0016927 3300046674 Bacteria 3532
309 Ga0495588_0026354 3300046674 Bacteria 2901
310 Ga0495588_0055658 3300046674 Bacteria 2041
311 Ga0495623_0029040 3300046679 Bacteria 3560
312 Ga0495623_0071293 3300046679 Bacteria 2162
313 Ga0495669_0000274 3300046684 Bacteria 29455
314 Ga0495669_0010427 3300046684 Bacteria 3927
315 Ga0495669_0021362 3300046684 Bacteria 2808
316 Ga0495669_0033252 3300046684 Bacteria 2269
317 Ga0495669_0049948 3300046684 Bacteria 1874
318 Ga0495613_0055405 3300046689 Bacteria 2913
319 Ga0495613_0100617 3300046689 Bacteria 2088
320 Ga0495670_0000184 3300046691 Bacteria 28061
321 Ga0495670_0006588 3300046691 Bacteria 5709
322 Ga0495670_0010268 3300046691 Bacteria 4601
323 Ga0495670_0064917 3300046691 Bacteria 1839
324 Ga0495670_0088886 3300046691 Bacteria 1580
325 Ga0495670_0121078 3300046691 Bacteria 1359
326 Ga0495671_0000218 3300046692 Bacteria 49547
327 Ga0495671_0001510 3300046692 Bacteria 15570
328 Ga0495671_0026417 3300046692 Bacteria 3010
329 Ga0495671_0050050 3300046692 Bacteria 2082
330 Ga0495671_0060152 3300046692 Bacteria 1875
331 Ga0495649_0000515 3300046694 Bacteria 33088
332 Ga0495649_0001535 3300046694 Bacteria 17351
333 Ga0495649_0026263 3300046694 Bacteria 3240
334 Ga0495649_0060589 3300046694 Bacteria 2036
335 Ga0495649_0159655 3300046694 Bacteria 1182
336 Ga0495589_0000061 3300046794 Bacteria 104649
337 Ga0495589_0000382 3300046794 Bacteria 33916
338 Ga0495589_0000517 3300046794 Bacteria 27136
339 Ga0495589_0000794 3300046794 Bacteria 20051
340 Ga0495589_0020220 3300046794 Bacteria 3406
341 Ga0495589_0023879 3300046794 Bacteria 3110
342 Ga0495589_0043696 3300046794 Bacteria 2229
343 Ga0495600_0017551 3300046809 Bacteria 4554
344 Ga0495600_0106165 3300046809 Bacteria 1830
345 Ga0495660_0000243 3300046810 Bacteria 53378
346 Ga0495660_0010058 3300046810 Bacteria 5503
347 Ga0495660_0046997 3300046810 Bacteria 2365
348 Ga0495660_0070203 3300046810 Bacteria 1860
349 Ga0495660_0079451 3300046810 Bacteria 1722
350 Ga0495581_0001550 3300047315 Bacteria 12837
351 Ga0495581_0005005 3300047315 Bacteria 7677
352 Ga0495581_0022077 3300047315 Bacteria 3688
353 Ga0495581_0074011 3300047315 Bacteria 1971
354 Ga0495581_0290288 3300047315 Bacteria 956
355 Ga0495604_0020960 3300047317 Bacteria 5215
356 Ga0495604_0051083 3300047317 Bacteria 3207
357 Ga0495604_0171277 3300047317 Bacteria 1526
358 Ga0495604_0233637 3300047317 Bacteria 1260
359 Ga0495636_0002911 3300047318 Bacteria 6618
360 Ga0495636_0076340 3300047318 Bacteria 1437
361 Ga0495636_0114497 3300047318 Bacteria 1189
362 Ga0495674_0099981 3300047319 Bacteria 2469
363 Ga0495672_0000654 3300047320 Bacteria 38515
364 Ga0495672_0003159 3300047320 Bacteria 14330
365 Ga0495672_0005153 3300047320 Bacteria 10430
366 Ga0495672_0007500 3300047320 Bacteria 8199
367 Ga0495672_0009818 3300047320 Bacteria 6888
368 Ga0495672_0023496 3300047320 Bacteria 3990
369 Ga0495672_0072410 3300047320 Bacteria 1947
370 Ga0495676_0000452 3300047321 Bacteria 33608
371 Ga0495676_0012430 3300047321 Bacteria 7670
