F454108

General Info

Members Datasets Scaffolds Average Seq Length
491 226 982 185

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10089817|Ga0213876_100898172
Length 203
Sequence MVNFLQAIAGAPVAKEMPHGTLPLAYTFHFYLFGFIAMVSALLFVTRKSPVAAALWLVNTMFSLAALYVLLDAQFIGAIQVLVYAGAIMVVFLFVIMLLNLGRGVGGDIRSIGWKVVAGAVGIAILAQIFAVTKAKTAITLTLPAGYAATQIEQTGAITPIAAPLFNEYLLAFEVTSVLLLAAVVGAVVLGKQRSDAEGQNVA

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10089817 3300021384 Bacteria 1627
2 Ga0065715_10173820 3300005293 Bacteria 1527
3 Ga0070658_10002750 3300005327 Bacteria 14643
4 Ga0070658_10456383 3300005327 Bacteria 1101
5 Ga0070658_10912468 3300005327 Bacteria 764
6 Ga0070658_11107621 3300005327 Bacteria 689
7 Ga0070658_11363245 3300005327 Bacteria 616
8 Ga0070683_100021692 3300005329 Bacteria 5734
9 Ga0070683_100053034 3300005329 Bacteria 3758
10 Ga0070683_100056894 3300005329 Bacteria 3632
11 Ga0070683_100255184 3300005329 Bacteria 1668
12 Ga0070683_100319093 3300005329 Bacteria 1478
13 Ga0070683_100382227 3300005329 Bacteria 1342
14 Ga0070690_100003160 3300005330 Bacteria 8972
15 Ga0070670_100267609 3300005331 Bacteria 1491
16 Ga0070670_100754750 3300005331 Bacteria 877
17 Ga0068869_100008962 3300005334 Bacteria 6478
18 Ga0070666_10418658 3300005335 Bacteria 965
19 Ga0070680_100001111 3300005336 Bacteria 19323
20 Ga0070680_100017956 3300005336 Bacteria 5585
21 Ga0070680_100019940 3300005336 Bacteria 5316
22 Ga0070680_100021647 3300005336 Bacteria 5113
23 Ga0070680_100059655 3300005336 Bacteria 3122
24 Ga0070682_100001019 3300005337 Bacteria 16201
25 Ga0070682_101046850 3300005337 Bacteria 680
26 Ga0068868_100508931 3300005338 Bacteria 1056
27 Ga0070660_100004019 3300005339 Bacteria 10153
28 Ga0070660_100014965 3300005339 Bacteria 5596
29 Ga0070660_100379547 3300005339 Bacteria 1167
30 Ga0070691_10369818 3300005341 Bacteria 801
31 Ga0070687_100467171 3300005343 Bacteria 843
32 Ga0070661_100000287 3300005344 Bacteria 40709
33 Ga0070661_100023179 3300005344 Bacteria 4448
34 Ga0070661_100357676 3300005344 Bacteria 1147
35 Ga0070669_100120811 3300005353 Bacteria 1999
36 Ga0070669_100165125 3300005353 Bacteria 1723
37 Ga0070675_100002700 3300005354 Bacteria 13330
38 Ga0070675_100362183 3300005354 Bacteria 1288
39 Ga0070675_100733874 3300005354 Bacteria 901
40 Ga0070673_100038788 3300005364 Bacteria 3640
41 Ga0070659_100000566 3300005366 Bacteria 27029
42 Ga0070659_100074080 3300005366 Bacteria 2712
43 Ga0070667_100130913 3300005367 Bacteria 2189
44 Ga0070709_10005224 3300005434 Bacteria 7024
45 Ga0070714_100013381 3300005435 Bacteria 6575
46 Ga0070713_100106381 3300005436 Bacteria 2439
47 Ga0070713_100418437 3300005436 Bacteria 1254
48 Ga0070710_10106524 3300005437 Bacteria 1678
49 Ga0070710_10598944 3300005437 Bacteria 767
50 Ga0070711_100056995 3300005439 Bacteria 2703
51 Ga0070708_100000265 3300005445 Bacteria 38895
52 Ga0070663_100356305 3300005455 Bacteria 1186
53 Ga0070662_100268128 3300005457 Bacteria 1378
54 Ga0070681_10000220 3300005458 Bacteria 44725
55 Ga0070681_10003062 3300005458 Bacteria 15503
56 Ga0070681_10038477 3300005458 Bacteria 4796
57 Ga0070681_10137382 3300005458 Bacteria 2374
58 Ga0070681_10157595 3300005458 Bacteria 2194
59 Ga0068867_100867025 3300005459 Bacteria 810
60 Ga0070706_100905750 3300005467 Bacteria 815
61 Ga0070707_101381054 3300005468 Bacteria 671
62 Ga0070679_100002193 3300005530 Bacteria 17636
63 Ga0070679_100002840 3300005530 Bacteria 15740
64 Ga0070679_100003473 3300005530 Bacteria 14433
65 Ga0070679_100177725 3300005530 Bacteria 2101
66 Ga0070679_100335388 3300005530 Bacteria 1460
67 Ga0070679_100378808 3300005530 Bacteria 1362
68 Ga0070679_100630817 3300005530 Bacteria 1015
69 Ga0070679_100913025 3300005530 Bacteria 822
70 Ga0070684_100007582 3300005535 Bacteria 8451
71 Ga0070684_100008811 3300005535 Bacteria 7909
72 Ga0070684_100027011 3300005535 Bacteria 4840
73 Ga0070684_100054646 3300005535 Bacteria 3479
74 Ga0070684_100059121 3300005535 Bacteria 3351
75 Ga0070684_100059373 3300005535 Bacteria 3344
76 Ga0070684_100158461 3300005535 Bacteria 2053
77 Ga0070684_101100102 3300005535 Bacteria 747
78 Ga0068853_100035404 3300005539 Bacteria 4241
79 Ga0068853_100473832 3300005539 Bacteria 1180
80 Ga0068853_100649632 3300005539 Bacteria 1004
81 Ga0068853_100745195 3300005539 Bacteria 936
82 Ga0068853_101393899 3300005539 Bacteria 678
83 Ga0070672_100565876 3300005543 Bacteria 988
