F454105

General Info

Members Datasets Scaffolds Average Seq Length
491 299 483 569

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10003359|Ga0157379_100033596
Length 703
Sequence MQRLRRRDQQLARHAANPRARCAVCAALDQHGTPAAGHDGPIGGEAGGASADHGDVGGNSVHGDSFRHEAAPVGRGAAPVAYGGRKNRAPAARYPSAGALPMPSCARRAPVASRAGTVSKARYNHRFSKKNRTMRVSHYFISTLKEAPAEAETASHRLMLRAGLIKRLAAGSYTWMPLGVRVLHKVEQIVREEMDSSGAIELLMPVIQPAELWQESGRWAKYGPELLRLKDRHDRDFVVQPTSEEVITDIARKELKSYKQLPINFYHIQTKFRDEVRPRFGVMRSREFIMKDAYSFDADKESLRASYKIMYDAYTRIFTRMGLEFRAVDADTGNIGGFASHEFQVLADSGEDAIAYCPASQYAANVELAEALAPASPRAAPAEAMRKVPTPGKSTCEDVAALLGLPLTRTVKCLMIFAADKVQMLLVRGDHSGNEIKIGKLPDIGPWRWASEAEIVAATGCQPGYLGPVGIPAGMPLIADRTVAAMADFVCGANEAGFHLAGVNFGRDCREPDRVADIRNVVRGDPSPDGKGVLDILRGIEVGHVFALGNVYSAALGATYLDASGQSQVMEMGCYGIGITRVVAAAIEQNHDARGIVWPPALAPFAVAIAAVGYDRNPGVRAFADRLHDDLAAAGVDVLLDDRGERPGVMFADLELIGIPHRVTVGERGLAAGNVEYQNRRDTTATPVPVAEVMDWLRARLSA

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2885266251 Ralstonia sp. SET104 Isolate Nodule
7 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
8 2928058823 Ralstonia sp. 1138 Isolate Unclassified
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
296 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.2
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.52
Nodule 0.61
Rhizoplane 2.24
Rhizosphere 87.78
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000220 3300001915 Bacteria 17106
2 JGI24740J21852_10000198 3300001979 Bacteria 24847
3 JGI24740J21852_10000808 3300001979 Bacteria 13763
4 JGI24740J21852_10011223 3300001979 Bacteria 3418
5 JGI24743J22301_10001686 3300001991 Bacteria 3145
6 JGI25156J39149_1003726 3300002705 Bacteria 4880
7 JGI25156J39149_1003772 3300002705 Bacteria 4835
8 JGI25154J39366_1000740 3300002738 Bacteria 14645
9 Ga0006562J51391_1024980 3300003578 Bacteria 4150
10 Ga0055539_1000148 3300003752 Bacteria 70566
11 Ga0055533_1005028 3300003756 Bacteria 2227
12 Ga0055532_1000072 3300003758 Bacteria 131787
13 Ga0055525_1000168 3300003759 Bacteria 83935
14 Ga0055535_1000053 3300003761 Bacteria 131787
15 Ga0055542_1000962 3300003762 Bacteria 18795
16 Ga0055542_1001846 3300003762 Bacteria 8568
17 Ga0055529_1000099 3300003763 Bacteria 131775
18 Ga0055541_1000469 3300003841 Bacteria 11565
19 Ga0070658_10001497 3300005327 Bacteria 19822
20 Ga0070658_10022741 3300005327 Bacteria 5031
21 Ga0070676_10000107 3300005328 Bacteria 30114
22 Ga0070683_100001691 3300005329 Bacteria 17152
23 Ga0070683_100018712 3300005329 Bacteria 6139
24 Ga0070690_100000795 3300005330 Bacteria 16013
25 Ga0070690_100010694 3300005330 Bacteria 5348
26 Ga0070670_100010043 3300005331 Bacteria 8080
27 Ga0070670_100023064 3300005331 Bacteria 5355
28 Ga0070677_10001867 3300005333 Bacteria 6661
29 Ga0068869_100001901 3300005334 Bacteria 12558
30 Ga0068869_100002079 3300005334 Bacteria 12035
31 Ga0070666_10000013 3300005335 Bacteria 230442
32 Ga0070666_10003823 3300005335 Bacteria 9132
33 Ga0070666_10008469 3300005335 Bacteria 6389
34 Ga0070680_100016059 3300005336 Bacteria 5883
35 Ga0068868_100054806 3300005338 Bacteria 3144
36 Ga0068868_100079535 3300005338 Bacteria 2626
37 Ga0068868_100091905 3300005338 Bacteria 2445
38 Ga0070660_100002423 3300005339 Bacteria 12817
39 Ga0070689_100000650 3300005340 Bacteria 20990
40 Ga0070689_100009848 3300005340 Bacteria 6794
41 Ga0070691_10002241 3300005341 Bacteria 8551
42 Ga0070661_100000097 3300005344 Bacteria 71801
43 Ga0070661_100003243 3300005344 Bacteria 11213
44 Ga0070661_100007985 3300005344 Bacteria 7307
45 Ga0070692_10006633 3300005345 Bacteria 5036
46 Ga0070668_100018546 3300005347 Bacteria 5225
47 Ga0070668_100031968 3300005347 Bacteria 4005
48 Ga0070669_100000548 3300005353 Bacteria 27906
49 Ga0070675_100000802 3300005354 Bacteria 22093
50 Ga0070671_100005736 3300005355 Bacteria 9886
51 Ga0070671_100034501 3300005355 Bacteria 4188
52 Ga0070674_100054328 3300005356 Bacteria 2770
53 Ga0070673_100001459 3300005364 Bacteria 13823
54 Ga0070673_100057662 3300005364 Bacteria 3069
55 Ga0070673_100088724 3300005364 Bacteria 2523
56 Ga0070659_100001035 3300005366 Bacteria 20335
57 Ga0070659_100004273 3300005366 Bacteria 10196
58 Ga0070659_100016207 3300005366 Bacteria 5592
59 Ga0070667_100005261 3300005367 Bacteria 10822