372 Ga0495680_0001787 3300047322 Bacteria 22767
373 Ga0495680_0174528 3300047322 Bacteria 1555
374 Ga0495683_0000566 3300047323 Bacteria 27912
375 Ga0495683_0007269 3300047323 Bacteria 6006
376 Ga0495683_0018868 3300047323 Bacteria 3561
377 Ga0495683_0039782 3300047323 Bacteria 2376
378 Ga0495683_0041233 3300047323 Bacteria 2330
379 Ga0495683_0057107 3300047323 Bacteria 1940
380 Ga0495687_000027 3300047443 Bacteria 299689
381 Ga0495687_000034 3300047443 Bacteria 257321
382 Ga0495687_000630 3300047443 Bacteria 40345
383 Ga0495687_001081 3300047443 Bacteria 26800
384 Ga0495687_001947 3300047443 Bacteria 17681
385 Ga0495687_021711 3300047443 Bacteria 3098
386 Ga0495687_051201 3300047443 Bacteria 1754
387 Ga0495675_0003165 3300047444 Bacteria 9883
388 Ga0495675_0015832 3300047444 Bacteria 4769
389 Ga0495677_0000001 3300047445 Bacteria 715000
390 Ga0495677_0000409 3300047445 Bacteria 18470
391 Ga0495677_0000432 3300047445 Bacteria 17905
392 Ga0495677_0004067 3300047445 Bacteria 5644
393 Ga0495677_0005517 3300047445 Bacteria 4797
394 Ga0495677_0007944 3300047445 Bacteria 3942
395 Ga0495677_0008720 3300047445 Bacteria 3762
396 Ga0495677_0021654 3300047445 Bacteria 2330
397 Ga0495677_0024166 3300047445 Bacteria 2204
398 Ga0495677_0057585 3300047445 Bacteria 1437
399 Ga0495677_0075241 3300047445 Bacteria 1261
400 Ga0495677_0099818 3300047445 Bacteria 1098
401 Ga0495679_004401 3300047446 Bacteria 6518
402 Ga0495679_008634 3300047446 Bacteria 4128
403 Ga0495679_013585 3300047446 Bacteria 3048
404 Ga0495685_004416 3300047447 Bacteria 4544
405 Ga0495685_013278 3300047447 Bacteria 2794
406 Ga0495685_052404 3300047447 Bacteria 1382
407 Ga0495681_0000518 3300047470 Bacteria 29464
408 Ga0495681_0000973 3300047470 Bacteria 21907
409 Ga0495681_0001441 3300047470 Bacteria 17863
410 Ga0495681_0019399 3300047470 Bacteria 3714
411 Ga0495681_0095671 3300047470 Bacteria 1305
412 Ga0495686_0001241 3300047472 Bacteria 29062
413 Ga0495686_0001624 3300047472 Bacteria 23531
414 Ga0495686_0080772 3300047472 Bacteria 1987
415 Ga0495686_0109443 3300047472 Bacteria 1658
416 Ga0495593_0022334 3300047673 Bacteria 3526
417 Ga0495593_0055434 3300047673 Bacteria 2086
418 Ga0495593_0080677 3300047673 Bacteria 1683
419 Ga0495602_0082858 3300048088 Bacteria 2690
420 Ga0495614_0001028 3300048089 Bacteria 11903
421 Ga0495614_0002109 3300048089 Bacteria 8788
422 Ga0495615_0035827 3300048090 Bacteria 1214
423 Ga0495626_0000027 3300048091 Bacteria 206022
424 Ga0495626_0000193 3300048091 Bacteria 73924
425 Ga0495626_0002085 3300048091 Bacteria 14557
426 Ga0495626_0002164 3300048091 Bacteria 14145
427 Ga0495626_0004335 3300048091 Bacteria 8749
428 Ga0495626_0005094 3300048091 Bacteria 7833
429 Ga0495626_0007170 3300048091 Bacteria 6232
430 Ga0495626_0009900 3300048091 Bacteria 5122
431 Ga0495626_0009957 3300048091 Bacteria 5107
432 Ga0495626_0013131 3300048091 Bacteria 4314
433 Ga0495626_0022111 3300048091 Bacteria 3143
434 Ga0495626_0039044 3300048091 Bacteria 2248