84 Ga0070696_100797881 3300005546 Bacteria 777
85 Ga0070693_100003978 3300005547 Bacteria 6938
86 Ga0070693_100311285 3300005547 Bacteria 1065
87 Ga0070665_100441983 3300005548 Bacteria 1310
88 Ga0068855_100015921 3300005563 Bacteria 9046
89 Ga0068855_100300762 3300005563 Bacteria 1777
90 Ga0068855_100886257 3300005563 Bacteria 943
91 Ga0068855_101006400 3300005563 Bacteria 875
92 Ga0068855_101274675 3300005563 Bacteria 762
93 Ga0068855_101579974 3300005563 Bacteria 671
94 Ga0070664_100003921 3300005564 Bacteria 12004
95 Ga0070664_100222638 3300005564 Bacteria 1689
96 Ga0070664_100919250 3300005564 Bacteria 821
97 Ga0068857_100157457 3300005577 Bacteria 2060
98 Ga0068854_100014867 3300005578 Bacteria 5139
99 Ga0068854_100236781 3300005578 Bacteria 1452
100 Ga0068854_100956364 3300005578 Bacteria 756
101 Ga0068856_100000868 3300005614 Bacteria 32382
102 Ga0068856_100320635 3300005614 Bacteria 1567
103 Ga0070702_100002075 3300005615 Bacteria 8491
104 Ga0068852_100004829 3300005616 Bacteria 9576
105 Ga0068852_100081876 3300005616 Bacteria 2867
106 Ga0068852_101638049 3300005616 Bacteria 666
107 Ga0068859_100002704 3300005617 Bacteria 18002
108 Ga0068864_100011899 3300005618 Bacteria 7184
109 Ga0068866_10067654 3300005718 Bacteria 1876
110 Ga0068863_100001868 3300005841 Bacteria 20951
111 Ga0068858_100442584 3300005842 Bacteria 1252
112 Ga0068860_100719460 3300005843 Bacteria 1009
113 Ga0070717_10156749 3300006028 Bacteria 1973
114 Ga0070712_100257583 3300006175 Bacteria 1397
115 Ga0097621_100049101 3300006237 Bacteria 3427
116 Ga0097621_100706427 3300006237 Bacteria 929
117 Ga0068871_100014345 3300006358 Bacteria 5905
118 Ga0075430_100000459 3300006846 Bacteria 30420
119 Ga0075430_100005574 3300006846 Bacteria 10632
120 Ga0075431_100347512 3300006847 Bacteria 1492
121 Ga0075433_10174486 3300006852 Bacteria 1913
122 Ga0075434_100145705 3300006871 Bacteria 2389
123 Ga0075434_100621513 3300006871 Bacteria 1099
124 Ga0068865_100421889 3300006881 Bacteria 1097
125 Ga0075436_100032480 3300006914 Bacteria 3598
126 Ga0075436_100535974 3300006914 Bacteria 858
127 Ga0097620_100002704 3300006931 Bacteria 18002
128 Ga0105240_10004867 3300009093 Bacteria 20207
129 Ga0105240_10302459 3300009093 Bacteria 1829
130 Ga0105240_10438790 3300009093 Bacteria 1463
131 Ga0105240_10895115 3300009093 Bacteria 955
132 Ga0105240_11017384 3300009093 Bacteria 885
133 Ga0105240_11399355 3300009093 Bacteria 735
134 Ga0105240_11620485 3300009093 Bacteria 677
135 Ga0105240_11626676 3300009093 Bacteria 675
136 Ga0105245_10036260 3300009098 Bacteria 4380
137 Ga0105245_10144856 3300009098 Bacteria 2241
138 Ga0105245_10457580 3300009098 Bacteria 1286
139 Ga0105245_10533879 3300009098 Bacteria 1193
140 Ga0114129_10083785 3300009147 Bacteria 4427
141 Ga0105241_10046466 3300009174 Bacteria 3297
142 Ga0105241_10546809 3300009174 Bacteria 1039
143 Ga0105241_10984739 3300009174 Bacteria 788
144 Ga0105241_11817435 3300009174 Bacteria 595
145 Ga0105242_10047881 3300009176 Bacteria 3472
146 Ga0105248_10016618 3300009177 Bacteria 8102
147 Ga0105248_10103368 3300009177 Bacteria 3211
148 Ga0105248_10126547 3300009177 Bacteria 2882
149 Ga0105237_10126790 3300009545 Bacteria 2547
150 Ga0105237_10518824 3300009545 Bacteria 1198
151 Ga0105237_11466690 3300009545 Bacteria 689
152 Ga0105238_10045745 3300009551 Bacteria 4421
153 Ga0105238_10903448 3300009551 Bacteria 902
154 Ga0105239_10047380 3300010375 Bacteria 4711
155 Ga0105239_10169091 3300010375 Bacteria 2444
156 Ga0105239_11148595 3300010375 Bacteria 894
157 Ga0105239_11936738 3300010375 Unclassified 684
158 Ga0157373_10023411 3300013100 Bacteria 4478
159 Ga0157373_10032714 3300013100 Bacteria 3743
160 Ga0157373_10126404 3300013100 Bacteria 1798
161 Ga0157373_10348239 3300013100 Bacteria 1056
162 Ga0157371_10006224 3300013102 Bacteria 9893
163 Ga0157371_10124278 3300013102 Bacteria 1835
164 Ga0157370_10004735 3300013104 Bacteria 15512
165 Ga0157370_10046071 3300013104 Bacteria 4182
166 Ga0157370_10133277 3300013104 Bacteria 2317
167 Ga0157370_10225395 3300013104 Bacteria 1735
168 Ga0157370_10286338 3300013104 Bacteria 1522
169 Ga0157370_10776484 3300013104 Bacteria 872
170 Ga0157370_10781331 3300013104 Bacteria 869
171 Ga0157370_10937354 3300013104 Bacteria 785
172 Ga0157369_10014379 3300013105 Bacteria 8937
173 Ga0157369_10024175 3300013105 Bacteria 6762
174 Ga0157369_10155261 3300013105 Bacteria 2418
175 Ga0157369_10175151 3300013105 Bacteria 2258