60 Ga0070667_100010030 3300005367 Bacteria 7849
61 Ga0070714_100003295 3300005435 Bacteria 12036
62 Ga0070714_100014358 3300005435 Bacteria 6362
63 Ga0070713_100000130 3300005436 Bacteria 49533
64 Ga0070713_100007064 3300005436 Bacteria 7846
65 Ga0070710_10003771 3300005437 Bacteria 7169
66 Ga0070701_10000187 3300005438 Bacteria 19276
67 Ga0070701_10004859 3300005438 Bacteria 5496
68 Ga0070711_100008289 3300005439 Bacteria 6358
69 Ga0070705_100000951 3300005440 Bacteria 16215
70 Ga0070700_100000243 3300005441 Bacteria 29938
71 Ga0070700_100006010 3300005441 Bacteria 6457
72 Ga0070694_100009696 3300005444 Bacteria 5914
73 Ga0070694_100028746 3300005444 Bacteria 3620
74 Ga0070694_100040844 3300005444 Bacteria 3093
75 Ga0070663_100000016 3300005455 Bacteria 126268
76 Ga0070663_100007543 3300005455 Bacteria 6628
77 Ga0070663_100025017 3300005455 Bacteria 4027
78 Ga0070678_100004178 3300005456 Bacteria 8152
79 Ga0070662_100001028 3300005457 Bacteria 17062
80 Ga0070681_10144907 3300005458 Bacteria 2305
81 Ga0068867_100000937 3300005459 Bacteria 19837
82 Ga0068867_100002133 3300005459 Bacteria 13894
83 Ga0068867_100011437 3300005459 Bacteria 6262
84 Ga0070685_10008515 3300005466 Bacteria 5276
85 Ga0070706_100155350 3300005467 Bacteria 2136
86 Ga0070699_100012310 3300005518 Bacteria 7380
87 Ga0070684_100009129 3300005535 Bacteria 7796
88 Ga0070684_100070515 3300005535 Bacteria 3075
89 Ga0070697_100051208 3300005536 Bacteria 3355
90 Ga0068853_100006241 3300005539 Bacteria 9446
91 Ga0068853_100015435 3300005539 Bacteria 6274
92 Ga0070672_100000305 3300005543 Bacteria 27772
93 Ga0070672_100021726 3300005543 Bacteria 4699
94 Ga0070686_100000137 3300005544 Bacteria 50642
95 Ga0070686_100015578 3300005544 Bacteria 4407
96 Ga0070695_100022828 3300005545 Bacteria 3841
97 Ga0070696_100000506 3300005546 Bacteria 24604
98 Ga0070696_100012305 3300005546 Bacteria 5736
99 Ga0070693_100009711 3300005547 Bacteria 4794
100 Ga0070665_100000755 3300005548 Bacteria 42946
101 Ga0070665_100003824 3300005548 Bacteria 15942
102 Ga0070665_100034535 3300005548 Bacteria 5085
103 Ga0070665_100155540 3300005548 Bacteria 2288
104 Ga0070704_100004923 3300005549 Bacteria 7754
105 Ga0070704_100038377 3300005549 Bacteria 3281
106 Ga0068855_100006361 3300005563 Bacteria 14395
107 Ga0068855_100011706 3300005563 Bacteria 10601
108 Ga0070664_100000017 3300005564 Bacteria 125713
109 Ga0070664_100002297 3300005564 Bacteria 15363
110 Ga0068854_100001483 3300005578 Bacteria 14216
111 Ga0068854_100007847 3300005578 Bacteria 6829
112 Ga0068854_100024639 3300005578 Bacteria 4122
113 Ga0068856_100000450 3300005614 Bacteria 45444
114 Ga0068856_100000937 3300005614 Bacteria 31230
115 Ga0068856_100002173 3300005614 Bacteria 20321
116 Ga0068856_100030419 3300005614 Bacteria 5278
117 Ga0070702_100000955 3300005615 Bacteria 11351
118 Ga0068852_100000776 3300005616 Bacteria 21052
119 Ga0068859_100003870 3300005617 Bacteria 15292
120 Ga0068859_100024820 3300005617 Bacteria 6016
121 Ga0068859_100257473 3300005617 Bacteria 1836
122 Ga0068864_100005645 3300005618 Bacteria 10257
123 Ga0068866_10000779 3300005718 Bacteria 14315
124 Ga0068861_100001670 3300005719 Bacteria 14206
125 Ga0068861_100005521 3300005719 Bacteria 8565
126 Ga0068851_10000578 3300005834 Bacteria 15951
127 Ga0068851_10000631 3300005834 Bacteria 14981
128 Ga0068870_10001240 3300005840 Bacteria 10246
129 Ga0068863_100002509 3300005841 Bacteria 18242
130 Ga0068858_100001035 3300005842 Bacteria 28743
131 Ga0068858_100017523 3300005842 Bacteria 6718
132 Ga0068858_100022672 3300005842 Bacteria 5856
133 Ga0068858_100023972 3300005842 Bacteria 5685
134 Ga0068858_100152148 3300005842 Bacteria 2176
135 Ga0068860_100015250 3300005843 Bacteria 7505
136 Ga0068862_100002750 3300005844 Bacteria 15435
137 Ga0068862_100006182 3300005844 Bacteria 9970
138 Ga0068862_100007849 3300005844 Bacteria 8828
139 Ga0081539_10000188 3300005985 Bacteria 143987
140 Ga0075368_10006730 3300006042 Bacteria 4033
141 Ga0075363_100050045 3300006048 Bacteria 2226
142 Ga0075367_10055253 3300006178 Bacteria 2356
143 Ga0097621_100000302 3300006237 Bacteria 33411
144 Ga0097621_100001156 3300006237 Bacteria 18340