435 Ga0495626_0050641 3300048091 Bacteria 1918
436 Ga0495626_0056949 3300048091 Bacteria 1788
437 Ga0495626_0057234 3300048091 Bacteria 1784
438 Ga0495626_0075754 3300048091 Bacteria 1503
439 Ga0495626_0098459 3300048091 Bacteria 1277
440 Ga0495626_0116817 3300048091 Bacteria 1150
441 Ga0496100_0019484 3300048903 Bacteria 4049
442 Ga0496101_0282636 3300048904 Bacteria 1297
443 Ga0496102_0000058 3300048905 Bacteria 168714
444 Ga0496102_0153921 3300048905 Bacteria 2161
445 Ga0496102_0355943 3300048905 Bacteria 1378
446 Ga0496102_0525738 3300048905 Bacteria 1105
447 Ga0496102_0579524 3300048905 Bacteria 1045
448 Ga0496103_0049096 3300048906 Bacteria 2609
449 Ga0496103_0226450 3300048906 Bacteria 1202
450 Ga0496103_0262089 3300048906 Bacteria 1112
451 Ga0496104_0599426 3300048907 Bacteria 1012
452 Ga0496105_0101583 3300048908 Bacteria 2375
453 Ga0496106_0007192 3300048909 Bacteria 8222
454 Ga0496106_0268333 3300048909 Bacteria 1366
455 Ga0496107_0016312 3300048910 Bacteria 5214
456 Ga0496107_0115297 3300048910 Bacteria 1977
457 Ga0496108_0374131 3300048911 Bacteria 1244
458 Ga0496109_0072821 3300048912 Bacteria 3157
459 Ga0496110_0000531 3300048913 Bacteria 25914
460 Ga0496110_0013829 3300048913 Bacteria 6688
461 Ga0496110_0250847 3300048913 Bacteria 1611
462 Ga0496111_0166015 3300048914 Bacteria 1639
463 Ga0496113_0002883 3300048916 Bacteria 10125
464 Ga0496113_0006153 3300048916 Bacteria 7576
465 Ga0496113_0317723 3300048916 Bacteria 1248
466 Ga0496115_0095692 3300048918 Bacteria 2431
467 Ga0496115_0136267 3300048918 Bacteria 2024
468 Ga0496122_0000180 3300048925 Bacteria 148816
469 Ga0496122_0010827 3300048925 Bacteria 9342
470 Ga0496122_0135615 3300048925 Bacteria 1552
471 Ga0496123_0000138 3300048926 Bacteria 151844
472 Ga0496123_0004638 3300048926 Bacteria 14281
473 Ga0496124_0010461 3300048927 Bacteria 9392
474 Ga0496124_0048458 3300048927 Bacteria 3630
475 Ga0496124_0081596 3300048927 Bacteria 2657
476 Ga0496124_0177115 3300048927 Bacteria 1645
477 Ga0496125_0007386 3300048928 Bacteria 11698
478 Ga0496125_0082105 3300048928 Bacteria 2459
479 Ga0495678_000156 3300049459 Bacteria 81252
480 Ga0495678_000366 3300049459 Bacteria 46246
481 Ga0495678_000695 3300049459 Bacteria 30589
482 Ga0495678_000765 3300049459 Bacteria 29082
483 Ga0495678_008897 3300049459 Bacteria 5020
484 Ga0495682_0000725 3300049460 Bacteria 21395
485 Ga0495682_0007881 3300049460 Bacteria 4212
486 Ga0495682_0022867 3300049460 Bacteria 2336
487 Ga0495682_0080126 3300049460 Bacteria 1174
488 Ga0501035_0011928 3300049822 Bacteria 8043
489 2643799002 2643221556 Bacteria 7251154
490 2644473667 2643221684 Bacteria 7145183
491 2809143121 2808606418 Bacteria 6724496
492 8047679397 8047673197 Bacteria 7395230
493 Ga0395898_0092383
494 Ga0055525_1000008
495 Ga0065165_1012753
496 Ga0070658_10059204
497 Ga0070658_10080035
498 Ga0070660_100074138
499 Ga0070660_100074441
500 Ga0070660_100343496
501 Ga0070661_100135864
502 Ga0070661_100459480
503 Ga0070659_100068742
504 Ga0070706_100564737
505 Ga0068855_100120300