176 Ga0157369_10242726 3300013105 Bacteria 1881
177 Ga0157369_10245147 3300013105 Bacteria 1871
178 Ga0157369_10646827 3300013105 Bacteria 1090
179 Ga0157369_10860556 3300013105 Bacteria 930
180 Ga0157369_10942653 3300013105 Bacteria 885
181 Ga0157374_10460900 3300013296 Bacteria 1273
182 Ga0163162_11069328 3300013306 Bacteria 914
183 Ga0157372_10009748 3300013307 Bacteria 10216
184 Ga0157372_10019518 3300013307 Bacteria 7308
185 Ga0157372_10020025 3300013307 Bacteria 7213
186 Ga0157372_10051984 3300013307 Bacteria 4561
187 Ga0157372_10066182 3300013307 Bacteria 4060
188 Ga0157372_10111033 3300013307 Bacteria 3141
189 Ga0157372_10113569 3300013307 Bacteria 3104
190 Ga0157372_10144833 3300013307 Bacteria 2740
191 Ga0157372_10176880 3300013307 Bacteria 2470
192 Ga0157372_11179596 3300013307 Bacteria 885
193 Ga0157375_10055876 3300013308 Bacteria 3894
194 Ga0157375_10418982 3300013308 Bacteria 1505
195 Ga0163163_10704048 3300014325 Bacteria 1074
196 Ga0163163_11197303 3300014325 Bacteria 822
197 Ga0157377_10025851 3300014745 Bacteria 3135
198 Ga0157379_10527487 3300014968 Bacteria 1097
199 Ga0157379_11375530 3300014968 Bacteria 683
200 Ga0157376_10029056 3300014969 Bacteria 4402
201 Ga0157376_10367173 3300014969 Bacteria 1382
202 Ga0157376_10572182 3300014969 Bacteria 1121
203 Ga0157376_12557279 3300014969 Unclassified 550
204 Ga0182007_10131794 3300015262 Bacteria 841
205 Ga0163161_10502364 3300017792 Bacteria 988
206 Ga0213876_10045094 3300021384 Bacteria 2332
207 Ga0213876_10228835 3300021384 Bacteria 988
208 Ga0207692_10126523 3300025898 Bacteria 1438
209 Ga0207692_10283405 3300025898 Bacteria 1003
210 Ga0207642_10054805 3300025899 Bacteria 1820
211 Ga0207680_10334468 3300025903 Bacteria 1061
212 Ga0207647_10280465 3300025904 Bacteria 951
213 Ga0207645_10224792 3300025907 Bacteria 1238
214 Ga0207643_10064183 3300025908 Bacteria 2102
215 Ga0207705_10001680 3300025909 Bacteria 17619
216 Ga0207705_10014323 3300025909 Bacteria 5707
217 Ga0207705_10184670 3300025909 Bacteria 1575
218 Ga0207705_10572800 3300025909 Bacteria 878
219 Ga0207684_10028128 3300025910 Bacteria 4788
220 Ga0207654_10019995 3300025911 Bacteria 3542
221 Ga0207654_10213118 3300025911 Bacteria 1277
222 Ga0207707_10002874 3300025912 Bacteria 15385
223 Ga0207707_10028650 3300025912 Bacteria 4867
224 Ga0207707_10348239 3300025912 Bacteria 1277
225 Ga0207707_10912667 3300025912 Bacteria 725
226 Ga0207695_10001853 3300025913 Bacteria 33132
227 Ga0207695_10003306 3300025913 Bacteria 22870
228 Ga0207695_10028182 3300025913 Bacteria 6235
229 Ga0207695_10158608 3300025913 Bacteria 2196
230 Ga0207695_10233087 3300025913 Bacteria 1745
231 Ga0207695_10407967 3300025913 Bacteria 1243
232 Ga0207695_11410294 3300025913 Bacteria 577
233 Ga0207671_10677586 3300025914 Bacteria 820
234 Ga0207663_10042816 3300025916 Bacteria 2769
235 Ga0207660_10000108 3300025917 Bacteria 46937
236 Ga0207660_10009523 3300025917 Bacteria 6288
237 Ga0207660_10042765 3300025917 Bacteria 3181
238 Ga0207660_10048794 3300025917 Bacteria 2998
239 Ga0207660_10261300 3300025917 Bacteria 1369
240 Ga0207660_10405206 3300025917 Bacteria 1099
241 Ga0207662_10205242 3300025918 Bacteria 1277
242 Ga0207662_10502633 3300025918 Bacteria 835
243 Ga0207657_10016878 3300025919 Bacteria 7025
244 Ga0207657_10057518 3300025919 Bacteria 3351
245 Ga0207657_10319956 3300025919 Bacteria 1227
246 Ga0207657_10583887 3300025919 Bacteria 872
247 Ga0207649_10051371 3300025920 Bacteria 2552
248 Ga0207649_10517686 3300025920 Bacteria 909
249 Ga0207652_10009862 3300025921 Bacteria 7685
250 Ga0207652_10025644 3300025921 Bacteria 4903
251 Ga0207652_10029887 3300025921 Bacteria 4560
252 Ga0207652_10050130 3300025921 Bacteria 3576
253 Ga0207652_10078514 3300025921 Bacteria 2882
254 Ga0207652_10097995 3300025921 Bacteria 2585
255 Ga0207652_10169427 3300025921 Bacteria 1959
256 Ga0207652_10258093 3300025921 Bacteria 1572
257 Ga0207681_10289667 3300025923 Bacteria 1292
258 Ga0207694_10074005 3300025924 Bacteria 2666
259 Ga0207650_10003032 3300025925 Bacteria 11567
260 Ga0207659_10009074 3300025926 Bacteria 6205
261 Ga0207659_10212663 3300025926 Bacteria 1551
262 Ga0207687_10016558 3300025927 Bacteria 4843
263 Ga0207687_10248169 3300025927 Bacteria 1414
264 Ga0207687_10341205 3300025927 Bacteria 1218
265 Ga0207700_10021618 3300025928 Bacteria 4397
266 Ga0207700_10273915 3300025928 Bacteria 1449
267 Ga0207664_10012405 3300025929 Bacteria 6091