145 Ga0097621_100150207 3300006237 Bacteria 1997
146 Ga0068871_100001427 3300006358 Bacteria 16004
147 Ga0068871_100003043 3300006358 Bacteria 11499
148 Ga0068871_100006939 3300006358 Bacteria 8068
149 Ga0075428_100048511 3300006844 Bacteria 4660
150 Ga0075430_100000213 3300006846 Bacteria 39796
151 Ga0075430_100007991 3300006846 Bacteria 8941
152 Ga0075431_100003682 3300006847 Bacteria 14887
153 Ga0075431_100083359 3300006847 Bacteria 3301
154 Ga0075434_100001059 3300006871 Bacteria 22456
155 Ga0075434_100107092 3300006871 Bacteria 2805
156 Ga0075434_100116412 3300006871 Bacteria 2686
157 Ga0075429_100026011 3300006880 Bacteria 5079
158 Ga0068865_100000054 3300006881 Bacteria 62847
159 Ga0075436_100000140 3300006914 Bacteria 43571
160 Ga0075436_100015929 3300006914 Bacteria 5146
161 Ga0075436_100057974 3300006914 Bacteria 2675
162 Ga0097620_100003871 3300006931 Bacteria 15292
163 Ga0097620_100024819 3300006931 Bacteria 6016
164 Ga0097620_100257456 3300006931 Bacteria 1836
165 Ga0075435_100000574 3300007076 Bacteria 22477
166 Ga0075435_100032451 3300007076 Bacteria 4124
167 Ga0099794_10009513 3300007265 Bacteria 4091
168 Ga0105251_10001356 3300009011 Bacteria 21161
169 Ga0105240_10006271 3300009093 Bacteria 17498
170 Ga0105240_10012937 3300009093 Bacteria 11493
171 Ga0105240_10059074 3300009093 Bacteria 4787
172 Ga0105240_10126331 3300009093 Bacteria 3073
173 Ga0105240_10197439 3300009093 Bacteria 2361
174 Ga0111539_10021469 3300009094 Bacteria 7945
175 Ga0111539_10048440 3300009094 Bacteria 5073
176 Ga0111539_10105553 3300009094 Bacteria 3305
177 Ga0111539_10168158 3300009094 Bacteria 2562
178 Ga0105245_10000196 3300009098 Bacteria 57538
179 Ga0114129_10168707 3300009147 Bacteria 2985
180 Ga0105243_10000403 3300009148 Bacteria 45449
181 Ga0105241_10010823 3300009174 Bacteria 6692
182 Ga0105242_10006185 3300009176 Bacteria 9224
183 Ga0105242_10029360 3300009176 Bacteria 4385
184 Ga0105248_10023191 3300009177 Bacteria 6892
185 Ga0105237_10015284 3300009545 Bacteria 7995
186 Ga0105238_10000131 3300009551 Bacteria 82050
187 Ga0105238_10015483 3300009551 Bacteria 7718
188 Ga0105249_10080514 3300009553 Bacteria 3026
189 Ga0105249_10199276 3300009553 Bacteria 1958
190 Ga0105030_101536 3300009987 Bacteria 2037
191 Ga0157373_10002304 3300013100 Bacteria 14486
192 Ga0157373_10006431 3300013100 Bacteria 8778
193 Ga0157373_10008754 3300013100 Bacteria 7499
194 Ga0157371_10000446 3300013102 Bacteria 50636
195 Ga0157370_10002603 3300013104 Bacteria 21687
196 Ga0157370_10005412 3300013104 Bacteria 14323
197 Ga0157370_10028721 3300013104 Bacteria 5468
198 Ga0157370_10076141 3300013104 Bacteria 3161
199 Ga0157369_10097592 3300013105 Bacteria 3134
200 Ga0157378_10000156 3300013297 Bacteria 64403
201 Ga0157378_10015713 3300013297 Bacteria 6629
202 Ga0157378_10092805 3300013297 Bacteria 2747
203 Ga0163162_10000221 3300013306 Bacteria 52249
204 Ga0163162_10042079 3300013306 Bacteria 4571
205 Ga0157372_10002351 3300013307 Bacteria 20462
206 Ga0157372_10109343 3300013307 Bacteria 3165
207 Ga0157375_10001555 3300013308 Bacteria 19760
208 Ga0163163_10004410 3300014325 Bacteria 11996
209 Ga0157380_10002556 3300014326 Bacteria 12289
210 Ga0157380_10002798 3300014326 Bacteria 11861
211 Ga0157380_10022040 3300014326 Bacteria 4787
212 Ga0157379_10003359 3300014968 Bacteria 13550
213 Ga0157379_10005908 3300014968 Bacteria 10537
214 Ga0157379_10006367 3300014968 Bacteria 10166
215 Ga0157379_10029599 3300014968 Bacteria 4869
216 Ga0157376_10004343 3300014969 Bacteria 9856
217 Ga0163161_10021624 3300017792 Bacteria 4521
218 Ga0209784_100063 3300025224 Bacteria 159576
219 Ga0209784_100704 3300025224 Bacteria 8992
220 Ga0209566_100048 3300025225 Bacteria 241570
221 Ga0209566_100794 3300025225 Bacteria 16578
222 Ga0209674_100071 3300025226 Bacteria 241568
223 Ga0209674_100151 3300025226 Bacteria 95725
224 Ga0209674_100235 3300025226 Bacteria 48669
225 Ga0209674_100544 3300025226 Bacteria 15117
226 Ga0209147_100002 3300025229 Bacteria 2158988
227 Ga0209563_100085 3300025230 Bacteria 186579
228 Ga0209258_100002 3300025242 Bacteria 2158988
229 Ga0209646_1000123 3300025246 Bacteria 142437
230 Ga0209677_100040 3300025253 Bacteria 241568
231 Ga0209148_1000077 3300025254 Bacteria 298133