506 Ga0068855_100330491
507 Ga0070664_100033886
508 Ga0070664_100156432
509 Ga0070664_100396776
510 Ga0068852_100285134
511 Ga0105245_10248719
512 Ga0105241_10098854
513 Ga0105239_10275334
514 Ga0105246_10412462
515 Ga0157371_10001021
516 Ga0157369_10249008
517 Ga0157372_10868793
518 Ga0182008_10006667
519 Ga0209563_100003
520 Ga0209677_102278
521 Ga0209148_1000576
522 Ga0207705_10004607
523 Ga0207705_10064056
524 Ga0207654_10119246
525 Ga0207657_10072829
526 Ga0207657_10086975
527 Ga0207657_10159962
528 Ga0207690_10178669
529 Ga0207706_10261419
530 Ga0207679_10114243
531 Ga0207679_10156480
532 Ga0207667_10047696
533 Ga0207667_10276248
534 Ga0207667_10331276
535 Ga0207698_10359469
536 Ga0316180_1103205
537 Ga0316182_1397066
538 Ga0395899_0004157
539 Ga0395899_0027459
540 Ga0395899_0031351
541 Ga0395900_0000028
542 Ga0395900_0003173
543 Ga0395900_0016881
544 Ga0395900_0051830
545 Ga0395900_0063351
546 Ga0395900_0137921
547 Ga0395900_0242024
548 Ga0395900_0686201
549 Ga0395898_0113842
550 Ga0395898_0126151
551 Ga0395905_0036653
552 Ga0395905_0049521
553 Ga0395905_0117618
554 Ga0395905_0157921
555 Ga0395905_0161250
556 Ga0395905_0258467
557 Ga0395905_0359023
558 Ga0395901_0000025
559 Ga0395901_0006376
560 Ga0395901_0353414
561 Ga0395901_0390681
562 Ga0395901_0456250
563 Ga0395901_0552792
564 Ga0439448_0014565
565 Ga0439449_0007337
566 Ga0439450_020830
567 Ga0466969_0070068
568 Ga0466969_0136511
569 Ga0466972_0007333
570 Ga0466965_0007268
571 Ga0466965_0049443
572 Ga0466965_0254083
573 Ga0466966_0061803
574 Ga0466966_0074939
575 Ga0466961_0060335
576 Ga0466961_0088503
577 Ga0466961_0088572
578 Ga0466964_0020437
579 Ga0466968_0003376
580 Ga0466970_0247236
581 Ga0466957_0003369
582 Ga0466957_0031062
583 Ga0466957_0148133
584 Ga0466957_0291203
585 Ga0466959_0091283
586 Ga0466959_0122962
587 Ga0466958_0094947
588 Ga0466958_0104503
589 Ga0466958_0239957
590 Ga0466958_0289067
591 Ga0466967_0081653
592 Ga0495617_000012
593 Ga0495627_000298
594 Ga0495627_032709
595 Ga0495603_0028745
596 Ga0495590_0000203
597 Ga0495590_0007711
598 Ga0495590_0110206
599 Ga0495591_000577
600 Ga0495591_010110
601 Ga0495638_0027237
602 Ga0495638_0113753
603 Ga0495653_0008555
604 Ga0495653_0303083
605 Ga0495650_0001604
606 Ga0495582_0002923
607 Ga0495582_0017654
608 Ga0495605_0000070
609 Ga0495605_0000419
610 Ga0495605_0009976
611 Ga0495605_0044935
612 Ga0495605_0051891
613 Ga0495605_0055829
614 Ga0495605_0058932
615 Ga0495605_0107306
616 Ga0495584_0000369
617 Ga0495584_0003778
618 Ga0495584_0006695
619 Ga0495584_0015874
620 Ga0495584_0026735
621 Ga0495584_0035419
622 Ga0495584_0060198
623 Ga0495584_0070224
624 Ga0495584_0106213
625 Ga0495584_0110967
626 Ga0495585_0000755
627 Ga0495585_0002590
628 Ga0495585_0009411
629 Ga0495585_0036441
630 Ga0495585_0046112
631 Ga0495585_0048447
632 Ga0495585_0081558
633 Ga0495585_0163780
634 Ga0495594_0006776
635 Ga0495594_0047869
636 Ga0495594_0087088
637 Ga0495594_0109307
638 Ga0495596_0001170
639 Ga0495596_0001215
640 Ga0495596_0003411