268 Ga0207664_10366120 3300025929 Bacteria 1278
269 Ga0207690_10008618 3300025932 Bacteria 6048
270 Ga0207690_10066164 3300025932 Bacteria 2474
271 Ga0207706_10008848 3300025933 Bacteria 9267
272 Ga0207686_10052565 3300025934 Bacteria 2543
273 Ga0207665_10068466 3300025939 Bacteria 2419
274 Ga0207691_10858400 3300025940 Bacteria 761
275 Ga0207711_10003320 3300025941 Bacteria 13958
276 Ga0207711_10221842 3300025941 Bacteria 1729
277 Ga0207689_10010032 3300025942 Bacteria 8166
278 Ga0207689_10206927 3300025942 Bacteria 1621
279 Ga0207661_10001301 3300025944 Bacteria 16701
280 Ga0207661_10004055 3300025944 Bacteria 10232
281 Ga0207661_10004809 3300025944 Bacteria 9456
282 Ga0207661_10024086 3300025944 Bacteria 4608
283 Ga0207661_10031205 3300025944 Bacteria 4113
284 Ga0207661_10046637 3300025944 Bacteria 3436
285 Ga0207661_10165845 3300025944 Bacteria 1919
286 Ga0207661_10216643 3300025944 Bacteria 1690
287 Ga0207661_10451967 3300025944 Bacteria 1170
288 Ga0207679_10001306 3300025945 Bacteria 15754
289 Ga0207679_10317196 3300025945 Bacteria 1348
290 Ga0207679_10608546 3300025945 Bacteria 985
291 Ga0207667_10052404 3300025949 Bacteria 4297
292 Ga0207667_10120706 3300025949 Bacteria 2701
293 Ga0207667_10542131 3300025949 Bacteria 1177
294 Ga0207667_10922502 3300025949 Bacteria 864
295 Ga0207667_10924105 3300025949 Bacteria 863
296 Ga0207712_10762700 3300025961 Bacteria 848
297 Ga0207668_10053330 3300025972 Bacteria 2802
298 Ga0207640_10131726 3300025981 Bacteria 1809
299 Ga0207640_10491355 3300025981 Bacteria 1020
300 Ga0207658_10576291 3300025986 Bacteria 1009
301 Ga0207677_10016765 3300026023 Bacteria 4349
302 Ga0207703_10434500 3300026035 Bacteria 1224
303 Ga0207639_10064975 3300026041 Bacteria 2831
304 Ga0207639_10268767 3300026041 Bacteria 1495
305 Ga0207639_10801479 3300026041 Bacteria 878
306 Ga0207702_10151834 3300026078 Bacteria 2107
307 Ga0207702_10217659 3300026078 Bacteria 1779
308 Ga0207702_10259686 3300026078 Bacteria 1635
309 Ga0207648_10049489 3300026089 Bacteria 3677
310 Ga0207648_11162624 3300026089 Bacteria 724
311 Ga0207676_10001736 3300026095 Bacteria 16029
312 Ga0207676_10162238 3300026095 Bacteria 1938
313 Ga0207674_10000603 3300026116 Bacteria 47253
314 Ga0207674_10239675 3300026116 Bacteria 1761
315 Ga0207675_100180577 3300026118 Bacteria 2021
316 Ga0207683_10856366 3300026121 Bacteria 844
317 Ga0207698_10004555 3300026142 Bacteria 8461
318 Ga0207698_10208269 3300026142 Bacteria 1757
319 Ga0268266_10336502 3300028379 Bacteria 1416
320 Ga0268264_10020159 3300028381 Bacteria 5449
321 Ga0268264_10130820 3300028381 Bacteria 2224
322 Ga0307413_10664532 3300031824 Bacteria 861
323 Ga0307413_11064463 3300031824 Unclassified 697
324 Ga0307410_10168066 3300031852 Bacteria 1650
325 Ga0307406_10473587 3300031901 Bacteria 1010
326 Ga0307407_10307943 3300031903 Bacteria 1107
327 Ga0307416_100483249 3300032002 Bacteria 1299
328 Ga0307416_100757951 3300032002 Bacteria 1064
329 Ga0307414_10506724 3300032004 Bacteria 1069
330 Ga0373934_0000613 3300035086 Bacteria 12584
331 Ga0373934_0015438 3300035086 Bacteria 2898
332 Ga0373923_0021276 3300035111 Bacteria 2530
333 Ga0373923_0389946 3300035111 Bacteria 669
334 Ga0373945_0043325 3300035116 Bacteria 1633
335 Ga0373953_0061654 3300035117 Bacteria 1534
336 Ga0373953_0085334 3300035117 Bacteria 1317
337 Ga0373956_0079954 3300035119 Bacteria 1499
338 Ga0373957_0011425 3300035120 Bacteria 2964
339 Ga0373955_0000555 3300035172 Bacteria 15870
340 Ga0373955_0024136 3300035172 Bacteria 3106
341 Ga0373935_0222044 3300035692 Bacteria 1313
342 Ga0373927_0027933 3300035695 Bacteria 3682
343 Ga0373933_0000055 3300035724 Bacteria 67484
344 Ga0373933_0006643 3300035724 Bacteria 6300
345 Ga0373947_0043390 3300035725 Bacteria 2686
346 Ga0373937_0000450 3300036401 Bacteria 37946
347 Ga0373937_0006326 3300036401 Bacteria 10210
348 Ga0373937_0081032 3300036401 Bacteria 3002
349 Ga0373937_0244282 3300036401 Bacteria 1692
350 Ga0373925_0160321 3300037068 Bacteria 1771
351 Ga0373925_0218344 3300037068 Bacteria 1521
352 Ga0395905_0111873 3300037471 Bacteria 2564
353 Ga0436365_0348834 3300039437 Bacteria 892
354 Ga0436365_0469632 3300039437 Bacteria 1805
355 Ga0436365_0999307 3300039437 Bacteria 1004
356 Ga0436365_1780610 3300039437 Bacteria 4529
357 Ga0439455_0097293 3300042012 Bacteria 811
358 Ga0451576_0249711 3300045051 Bacteria 1854
359 Ga0451576_0833357 3300045051 Bacteria 968