232 Ga0209759_1000630 3300025256 Bacteria 33452
233 Ga0209759_1012425 3300025256 Bacteria 2359
234 Ga0209455_1000149 3300025272 Bacteria 131876
235 Ga0207673_1001014 3300025290 Bacteria 3019
236 Ga0207697_10000474 3300025315 Bacteria 22692
237 Ga0207656_10038865 3300025321 Bacteria 2009
238 Ga0207682_10000146 3300025893 Bacteria 31872
239 Ga0207682_10000224 3300025893 Bacteria 25591
240 Ga0207642_10011604 3300025899 Bacteria 3151
241 Ga0207642_10012511 3300025899 Bacteria 3065
242 Ga0207688_10001248 3300025901 Bacteria 13208
243 Ga0207680_10000001 3300025903 Bacteria 1091453
244 Ga0207645_10000488 3300025907 Bacteria 32821
245 Ga0207645_10005545 3300025907 Bacteria 9134
246 Ga0207645_10010214 3300025907 Bacteria 6454
247 Ga0207643_10000241 3300025908 Bacteria 38063
248 Ga0207705_10006682 3300025909 Bacteria 8532
249 Ga0207705_10037869 3300025909 Bacteria 3451
250 Ga0207707_10006997 3300025912 Bacteria 9841
251 Ga0207695_10021594 3300025913 Bacteria 7341
252 Ga0207695_10021681 3300025913 Bacteria 7323
253 Ga0207695_10043483 3300025913 Bacteria 4787
254 Ga0207695_10055942 3300025913 Bacteria 4108
255 Ga0207671_10029876 3300025914 Bacteria 4067
256 Ga0207663_10028699 3300025916 Bacteria 3260
257 Ga0207660_10127936 3300025917 Bacteria 1931
258 Ga0207662_10001613 3300025918 Bacteria 11039
259 Ga0207657_10001713 3300025919 Bacteria 23638
260 Ga0207657_10005085 3300025919 Bacteria 13783
261 Ga0207657_10125587 3300025919 Bacteria 2107
262 Ga0207649_10000051 3300025920 Bacteria 108386
263 Ga0207649_10015681 3300025920 Bacteria 4257
264 Ga0207649_10019468 3300025920 Bacteria 3879
265 Ga0207649_10043322 3300025920 Bacteria 2751
266 Ga0207652_10001143 3300025921 Bacteria 23866
267 Ga0207646_10134010 3300025922 Bacteria 2231
268 Ga0207681_10000820 3300025923 Bacteria 20470
269 Ga0207694_10000168 3300025924 Bacteria 67647
270 Ga0207694_10008735 3300025924 Bacteria 7645
271 Ga0207650_10003314 3300025925 Bacteria 11088
272 Ga0207659_10023815 3300025926 Bacteria 4093
273 Ga0207687_10000422 3300025927 Bacteria 28741
274 Ga0207700_10000262 3300025928 Bacteria 31393
275 Ga0207700_10001882 3300025928 Bacteria 11909
276 Ga0207664_10001100 3300025929 Bacteria 18018
277 Ga0207664_10003842 3300025929 Bacteria 10093
278 Ga0207664_10004554 3300025929 Bacteria 9396
279 Ga0207664_10040901 3300025929 Bacteria 3608
280 Ga0207644_10006660 3300025931 Bacteria 7529
281 Ga0207644_10014239 3300025931 Bacteria 5318
282 Ga0207644_10052172 3300025931 Bacteria 2938
283 Ga0207690_10001030 3300025932 Bacteria 17852
284 Ga0207706_10000045 3300025933 Bacteria 120758
285 Ga0207706_10000488 3300025933 Bacteria 42317
286 Ga0207686_10003574 3300025934 Bacteria 8344
287 Ga0207709_10005049 3300025935 Bacteria 7535
288 Ga0207670_10039786 3300025936 Bacteria 3082
289 Ga0207704_10000369 3300025938 Bacteria 20783
290 Ga0207704_10009964 3300025938 Bacteria 4611
291 Ga0207691_10000310 3300025940 Bacteria 48478
292 Ga0207691_10003983 3300025940 Bacteria 14347
293 Ga0207691_10027030 3300025940 Bacteria 5384
294 Ga0207691_10038315 3300025940 Bacteria 4436
295 Ga0207689_10000719 3300025942 Bacteria 31673
296 Ga0207689_10000727 3300025942 Bacteria 31622
297 Ga0207661_10017440 3300025944 Bacteria 5315
298 Ga0207679_10000042 3300025945 Bacteria 126099
299 Ga0207679_10001171 3300025945 Bacteria 16729
300 Ga0207679_10089430 3300025945 Bacteria 2377
301 Ga0207667_10001912 3300025949 Bacteria 26150
302 Ga0207667_10028768 3300025949 Bacteria 6033
303 Ga0207667_10121924 3300025949 Bacteria 2686
304 Ga0207651_10002673 3300025960 Bacteria 8533
305 Ga0207651_10019465 3300025960 Bacteria 4069
306 Ga0207651_10067497 3300025960 Bacteria 2517
307 Ga0207712_10008326 3300025961 Bacteria 6555
308 Ga0207668_10002080 3300025972 Bacteria 11670
309 Ga0207668_10003768 3300025972 Bacteria 8930
310 Ga0207658_10001222 3300025986 Bacteria 20330
311 Ga0207703_10001973 3300026035 Bacteria 18116
312 Ga0207703_10002424 3300026035 Bacteria 16178
313 Ga0207703_10012276 3300026035 Bacteria 6680
314 Ga0207639_10001920 3300026041 Bacteria 13963
315 Ga0207639_10007954 3300026041 Bacteria 7243
316 Ga0207639_10012916 3300026041 Bacteria 5826
317 Ga0207639_10105387 3300026041 Bacteria 2287