641 Ga0495596_0012248
642 Ga0495596_0013707
643 Ga0495596_0014627
644 Ga0495596_0018177
645 Ga0495596_0028220
646 Ga0495596_0040618
647 Ga0495596_0069701
648 Ga0495607_0001216
649 Ga0495607_0001460
650 Ga0495607_0001736
651 Ga0495607_0006527
652 Ga0495607_0011508
653 Ga0495607_0016564
654 Ga0495607_0021698
655 Ga0495607_0023238
656 Ga0495607_0025276
657 Ga0495607_0274409
658 Ga0495583_0000704
659 Ga0495583_0000895
660 Ga0495583_0001086
661 Ga0495583_0001654
662 Ga0495583_0005731
663 Ga0495583_0008390
664 Ga0495583_0025155
665 Ga0495583_0115972
666 Ga0495606_0048357
667 Ga0495606_0094289
668 Ga0495606_0169419
669 Ga0495610_0001066
670 Ga0495616_0000264
671 Ga0495616_0000530
672 Ga0495616_0001413
673 Ga0495616_0004752
674 Ga0495616_0018326
675 Ga0495616_0019508
676 Ga0495616_0029446
677 Ga0495616_0046072
678 Ga0495616_0049758
679 Ga0495616_0132951
680 Ga0495616_0142110
681 Ga0495631_0000356
682 Ga0495631_0000786
683 Ga0495631_0006083
684 Ga0495631_0008813
685 Ga0495631_0010599
686 Ga0495631_0012918
687 Ga0495631_0039844
688 Ga0495631_0046998
689 Ga0495631_0053791
690 Ga0495632_0000044
691 Ga0495632_0000066
692 Ga0495632_0000319
693 Ga0495632_0001624
694 Ga0495632_0003640
695 Ga0495632_0112484
696 Ga0495637_0000891
697 Ga0495637_0040077
698 Ga0495637_0047303
699 Ga0495643_0000270
700 Ga0495643_0000808
701 Ga0495643_0001952
702 Ga0495643_0009737
703 Ga0495643_0021440
704 Ga0495643_0049988
705 Ga0495643_0107191
706 Ga0495644_0007951
707 Ga0495644_0008476
708 Ga0495644_0011098
709 Ga0495644_0030481
710 Ga0495644_0046047
711 Ga0495648_0000106
712 Ga0495648_0002974
713 Ga0495648_0019518
714 Ga0495648_0032175
715 Ga0495648_0033494
716 Ga0495648_0041574
717 Ga0495648_0042393
718 Ga0495666_0002973
719 Ga0495666_0017828
720 Ga0495666_0031784
721 Ga0495642_0000053
722 Ga0495642_0000300
723 Ga0495642_0000343
724 Ga0495642_0009380
725 Ga0495642_0021188
726 Ga0495642_0038146
727 Ga0495642_0113833
728 Ga0495654_0012195
729 Ga0495654_0015418
730 Ga0495654_0048610
731 Ga0495665_0001565
732 Ga0495665_0065719
733 Ga0495665_0148866
734 Ga0495586_0012203
735 Ga0495586_0036443
736 Ga0495586_0037118
737 Ga0495586_0045294
738 Ga0495586_0245894
739 Ga0495587_0109641
740 Ga0495587_0156568
741 Ga0495609_0000001
742 Ga0495609_0002078
743 Ga0495609_0002082
744 Ga0495609_0031311
745 Ga0495609_0115019
746 Ga0495597_0000504
747 Ga0495597_0000658
748 Ga0495597_0008283
749 Ga0495597_0014490
750 Ga0495597_0026776
751 Ga0495597_0047430
752 Ga0495597_0053757
753 Ga0495622_0005090
754 Ga0495622_0010867
755 Ga0495622_0023292
756 Ga0495633_0001156
757 Ga0495633_0001930
758 Ga0495633_0006374
759 Ga0495633_0022973
760 Ga0495656_0011492
761 Ga0495668_0000166
762 Ga0495668_0000717
763 Ga0495668_0001640
764 Ga0495668_0020913
765 Ga0495668_0024551
766 Ga0495668_0059057
767 Ga0495668_0063907
768 Ga0495668_0064553
769 Ga0495668_0197379
770 Ga0495634_0012137
771 Ga0495611_0001640
772 Ga0495611_0008264
773 Ga0495611_0086329
774 Ga0495611_0087901
775 Ga0495625_0020053
776 Ga0495625_0149600