360 Ga0466967_0096318 3300045976 Bacteria 2699
361 Ga0466967_0281410 3300045976 Bacteria 1596
362 Ga0466967_0501062 3300045976 Bacteria 1192
363 Ga0495592_0002705 3300046454 Bacteria 12543
364 Ga0495592_0028290 3300046454 Bacteria 4246
365 Ga0495629_0064592 3300046459 Bacteria 2556
366 Ga0495629_0065595 3300046459 Bacteria 2534
367 Ga0495629_0142153 3300046459 Bacteria 1669
368 Ga0495629_0619537 3300046459 Bacteria 723
369 Ga0495651_0000996 3300046462 Bacteria 21980
370 Ga0495651_0024457 3300046462 Bacteria 4698
371 Ga0495651_0128516 3300046462 Bacteria 1853
372 Ga0495653_0000195 3300046463 Bacteria 49244
373 Ga0495653_0079291 3300046463 Bacteria 2432
374 Ga0495580_0068932 3300046472 Bacteria 2472
375 Ga0495580_0078085 3300046472 Bacteria 2309
376 Ga0495582_0041545 3300046473 Bacteria 2534
377 Ga0495582_0199520 3300046473 Bacteria 1142
378 Ga0495582_0300495 3300046473 Bacteria 922
379 Ga0495639_0089033 3300046475 Bacteria 1446
380 Ga0495639_0115874 3300046475 Bacteria 1275
381 Ga0495639_0120029 3300046475 Bacteria 1254
382 Ga0495662_0115906 3300046476 Bacteria 1314
383 Ga0495662_0170035 3300046476 Bacteria 1074
384 Ga0495664_0054273 3300046477 Bacteria 2383
385 Ga0495664_0147235 3300046477 Bacteria 1428
386 Ga0495594_0019078 3300046499 Bacteria 3642
387 Ga0495594_0036114 3300046499 Bacteria 2694
388 Ga0495608_0000085 3300046511 Bacteria 68124
389 Ga0495608_0306564 3300046511 Bacteria 982
390 Ga0495618_0081191 3300046514 Bacteria 2070
391 Ga0495628_0019544 3300046516 Bacteria 5598
392 Ga0495628_0034222 3300046516 Bacteria 4088
393 Ga0495628_0203309 3300046516 Bacteria 1492
394 Ga0495628_0315535 3300046516 Bacteria 1154
395 Ga0495630_0022736 3300046517 Bacteria 4631
396 Ga0495630_0155017 3300046517 Bacteria 1743
397 Ga0495630_0168493 3300046517 Bacteria 1668
398 Ga0495666_0121623 3300046526 Bacteria 1222
399 Ga0495652_0001945 3300046529 Bacteria 21956
400 Ga0495652_0008685 3300046529 Bacteria 9262
401 Ga0495652_0208172 3300046529 Bacteria 1479
402 Ga0495665_0103981 3300046531 Bacteria 1490
403 Ga0495665_0106728 3300046531 Bacteria 1469
404 Ga0495665_0171566 3300046531 Bacteria 1129
405 Ga0495665_0289895 3300046531 Bacteria 839
406 Ga0495640_0304947 3300046533 Bacteria 988
407 Ga0495586_0080109 3300046535 Bacteria 1793
408 Ga0495587_0000114 3300046536 Bacteria 61671
409 Ga0495587_0006144 3300046536 Bacteria 7837
410 Ga0495587_0012708 3300046536 Bacteria 5295
411 Ga0495645_0000144 3300046543 Bacteria 48490
412 Ga0495645_0003374 3300046543 Bacteria 10824
413 Ga0495645_0004180 3300046543 Bacteria 9866
414 Ga0495667_0000241 3300046559 Bacteria 35516
415 Ga0495667_0014305 3300046559 Bacteria 5360
416 Ga0495667_0022631 3300046559 Bacteria 4234
417 Ga0495635_0000253 3300046663 Bacteria 34161
418 Ga0495588_0066857 3300046674 Bacteria 1866
419 Ga0495657_0000210 3300046675 Bacteria 52663
420 Ga0495657_0048442 3300046675 Bacteria 2867
421 Ga0495657_0075496 3300046675 Bacteria 2191
422 Ga0495599_0002826 3300046678 Bacteria 10115
423 Ga0495623_0000305 3300046679 Bacteria 31845
424 Ga0495623_0042320 3300046679 Bacteria 2902
425 Ga0495623_0076599 3300046679 Bacteria 2075
426 Ga0495646_0011487 3300046680 Bacteria 5621
427 Ga0495646_0087381 3300046680 Bacteria 1807
428 Ga0495613_0140181 3300046689 Bacteria 1728
429 Ga0495613_0205812 3300046689 Bacteria 1386
430 Ga0495613_0392015 3300046689 Bacteria 948
431 Ga0495600_0000023 3300046809 Bacteria 94401
432 Ga0495600_0054786 3300046809 Bacteria 2605
433 Ga0495581_0115845 3300047315 Bacteria 1558
434 Ga0495604_0000251 3300047317 Bacteria 47665
435 Ga0495604_0009316 3300047317 Bacteria 7774
436 Ga0495674_0040004 3300047319 Bacteria 4197
437 Ga0495674_0360751 3300047319 Bacteria 1178
438 Ga0495674_0461643 3300047319 Bacteria 1019
439 Ga0495680_0006224 3300047322 Bacteria 11126
440 Ga0495680_0079165 3300047322 Bacteria 2486
441 Ga0495680_0695039 3300047322 Bacteria 672
442 Ga0495675_0005468 3300047444 Bacteria 7750
443 Ga0495675_0022397 3300047444 Bacteria 4027
444 Ga0495675_0039458 3300047444 Bacteria 3007
445 Ga0495684_0000037 3300047471 Bacteria 106933
446 Ga0495684_0008609 3300047471 Bacteria 7895
447 Ga0495684_0124391 3300047471 Bacteria 1941
448 Ga0495684_0186540 3300047471 Bacteria 1535
449 Ga0495684_0300262 3300047471 Bacteria 1154
450 Ga0495602_0002980 3300048088 Bacteria 17361
451 Ga0495602_0027245 3300048088 Bacteria 5495
452 Ga0496104_0144013 3300048907 Bacteria 2289