318 Ga0207678_10000055 3300026067 Bacteria 87202
319 Ga0207678_10002562 3300026067 Bacteria 16560
320 Ga0207678_10045421 3300026067 Bacteria 3799
321 Ga0207708_10000071 3300026075 Bacteria 81358
322 Ga0207708_10011589 3300026075 Bacteria 6571
323 Ga0207708_10012890 3300026075 Bacteria 6232
324 Ga0207708_10038772 3300026075 Bacteria 3630
325 Ga0207702_10000156 3300026078 Bacteria 80626
326 Ga0207702_10006443 3300026078 Bacteria 10119
327 Ga0207702_10033442 3300026078 Bacteria 4295
328 Ga0207648_10000132 3300026089 Bacteria 73817
329 Ga0207648_10001796 3300026089 Bacteria 23501
330 Ga0207648_10007103 3300026089 Bacteria 11049
331 Ga0207648_10010481 3300026089 Bacteria 8782
332 Ga0207648_10017632 3300026089 Bacteria 6485
333 Ga0207676_10003996 3300026095 Bacteria 10407
334 Ga0207674_10000357 3300026116 Bacteria 59170
335 Ga0207674_10009935 3300026116 Bacteria 10826
336 Ga0207675_100002245 3300026118 Bacteria 19221
337 Ga0207675_100002782 3300026118 Bacteria 17187
338 Ga0207675_100036957 3300026118 Bacteria 4556
339 Ga0207683_10000218 3300026121 Bacteria 50151
340 Ga0207683_10001799 3300026121 Bacteria 18984
341 Ga0207683_10006378 3300026121 Bacteria 10102
342 Ga0207698_10003091 3300026142 Bacteria 9986
343 Ga0207698_10011611 3300026142 Bacteria 5720
344 Ga0209371_1002068 3300027312 Bacteria 11962
345 Ga0209996_1001039 3300027395 Bacteria 3311
346 Ga0210000_1002030 3300027462 Bacteria 2862
347 Ga0209999_1010305 3300027543 Bacteria 1688
348 Ga0209588_1014627 3300027671 Bacteria 2405
349 Ga0209971_1001066 3300027682 Bacteria 6971
350 Ga0207428_10012963 3300027907 Bacteria 7305
351 Ga0207428_10053519 3300027907 Bacteria 3218
352 Ga0268266_10000075 3300028379 Bacteria 218045
353 Ga0268266_10005809 3300028379 Bacteria 11426
354 Ga0268265_10002821 3300028380 Bacteria 12780
355 Ga0268264_10029225 3300028381 Bacteria 4513
356 Ga0265338_10047488 3300028800 Bacteria 3920
357 Ga0268256_1001827 3300030500 Bacteria 11962
358 Ga0307511_10001782 3300030521 Bacteria 22654
359 Ga0265327_10055903 3300031251 Bacteria 2036
360 Ga0265316_10062127 3300031344 Bacteria 2899
361 Ga0307508_10039090 3300031616 Bacteria 4263
362 Ga0265342_10006027 3300031712 Bacteria 9099
363 Ga0307407_10014152 3300031903 Bacteria 3897
364 Ga0307416_100057367 3300032002 Bacteria 3149
365 Ga0307411_10004457 3300032005 Bacteria 6710
366 Ga0316585_10004163 3300032137 Bacteria 4017
367 Ga0373926_0007026 3300035083 Bacteria 3744
368 Ga0373934_0017274 3300035086 Bacteria 2752
369 Ga0373945_0017953 3300035116 Bacteria 2402
370 Ga0373954_0000013 3300035118 Bacteria 73606
371 Ga0373954_0008567 3300035118 Bacteria 4496
372 Ga0373955_0015602 3300035172 Bacteria 3723
373 Ga0373931_0016865 3300035691 Bacteria 3602
374 Ga0373927_0003208 3300035695 Bacteria 11782
375 Ga0373947_0049492 3300035725 Bacteria 2524
376 Ga0373937_0000568 3300036401 Bacteria 32759
377 Ga0373937_0038586 3300036401 Bacteria 4352
378 Ga0316584_0004158 3300036712 Bacteria 9553
379 Ga0395905_0069351 3300037471 Bacteria 3302
380 Ga0450923_001270 3300042125 Bacteria 3287
381 Ga0450898_004953 3300042134 Bacteria 1991
382 Ga0450910_002490 3300042147 Bacteria 2422
383 Ga0439446_0003122 3300042156 Bacteria 4075
384 Ga0439435_0000861 3300042436 Bacteria 5201
385 Ga0439435_0001698 3300042436 Bacteria 4159
386 Ga0439460_0008491 3300042461 Bacteria 2596
387 Ga0451577_0035327 3300042876 Bacteria 4503
388 Ga0451577_0051509 3300042876 Bacteria 3675
389 Ga0466961_0000984 3300044693 Bacteria 17665
390 Ga0453684_0000485 3300044712 Bacteria 156758
391 Ga0453684_0027336 3300044712 Bacteria 8186
392 Ga0453684_0062868 3300044712 Bacteria 4752
393 Ga0453684_0118806 3300044712 Bacteria 3197
394 Ga0451576_0000424 3300045051 Bacteria 97297
395 Ga0451576_0004965 3300045051 Bacteria 16929
396 Ga0451576_0118008 3300045051 Bacteria 2762
397 Ga0495592_0001655 3300046454 Bacteria 15626
398 Ga0495592_0012915 3300046454 Bacteria 6349
399 Ga0495629_0083872 3300046459 Bacteria 2224
400 Ga0495641_0010479 3300046461 Bacteria 5367
401 Ga0495582_0008915 3300046473 Bacteria 5535
402 Ga0495639_0002795 3300046475 Bacteria 7590
403 Ga0495628_0053758 3300046516 Bacteria 3176
404 Ga0495630_0000139 3300046517 Bacteria 57204
405 Ga0495666_0011157 3300046526 Bacteria 4483