777 Ga0495625_0164539
778 Ga0495625_0208244
779 Ga0495635_0003814
780 Ga0495661_0000069
781 Ga0495661_0000318
782 Ga0495661_0002959
783 Ga0495661_0006139
784 Ga0495661_0013541
785 Ga0495661_0035584
786 Ga0495661_0039874
787 Ga0495661_0045898
788 Ga0495661_0047647
789 Ga0495661_0048346
790 Ga0495661_0059626
791 Ga0495661_0067348
792 Ga0495661_0099690
793 Ga0495661_0104588
794 Ga0495588_0000041
795 Ga0495588_0005789
796 Ga0495588_0006370
797 Ga0495588_0012281
798 Ga0495588_0014270
799 Ga0495588_0014797
800 Ga0495588_0016927
801 Ga0495588_0026354
802 Ga0495588_0055658
803 Ga0495623_0029040
804 Ga0495623_0071293
805 Ga0495669_0000274
806 Ga0495669_0010427
807 Ga0495669_0021362
808 Ga0495669_0033252
809 Ga0495669_0049948
810 Ga0495613_0055405
811 Ga0495613_0100617
812 Ga0495670_0000184
813 Ga0495670_0006588
814 Ga0495670_0010268
815 Ga0495670_0064917
816 Ga0495670_0088886
817 Ga0495670_0121078
818 Ga0495671_0000218
819 Ga0495671_0001510
820 Ga0495671_0026417
821 Ga0495671_0050050
822 Ga0495671_0060152
823 Ga0495649_0000515
824 Ga0495649_0001535
825 Ga0495649_0026263
826 Ga0495649_0060589
827 Ga0495649_0159655
828 Ga0495589_0000061
829 Ga0495589_0000382
830 Ga0495589_0000517
831 Ga0495589_0000794
832 Ga0495589_0020220
833 Ga0495589_0023879
834 Ga0495589_0043696
835 Ga0495600_0017551
836 Ga0495600_0106165
837 Ga0495660_0000243
838 Ga0495660_0010058
839 Ga0495660_0046997
840 Ga0495660_0070203
841 Ga0495660_0079451
842 Ga0495581_0001550
843 Ga0495581_0005005
844 Ga0495581_0022077
845 Ga0495581_0074011
846 Ga0495581_0290288
847 Ga0495604_0020960
848 Ga0495604_0051083
849 Ga0495604_0171277
850 Ga0495604_0233637
851 Ga0495636_0002911
852 Ga0495636_0076340
853 Ga0495636_0114497
854 Ga0495674_0099981
855 Ga0495672_0000654
856 Ga0495672_0003159
857 Ga0495672_0005153
858 Ga0495672_0007500
859 Ga0495672_0009818
860 Ga0495672_0023496
861 Ga0495672_0072410
862 Ga0495676_0000452
863 Ga0495676_0012430
864 Ga0495680_0001787
865 Ga0495680_0174528
866 Ga0495683_0000566
867 Ga0495683_0007269
868 Ga0495683_0018868
869 Ga0495683_0039782
870 Ga0495683_0041233
871 Ga0495683_0057107
872 Ga0495687_000027
873 Ga0495687_000034
874 Ga0495687_000630
875 Ga0495687_001081
876 Ga0495687_001947
877 Ga0495687_021711
878 Ga0495687_051201
879 Ga0495675_0003165
880 Ga0495675_0015832
881 Ga0495677_0000001
882 Ga0495677_0000409
883 Ga0495677_0000432
884 Ga0495677_0004067
885 Ga0495677_0005517
886 Ga0495677_0007944
887 Ga0495677_0008720
888 Ga0495677_0021654
889 Ga0495677_0024166
890 Ga0495677_0057585
891 Ga0495677_0075241
892 Ga0495677_0099818
893 Ga0495679_004401
894 Ga0495679_008634
895 Ga0495679_013585
896 Ga0495685_004416
897 Ga0495685_013278
898 Ga0495685_052404
899 Ga0495681_0000518
900 Ga0495681_0000973
901 Ga0495681_0001441
902 Ga0495681_0019399
903 Ga0495681_0095671
904 Ga0495686_0001241
905 Ga0495686_0001624
906 Ga0495686_0080772
907 Ga0495686_0109443
908 Ga0495593_0022334
909 Ga0495593_0055434
910 Ga0495593_0080677
911 Ga0495602_0082858
912 Ga0495614_0001028
913 Ga0495614_0002109