453 Ga0496109_0046223 3300048912 Bacteria 3954
454 Ga0496112_0002644 3300048915 Bacteria 14476
455 Ga0496115_0385705 3300048918 Bacteria 1139
456 Ga0501032_0099558 3300049569 Bacteria 1926
457 Ga0501033_0005909 3300049570 Bacteria 9613
458 Ga0501033_0103281 3300049570 Bacteria 2079
459 Ga0501034_0137800 3300049571 Bacteria 2421
460 Ga0501036_0142056 3300049572 Bacteria 2025
461 Ga0501037_0197903 3300049573 Bacteria 1421
462 Ga0501039_0480303 3300049575 Bacteria 976
463 Ga0501039_0582771 3300049575 Bacteria 877
464 Ga0501041_0418723 3300049577 Bacteria 849
465 Ga0501042_0100569 3300049578 Bacteria 2079
466 Ga0501046_0209142 3300049580 Bacteria 1449
467 Ga0501047_0210234 3300049581 Bacteria 1804
468 Ga0501047_0353811 3300049581 Bacteria 1305
469 Ga0501070_0428249 3300049586 Bacteria 1068
470 Ga0501073_0019417 3300049589 Bacteria 4908
471 Ga0501249_126263 3300049679 Bacteria 628
472 Ga0501035_0075848 3300049822 Bacteria 2974
473 Ga0501044_0041841 3300049823 Bacteria 4769
474 Ga0501044_0236939 3300049823 Bacteria 1770
475 Ga0501044_0253669 3300049823 Bacteria 1699
476 nmdc:mga09592_127352_c1 3300050508 Bacteria 2189
477 nmdc:mga0n895_10051_c1 3300050512 Bacteria 8327
478 nmdc:mga08x19_13426_c1 3300050514 Bacteria 4952
479 nmdc:mga08x19_192665_c1 3300050514 Bacteria 1395
480 nmdc:mga08x19_2073_c1 3300050514 Bacteria 12267
481 nmdc:mga0a205_114816_c1 3300050515 Bacteria 2591
482 nmdc:mga0a205_251315_c1 3300050515 Bacteria 1647
483 Ga0495601_0002235 3300053077 Bacteria 10903
484 Ga0495601_0110863 3300053077 Bacteria 1777
485 Ga0495612_0000577 3300053078 Bacteria 14757
486 Ga0495612_0018213 3300053078 Bacteria 2812
487 Ga0495595_0011132 3300053084 Bacteria 3756
488 Ga0495595_0152275 3300053084 Bacteria 1138
489 Ga0495619_0006426 3300053085 Bacteria 7446
490 Ga0495619_0024166 3300053085 Bacteria 3897
491 Ga0501082_0230871 3300060353 Bacteria 1610
492 Ga0213876_10089817
493 Ga0065715_10173820
494 Ga0070658_10002750
495 Ga0070658_10456383
496 Ga0070658_10912468
497 Ga0070658_11107621
498 Ga0070658_11363245
499 Ga0070683_100021692
500 Ga0070683_100053034
501 Ga0070683_100056894
502 Ga0070683_100255184
503 Ga0070683_100319093
504 Ga0070683_100382227
505 Ga0070690_100003160
506 Ga0070670_100267609
507 Ga0070670_100754750
508 Ga0068869_100008962
509 Ga0070666_10418658
510 Ga0070680_100001111
511 Ga0070680_100017956
512 Ga0070680_100019940
513 Ga0070680_100021647
514 Ga0070680_100059655
515 Ga0070682_100001019
516 Ga0070682_101046850
517 Ga0068868_100508931
518 Ga0070660_100004019
519 Ga0070660_100014965
520 Ga0070660_100379547
521 Ga0070691_10369818
522 Ga0070687_100467171
523 Ga0070661_100000287
524 Ga0070661_100023179
525 Ga0070661_100357676
526 Ga0070669_100120811
527 Ga0070669_100165125
528 Ga0070675_100002700
529 Ga0070675_100362183
530 Ga0070675_100733874
531 Ga0070673_100038788
532 Ga0070659_100000566
533 Ga0070659_100074080
534 Ga0070667_100130913
535 Ga0070709_10005224
536 Ga0070714_100013381
537 Ga0070713_100106381
538 Ga0070713_100418437
539 Ga0070710_10106524
540 Ga0070710_10598944
541 Ga0070711_100056995
542 Ga0070708_100000265
543 Ga0070663_100356305
544 Ga0070662_100268128
545 Ga0070681_10000220
546 Ga0070681_10003062
547 Ga0070681_10038477
548 Ga0070681_10137382
549 Ga0070681_10157595
550 Ga0068867_100867025
551 Ga0070706_100905750
552 Ga0070707_101381054
553 Ga0070679_100002193
554 Ga0070679_100002840
555 Ga0070679_100003473
556 Ga0070679_100177725
557 Ga0070679_100335388
558 Ga0070679_100378808
559 Ga0070679_100630817
560 Ga0070679_100913025
561 Ga0070684_100007582
562 Ga0070684_100008811
563 Ga0070684_100027011
564 Ga0070684_100054646
565 Ga0070684_100059121
566 Ga0070684_100059373
567 Ga0070684_100158461
568 Ga0070684_101100102
569 Ga0068853_100035404
570 Ga0068853_100473832
571 Ga0068853_100649632
572 Ga0068853_100745195
573 Ga0068853_101393899
574 Ga0070672_100565876
575 Ga0070696_100797881
576 Ga0070693_100003978
577 Ga0070693_100311285
578 Ga0070665_100441983
579 Ga0068855_100015921
580 Ga0068855_100300762
581 Ga0068855_100886257
582 Ga0068855_101006400
583 Ga0068855_101274675
584 Ga0068855_101579974
585 Ga0070664_100003921
586 Ga0070664_100222638
587 Ga0070664_100919250
588 Ga0068857_100157457
589 Ga0068854_100014867
590 Ga0068854_100236781
591 Ga0068854_100956364
592 Ga0068856_100000868
593 Ga0068856_100320635
594 Ga0070702_100002075
595 Ga0068852_100004829
596 Ga0068852_100081876
597 Ga0068852_101638049
598 Ga0068859_100002704