406 Ga0495652_0009814 3300046529 Bacteria 8680
407 Ga0495587_0037894 3300046536 Bacteria 2892
408 Ga0495645_0000629 3300046543 Bacteria 24231
409 Ga0495667_0113660 3300046559 Bacteria 1749
410 Ga0495599_0001044 3300046678 Bacteria 15560
411 Ga0495599_0010627 3300046678 Bacteria 5634
412 Ga0495600_0003884 3300046809 Bacteria 8870
413 Ga0495674_0049515 3300047319 Bacteria 3712
414 Ga0495675_0003549 3300047444 Bacteria 9401
415 Ga0496100_0040346 3300048903 Bacteria 2969
416 Ga0496104_0010541 3300048907 Bacteria 8254
417 Ga0496106_0002307 3300048909 Bacteria 14233
418 Ga0496106_0015996 3300048909 Bacteria 5548
419 Ga0496107_0003606 3300048910 Bacteria 10389
420 Ga0496108_0002799 3300048911 Bacteria 13982
421 Ga0496109_0002292 3300048912 Bacteria 15916
422 Ga0496110_0032155 3300048913 Bacteria 4529
423 Ga0496111_0017145 3300048914 Bacteria 5002
424 Ga0496112_0005023 3300048915 Bacteria 11358
425 Ga0496125_0030721 3300048928 Bacteria 4800
426 Ga0496126_0004710 3300048929 Bacteria 16111
427 Ga0501036_0003526 3300049572 Bacteria 12520
428 Ga0501036_0150411 3300049572 Bacteria 1963
429 Ga0501039_0004511 3300049575 Bacteria 10515
430 Ga0501040_0082284 3300049576 Bacteria 2232
431 Ga0501041_0001159 3300049577 Bacteria 14435
432 Ga0501042_0017893 3300049578 Bacteria 4897
433 Ga0501043_0119924 3300049579 Bacteria 2063
434 Ga0501046_0007796 3300049580 Bacteria 9393
435 Ga0501046_0041736 3300049580 Bacteria 3660
436 Ga0501048_0008821 3300049582 Bacteria 7595
437 Ga0501072_0009360 3300049588 Bacteria 7448
438 Ga0501072_0011354 3300049588 Bacteria 6808
439 Ga0501073_0057819 3300049589 Bacteria 2710
440 Ga0501074_0069146 3300049590 Bacteria 2539
441 Ga0501075_0000249 3300049591 Bacteria 29011
442 Ga0501075_0003507 3300049591 Bacteria 10492
443 Ga0501076_0000138 3300049592 Bacteria 41193
444 Ga0501076_0000181 3300049592 Bacteria 37445
445 Ga0501079_0003270 3300049741 Bacteria 11879
446 Ga0501080_0007684 3300049742 Bacteria 9743
447 Ga0501080_0016245 3300049742 Bacteria 6873
448 Ga0501080_0051353 3300049742 Bacteria 3837
449 Ga0501081_0000818 3300049743 Bacteria 18376
450 Ga0501081_0019773 3300049743 Bacteria 4486
451 Ga0501083_0010603 3300049744 Bacteria 6489
452 Ga0501045_0003461 3300049824 Bacteria 10807
453 Ga0501045_0010182 3300049824 Bacteria 6581
454 Ga0501045_0018343 3300049824 Bacteria 4977
455 nmdc:mga00v17_8034_c1 3300050491 Bacteria 5663
456 nmdc:mga06z11_34748_c1 3300050494 Bacteria 2477
457 nmdc:mga05p37_71153_c1 3300050507 Bacteria 4278
458 nmdc:mga09592_95677_c1 3300050508 Bacteria 2541
459 nmdc:mga0qj67_12432_c1 3300050509 Bacteria 6412
460 nmdc:mga0qj67_743_c1 3300050509 Bacteria 22097
461 nmdc:mga08y16_27533_c1 3300050511 Bacteria 5988
462 nmdc:mga08y16_38712_c1 3300050511 Bacteria 5005
463 nmdc:mga0n895_236945_c1 3300050512 Bacteria 1852
464 nmdc:mga0n895_528_c1 3300050512 Bacteria 26099
465 nmdc:mga0rr50_606_c1 3300050513 Bacteria 19271
466 nmdc:mga0rr50_61101_c1 3300050513 Bacteria 2837
467 nmdc:mga0rr50_62915_c1 3300050513 Bacteria 2801
468 nmdc:mga08x19_16341_c1 3300050514 Bacteria 4525
469 nmdc:mga08x19_18922_c1 3300050514 Bacteria 4222
470 nmdc:mga08x19_374_c1 3300050514 Bacteria 31392
471 nmdc:mga0a205_105440_c1 3300050515 Bacteria 2717
472 nmdc:mga0a205_763_c1 3300050515 Bacteria 26004
473 Ga0495601_0001562 3300053077 Bacteria 12662
474 Ga0500604_0001095 3300053151 Bacteria 7539
475 Ga0500616_0000030 3300053153 Bacteria 415224
476 Ga0500636_0000371 3300053177 Bacteria 24614
477 Ga0500637_0009603 3300053178 Bacteria 4931
478 Ga0501084_0003891 3300054114 Bacteria 12154
479 Ga0501084_0052553 3300054114 Bacteria 3409
480 Ga0501082_0002546 3300060353 Bacteria 15973
481 Ga0501082_0017614 3300060353 Bacteria 6153
482 Ga0501082_0093396 3300060353 Bacteria 2599
483 Ga0530510_0000432 3300061734 Bacteria 27057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027543 Ga0209999_1010305 Ga0209999_10103052 478
2 3300042125 Ga0450923_001270 Ga0450923_001270_15_1514 483
3 3300042134 Ga0450898_004953 Ga0450898_004953_26_1603 509
4 3300049590 Ga0501074_0069146 Ga0501074_0069146_22_1668 531
5 3300005364 Ga0070673_100057662 Ga0070673_1000576623 541
6 3300049580 Ga0501046_0041736 Ga0501046_0041736_597_2273 542