914 Ga0495615_0035827
915 Ga0495626_0000027
916 Ga0495626_0000193
917 Ga0495626_0002085
918 Ga0495626_0002164
919 Ga0495626_0004335
920 Ga0495626_0005094
921 Ga0495626_0007170
922 Ga0495626_0009900
923 Ga0495626_0009957
924 Ga0495626_0013131
925 Ga0495626_0022111
926 Ga0495626_0039044
927 Ga0495626_0050641
928 Ga0495626_0056949
929 Ga0495626_0057234
930 Ga0495626_0075754
931 Ga0495626_0098459
932 Ga0495626_0116817
933 Ga0496100_0019484
934 Ga0496101_0282636
935 Ga0496102_0000058
936 Ga0496102_0153921
937 Ga0496102_0355943
938 Ga0496102_0525738
939 Ga0496102_0579524
940 Ga0496103_0049096
941 Ga0496103_0226450
942 Ga0496103_0262089
943 Ga0496104_0599426
944 Ga0496105_0101583
945 Ga0496106_0007192
946 Ga0496106_0268333
947 Ga0496107_0016312
948 Ga0496107_0115297
949 Ga0496108_0374131
950 Ga0496109_0072821
951 Ga0496110_0000531
952 Ga0496110_0013829
953 Ga0496110_0250847
954 Ga0496111_0166015
955 Ga0496113_0002883
956 Ga0496113_0006153
957 Ga0496113_0317723
958 Ga0496115_0095692
959 Ga0496115_0136267
960 Ga0496122_0000180
961 Ga0496122_0010827
962 Ga0496122_0135615
963 Ga0496123_0000138
964 Ga0496123_0004638
965 Ga0496124_0010461
966 Ga0496124_0048458
967 Ga0496124_0081596
968 Ga0496124_0177115
969 Ga0496125_0007386
970 Ga0496125_0082105
971 Ga0495678_000156
972 Ga0495678_000366
973 Ga0495678_000695
974 Ga0495678_000765
975 Ga0495678_008897
976 Ga0495682_0000725
977 Ga0495682_0007881
978 Ga0495682_0022867
979 Ga0495682_0080126
980 Ga0501035_0011928
981 2643799002
982 2644473667
983 2809143121
984 8047679397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

19

181

0.81

PF12146

Hydrolase_4

Serine aminopeptidase, S33

15

164

0.8

PF06821

Ser_hydrolase

Serine hydrolase

24

123

0.76

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

23

268

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.8208 11 268
6idy-assembly1.cif.gz_A crystal structure of aspergillus fumigatus lipase b 0.76 12 112
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.759 11 268
5ie5-assembly2.cif.gz_C-2 crystal structure of a lactonase double mutant in complex with substrate a 0.7568 11 105
6idy-assembly3.cif.gz_C crystal structure of aspergillus fumigatus lipase b 0.7535 12 112
ID Description Score Start End Superfamily
3kxpG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.813 13 268 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8121 11 101 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8036 11 107 3.40.50.1820
3bdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7519 9 270 3.40.50.1820
af_Q59LU6_1_344_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7492 6 271 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q3JKJ8-F1-model_v4 deleted 0.9848 10 108
AF-A0A4Q3JKJ8-F1-model_v4 deleted 0.9751 10 108
AF-F3FSV4-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9616 10 101
AF-A0A104P8U6-F1-model_v4 Alpha/beta hydrolase 0.9417 12 280 GO:0016787
AF-A0A1X7DFK7-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9391 12 270

Map