599 Ga0068864_100011899
600 Ga0068866_10067654
601 Ga0068863_100001868
602 Ga0068858_100442584
603 Ga0068860_100719460
604 Ga0070717_10156749
605 Ga0070712_100257583
606 Ga0097621_100049101
607 Ga0097621_100706427
608 Ga0068871_100014345
609 Ga0075430_100000459
610 Ga0075430_100005574
611 Ga0075431_100347512
612 Ga0075433_10174486
613 Ga0075434_100145705
614 Ga0075434_100621513
615 Ga0068865_100421889
616 Ga0075436_100032480
617 Ga0075436_100535974
618 Ga0097620_100002704
619 Ga0105240_10004867
620 Ga0105240_10302459
621 Ga0105240_10438790
622 Ga0105240_10895115
623 Ga0105240_11017384
624 Ga0105240_11399355
625 Ga0105240_11620485
626 Ga0105240_11626676
627 Ga0105245_10036260
628 Ga0105245_10144856
629 Ga0105245_10457580
630 Ga0105245_10533879
631 Ga0114129_10083785
632 Ga0105241_10046466
633 Ga0105241_10546809
634 Ga0105241_10984739
635 Ga0105241_11817435
636 Ga0105242_10047881
637 Ga0105248_10016618
638 Ga0105248_10103368
639 Ga0105248_10126547
640 Ga0105237_10126790
641 Ga0105237_10518824
642 Ga0105237_11466690
643 Ga0105238_10045745
644 Ga0105238_10903448
645 Ga0105239_10047380
646 Ga0105239_10169091
647 Ga0105239_11148595
648 Ga0105239_11936738
649 Ga0157373_10023411
650 Ga0157373_10032714
651 Ga0157373_10126404
652 Ga0157373_10348239
653 Ga0157371_10006224
654 Ga0157371_10124278
655 Ga0157370_10004735
656 Ga0157370_10046071
657 Ga0157370_10133277
658 Ga0157370_10225395
659 Ga0157370_10286338
660 Ga0157370_10776484
661 Ga0157370_10781331
662 Ga0157370_10937354
663 Ga0157369_10014379
664 Ga0157369_10024175
665 Ga0157369_10155261
666 Ga0157369_10175151
667 Ga0157369_10242726
668 Ga0157369_10245147
669 Ga0157369_10646827
670 Ga0157369_10860556
671 Ga0157369_10942653
672 Ga0157374_10460900
673 Ga0163162_11069328
674 Ga0157372_10009748
675 Ga0157372_10019518
676 Ga0157372_10020025
677 Ga0157372_10051984
678 Ga0157372_10066182
679 Ga0157372_10111033
680 Ga0157372_10113569
681 Ga0157372_10144833
682 Ga0157372_10176880
683 Ga0157372_11179596
684 Ga0157375_10055876
685 Ga0157375_10418982
686 Ga0163163_10704048
687 Ga0163163_11197303
688 Ga0157377_10025851
689 Ga0157379_10527487
690 Ga0157379_11375530
691 Ga0157376_10029056
692 Ga0157376_10367173
693 Ga0157376_10572182
694 Ga0157376_12557279
695 Ga0182007_10131794
696 Ga0163161_10502364
697 Ga0213876_10045094
698 Ga0213876_10228835
699 Ga0207692_10126523
700 Ga0207692_10283405
701 Ga0207642_10054805
702 Ga0207680_10334468
703 Ga0207647_10280465
704 Ga0207645_10224792
705 Ga0207643_10064183
706 Ga0207705_10001680
707 Ga0207705_10014323
708 Ga0207705_10184670
709 Ga0207705_10572800
710 Ga0207684_10028128
711 Ga0207654_10019995
712 Ga0207654_10213118
713 Ga0207707_10002874
714 Ga0207707_10028650
715 Ga0207707_10348239
716 Ga0207707_10912667
717 Ga0207695_10001853
718 Ga0207695_10003306
719 Ga0207695_10028182
720 Ga0207695_10158608
721 Ga0207695_10233087
722 Ga0207695_10407967
723 Ga0207695_11410294
724 Ga0207671_10677586
725 Ga0207663_10042816
726 Ga0207660_10000108
727 Ga0207660_10009523
728 Ga0207660_10042765
729 Ga0207660_10048794
730 Ga0207660_10261300
731 Ga0207660_10405206
732 Ga0207662_10205242
733 Ga0207662_10502633
734 Ga0207657_10016878
735 Ga0207657_10057518
736 Ga0207657_10319956
737 Ga0207657_10583887
738 Ga0207649_10051371
739 Ga0207649_10517686
740 Ga0207652_10009862
741 Ga0207652_10025644
742 Ga0207652_10029887
743 Ga0207652_10050130
744 Ga0207652_10078514
745 Ga0207652_10097995
746 Ga0207652_10169427
747 Ga0207652_10258093
748 Ga0207681_10289667
749 Ga0207694_10074005
750 Ga0207650_10003032
751 Ga0207659_10009074
752 Ga0207659_10212663
753 Ga0207687_10016558
754 Ga0207687_10248169
755 Ga0207687_10341205
756 Ga0207700_10021618
757 Ga0207700_10273915
758 Ga0207664_10012405
759 Ga0207664_10366120
760 Ga0207690_10008618
761 Ga0207690_10066164
762 Ga0207706_10008848
763 Ga0207686_10052565
764 Ga0207665_10068466
765 Ga0207691_10858400
766 Ga0207711_10003320
767 Ga0207711_10221842
768 Ga0207689_10010032
769 Ga0207689_10206927
770 Ga0207661_10001301
771 Ga0207661_10004055
772 Ga0207661_10004809
773 Ga0207661_10024086
774 Ga0207661_10031205
775 Ga0207661_10046637
776 Ga0207661_10165845
777 Ga0207661_10216643
778 Ga0207661_10451967
779 Ga0207679_10001306
780 Ga0207679_10317196
781 Ga0207679_10608546
782 Ga0207667_10052404
783 Ga0207667_10120706
784 Ga0207667_10542131
785 Ga0207667_10922502
786 Ga0207667_10924105
787 Ga0207712_10762700
788 Ga0207668_10053330