7 3300002738 JGI25154J39366_1000740 JGI25154J39366_100074011 544
8 3300003762 Ga0055542_1000962 Ga0055542_10009624 544
9 3300003762 Ga0055542_1001846 Ga0055542_10018465 544
10 3300003841 Ga0055541_1000469 Ga0055541_100046910 544
11 3300025224 Ga0209784_100704 Ga0209784_1007049 544
12 3300025225 Ga0209566_100794 Ga0209566_10079413 544
13 3300025226 Ga0209674_100544 Ga0209674_10054412 544
14 3300025246 Ga0209646_1000123 Ga0209646_100012371 544
15 3300025254 Ga0209148_1000077 Ga0209148_1000077218 544
16 3300025256 Ga0209759_1012425 Ga0209759_10124252 544
17 3300044693 Ga0466961_0000984 Ga0466961_0000984_15654_17378 544
18 3300049576 Ga0501040_0082284 Ga0501040_0082284_451_2157 545
19 3300054114 Ga0501084_0052553 Ga0501084_0052553_169_1875 545
20 3300002705 JGI25156J39149_1003772 JGI25156J39149_10037721 548
21 3300005467 Ga0070706_100155350 Ga0070706_1001553502 548
22 3300005617 Ga0068859_100257473 Ga0068859_1002574732 548
23 3300005842 Ga0068858_100152148 Ga0068858_1001521481 548
24 3300006871 Ga0075434_100001059 Ga0075434_10000105917 548
25 3300006914 Ga0075436_100000140 Ga0075436_10000014033 548
26 3300006931 Ga0097620_100257456 Ga0097620_1002574561 548
27 3300007076 Ga0075435_100000574 Ga0075435_10000057411 548
28 3300009094 Ga0111539_10021469 Ga0111539_100214694 548
29 3300025226 Ga0209674_100235 Ga0209674_10023547 548
30 3300025256 Ga0209759_1000630 Ga0209759_100063024 548
31 3300025960 Ga0207651_10067497 Ga0207651_100674972 548
32 3300027462 Ga0210000_1002030 Ga0210000_10020302 548
33 3300027907 Ga0207428_10012963 Ga0207428_100129633 548
34 3300049588 Ga0501072_0011354 Ga0501072_0011354_3441_5126 548
35 3300049824 Ga0501045_0018343 Ga0501045_0018343_1889_3574 548
36 3300050512 nmdc:mga0n895_528_c1 nmdc:mga0n895_528_c1_8239_9924 548
37 3300050513 nmdc:mga0rr50_606_c1 nmdc:mga0rr50_606_c1_1783_3468 548
38 3300050514 nmdc:mga08x19_374_c1 nmdc:mga08x19_374_c1_20443_22128 548
39 3300050515 nmdc:mga0a205_763_c1 nmdc:mga0a205_763_c1_22537_24222 548
40 3300031251 Ga0265327_10055903 Ga0265327_100559032 549
41 3300049572 Ga0501036_0150411 Ga0501036_0150411_60_1748 549
42 3300049579 Ga0501043_0119924 Ga0501043_0119924_354_2042 549
43 3300005327 Ga0070658_10001497 Ga0070658_100014973 550
44 3300005335 Ga0070666_10000013 Ga0070666_10000013195 550
45 3300005440 Ga0070705_100000951 Ga0070705_10000095112 550
46 3300005444 Ga0070694_100040844 Ga0070694_1000408443 550
47 3300005536 Ga0070697_100051208 Ga0070697_1000512081 550
48 3300005546 Ga0070696_100000506 Ga0070696_10000050623 550
49 3300005843 Ga0068860_100015250 Ga0068860_1000152504 550
50 3300006844 Ga0075428_100048511 Ga0075428_1000485113 550
51 3300006846 Ga0075430_100000213 Ga0075430_10000021337 550
52 3300006846 Ga0075430_100007991 Ga0075430_1000079916 550
53 3300006847 Ga0075431_100083359 Ga0075431_1000833592 550
54 3300006880 Ga0075429_100026011 Ga0075429_1000260114 550
55 3300006914 Ga0075436_100057974 Ga0075436_1000579741 550
56 3300007076 Ga0075435_100032451 Ga0075435_1000324514 550
57 3300009147 Ga0114129_10168707 Ga0114129_101687073 550
58 3300009551 Ga0105238_10000131 Ga0105238_1000013136 550
59 3300013306 Ga0163162_10000221 Ga0163162_1000022112 550
60 3300025903 Ga0207680_10000001 Ga0207680_10000001279 550
61 3300025909 Ga0207705_10006682 Ga0207705_100066823 550
62 3300025924 Ga0207694_10000168 Ga0207694_100001685 550
63 3300027395 Ga0209996_1001039 Ga0209996_10010393 550
64 3300028379 Ga0268266_10000075 Ga0268266_1000007521 550
65 3300048928 Ga0496125_0030721 Ga0496125_0030721_1955_3652 550
66 3300048929 Ga0496126_0004710 Ga0496126_0004710_10233_11930 550
67 3300049580 Ga0501046_0007796 Ga0501046_0007796_4174_5865 550
68 3300049591 Ga0501075_0003507 Ga0501075_0003507_4692_6383 550
69 3300049592 Ga0501076_0000181 Ga0501076_0000181_29077_30768 550
70 3300049741 Ga0501079_0003270 Ga0501079_0003270_515_2206 550
71 3300049742 Ga0501080_0016245 Ga0501080_0016245_4745_6436 550
72 3300049824 Ga0501045_0010182 Ga0501045_0010182_3054_4745 550
73 3300050507 nmdc:mga05p37_71153_c1 nmdc:mga05p37_71153_c1_2048_3739 550
74 3300050508 nmdc:mga09592_95677_c1 nmdc:mga09592_95677_c1_184_1932 550
75 3300050509 nmdc:mga0qj67_12432_c1 nmdc:mga0qj67_12432_c1_2127_3818 550
76 3300050509 nmdc:mga0qj67_743_c1 nmdc:mga0qj67_743_c1_17735_19426 550