789 Ga0207640_10131726
790 Ga0207640_10491355
791 Ga0207658_10576291
792 Ga0207677_10016765
793 Ga0207703_10434500
794 Ga0207639_10064975
795 Ga0207639_10268767
796 Ga0207639_10801479
797 Ga0207702_10151834
798 Ga0207702_10217659
799 Ga0207702_10259686
800 Ga0207648_10049489
801 Ga0207648_11162624
802 Ga0207676_10001736
803 Ga0207676_10162238
804 Ga0207674_10000603
805 Ga0207674_10239675
806 Ga0207675_100180577
807 Ga0207683_10856366
808 Ga0207698_10004555
809 Ga0207698_10208269
810 Ga0268266_10336502
811 Ga0268264_10020159
812 Ga0268264_10130820
813 Ga0307413_10664532
814 Ga0307413_11064463
815 Ga0307410_10168066
816 Ga0307406_10473587
817 Ga0307407_10307943
818 Ga0307416_100483249
819 Ga0307416_100757951
820 Ga0307414_10506724
821 Ga0373934_0000613
822 Ga0373934_0015438
823 Ga0373923_0021276
824 Ga0373923_0389946
825 Ga0373945_0043325
826 Ga0373953_0061654
827 Ga0373953_0085334
828 Ga0373956_0079954
829 Ga0373957_0011425
830 Ga0373955_0000555
831 Ga0373955_0024136
832 Ga0373935_0222044
833 Ga0373927_0027933
834 Ga0373933_0000055
835 Ga0373933_0006643
836 Ga0373947_0043390
837 Ga0373937_0000450
838 Ga0373937_0006326
839 Ga0373937_0081032
840 Ga0373937_0244282
841 Ga0373925_0160321
842 Ga0373925_0218344
843 Ga0395905_0111873
844 Ga0436365_0348834
845 Ga0436365_0469632
846 Ga0436365_0999307
847 Ga0436365_1780610
848 Ga0439455_0097293
849 Ga0451576_0249711
850 Ga0451576_0833357
851 Ga0466967_0096318
852 Ga0466967_0281410
853 Ga0466967_0501062
854 Ga0495592_0002705
855 Ga0495592_0028290
856 Ga0495629_0064592
857 Ga0495629_0065595
858 Ga0495629_0142153
859 Ga0495629_0619537
860 Ga0495651_0000996
861 Ga0495651_0024457
862 Ga0495651_0128516
863 Ga0495653_0000195
864 Ga0495653_0079291
865 Ga0495580_0068932
866 Ga0495580_0078085
867 Ga0495582_0041545
868 Ga0495582_0199520
869 Ga0495582_0300495
870 Ga0495639_0089033
871 Ga0495639_0115874
872 Ga0495639_0120029
873 Ga0495662_0115906
874 Ga0495662_0170035
875 Ga0495664_0054273
876 Ga0495664_0147235
877 Ga0495594_0019078
878 Ga0495594_0036114
879 Ga0495608_0000085
880 Ga0495608_0306564
881 Ga0495618_0081191
882 Ga0495628_0019544
883 Ga0495628_0034222
884 Ga0495628_0203309
885 Ga0495628_0315535
886 Ga0495630_0022736
887 Ga0495630_0155017
888 Ga0495630_0168493
889 Ga0495666_0121623
890 Ga0495652_0001945
891 Ga0495652_0008685
892 Ga0495652_0208172
893 Ga0495665_0103981
894 Ga0495665_0106728
895 Ga0495665_0171566
896 Ga0495665_0289895
897 Ga0495640_0304947
898 Ga0495586_0080109
899 Ga0495587_0000114
900 Ga0495587_0006144
901 Ga0495587_0012708
902 Ga0495645_0000144
903 Ga0495645_0003374
904 Ga0495645_0004180
905 Ga0495667_0000241
906 Ga0495667_0014305
907 Ga0495667_0022631
908 Ga0495635_0000253
909 Ga0495588_0066857
910 Ga0495657_0000210
911 Ga0495657_0048442
912 Ga0495657_0075496
913 Ga0495599_0002826
914 Ga0495623_0000305
915 Ga0495623_0042320
916 Ga0495623_0076599
917 Ga0495646_0011487
918 Ga0495646_0087381
919 Ga0495613_0140181
920 Ga0495613_0205812
921 Ga0495613_0392015
922 Ga0495600_0000023
923 Ga0495600_0054786
924 Ga0495581_0115845
925 Ga0495604_0000251
926 Ga0495604_0009316
927 Ga0495674_0040004
928 Ga0495674_0360751
929 Ga0495674_0461643
930 Ga0495680_0006224
931 Ga0495680_0079165
932 Ga0495680_0695039
933 Ga0495675_0005468
934 Ga0495675_0022397
935 Ga0495675_0039458
936 Ga0495684_0000037
937 Ga0495684_0008609
938 Ga0495684_0124391
939 Ga0495684_0186540
940 Ga0495684_0300262
941 Ga0495602_0002980
942 Ga0495602_0027245
943 Ga0496104_0144013
944 Ga0496109_0046223
945 Ga0496112_0002644
946 Ga0496115_0385705
947 Ga0501032_0099558
948 Ga0501033_0005909
949 Ga0501033_0103281
950 Ga0501034_0137800
951 Ga0501036_0142056
952 Ga0501037_0197903
953 Ga0501039_0480303
954 Ga0501039_0582771
955 Ga0501041_0418723
956 Ga0501042_0100569
957 Ga0501046_0209142
958 Ga0501047_0210234
959 Ga0501047_0353811
960 Ga0501070_0428249
961 Ga0501073_0019417
962 Ga0501249_126263
963 Ga0501035_0075848
964 Ga0501044_0041841
965 Ga0501044_0236939
966 Ga0501044_0253669
967 nmdc:mga09592_127352_c1
968 nmdc:mga0n895_10051_c1
969 nmdc:mga08x19_13426_c1
970 nmdc:mga08x19_192665_c1
971 nmdc:mga08x19_2073_c1
972 nmdc:mga0a205_114816_c1
973 nmdc:mga0a205_251315_c1
974 Ga0495601_0002235
975 Ga0495601_0110863
976 Ga0495612_0000577
977 Ga0495612_0018213
978 Ga0495595_0011132
979 Ga0495595_0152275
980 Ga0495619_0006426
981 Ga0495619_0024166
982 Ga0501082_0230871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

40

190

0.84

Map