77 3300050513 nmdc:mga0rr50_62915_c1 nmdc:mga0rr50_62915_c1_772_2463 550
78 3300060353 Ga0501082_0002546 Ga0501082_0002546_9392_11083 550
79 3300005444 Ga0070694_100028746 Ga0070694_1000287463 551
80 3300005985 Ga0081539_10000188 Ga0081539_1000018825 551
81 3300025899 Ga0207642_10012511 Ga0207642_100125111 551
82 3300025917 Ga0207660_10127936 Ga0207660_101279362 551
83 3300031712 Ga0265342_10006027 Ga0265342_100060276 551
84 3300035118 Ga0373954_0000013 Ga0373954_0000013_33009_34706 551
85 3300036401 Ga0373937_0000568 Ga0373937_0000568_439_2136 551
86 3300042436 Ga0439435_0001698 Ga0439435_0001698_1403_3121 551
87 3300042876 Ga0451577_0051509 Ga0451577_0051509_993_2732 551
88 3300044712 Ga0453684_0000485 Ga0453684_0000485_93920_95659 551
89 3300050514 nmdc:mga08x19_18922_c1 nmdc:mga08x19_18922_c1_155_1849 551
90 3300005345 Ga0070692_10006633 Ga0070692_100066332 552
91 3300005347 Ga0070668_100018546 Ga0070668_1000185464 552
92 3300005353 Ga0070669_100000548 Ga0070669_10000054820 552
93 3300005459 Ga0068867_100002133 Ga0068867_10000213311 552
94 3300005719 Ga0068861_100005521 Ga0068861_1000055218 552
95 3300005844 Ga0068862_100002750 Ga0068862_10000275011 552
96 3300009094 Ga0111539_10105553 Ga0111539_101055532 552
97 3300009176 Ga0105242_10029360 Ga0105242_100293605 552
98 3300009553 Ga0105249_10199276 Ga0105249_101992762 552
99 3300014326 Ga0157380_10002556 Ga0157380_100025561 552
100 3300025923 Ga0207681_10000820 Ga0207681_1000082016 552
101 3300025934 Ga0207686_10003574 Ga0207686_1000357410 552
102 3300025938 Ga0207704_10009964 Ga0207704_100099643 552
103 3300025961 Ga0207712_10008326 Ga0207712_100083262 552
104 3300025972 Ga0207668_10003768 Ga0207668_100037689 552
105 3300026075 Ga0207708_10038772 Ga0207708_100387722 552
106 3300026089 Ga0207648_10010481 Ga0207648_100104814 552
107 3300026118 Ga0207675_100002245 Ga0207675_1000022452 552
108 3300027907 Ga0207428_10053519 Ga0207428_100535192 552
109 3300028380 Ga0268265_10002821 Ga0268265_1000282112 552
110 3300036401 Ga0373937_0038586 Ga0373937_0038586_1314_3011 552
111 3300050511 nmdc:mga08y16_38712_c1 nmdc:mga08y16_38712_c1_1441_3141 552
112 3300009094 Ga0111539_10048440 Ga0111539_100484404 553
113 3300031903 Ga0307407_10014152 Ga0307407_100141522 553
114 3300032002 Ga0307416_100057367 Ga0307416_1000573673 553
115 3300032005 Ga0307411_10004457 Ga0307411_100044573 553
116 3300042147 Ga0450910_002490 Ga0450910_002490_595_2304 553
117 3300042156 Ga0439446_0003122 Ga0439446_0003122_1125_2834 553
118 3300042436 Ga0439435_0000861 Ga0439435_0000861_1277_2986 553
119 3300042461 Ga0439460_0008491 Ga0439460_0008491_871_2580 553
120 3300045051 Ga0451576_0004965 Ga0451576_0004965_964_2670 553
121 3300050511 nmdc:mga08y16_27533_c1 nmdc:mga08y16_27533_c1_3397_5103 553
122 3300053177 Ga0500636_0000371 Ga0500636_0000371_4672_6390 553
123 3300053178 Ga0500637_0009603 Ga0500637_0009603_2885_4603 553
124 3300005334 Ga0068869_100002079 Ga0068869_1000020796 554
125 3300005459 Ga0068867_100011437 Ga0068867_1000114377 554
126 3300005548 Ga0070665_100034535 Ga0070665_1000345352 554
127 3300006237 Ga0097621_100150207 Ga0097621_1001502072 554
128 3300006847 Ga0075431_100003682 Ga0075431_1000036824 554
129 3300007265 Ga0099794_10009513 Ga0099794_100095133 554
130 3300009177 Ga0105248_10023191 Ga0105248_100231915 554
131 3300014968 Ga0157379_10029599 Ga0157379_100295993 554
132 3300014969 Ga0157376_10004343 Ga0157376_100043434 554
133 3300025899 Ga0207642_10011604 Ga0207642_100116041 554
134 3300026075 Ga0207708_10012890 Ga0207708_100128902 554
135 3300026089 Ga0207648_10017632 Ga0207648_100176323 554
136 3300026118 Ga0207675_100036957 Ga0207675_1000369573 554
137 3300028381 Ga0268264_10029225 Ga0268264_100292252 554
138 3300035083 Ga0373926_0007026 Ga0373926_0007026_1343_3049 554
139 3300035086 Ga0373934_0017274 Ga0373934_0017274_990_2696 554
140 3300035116 Ga0373945_0017953 Ga0373945_0017953_29_1735 554
141 3300035118 Ga0373954_0008567 Ga0373954_0008567_1548_3254 554
142 3300035725 Ga0373947_0049492 Ga0373947_0049492_711_2417 554
143 3300042876 Ga0451577_0035327 Ga0451577_0035327_2423_4135 554
144 3300045051 Ga0451576_0000424 Ga0451576_0000424_72054_73769 554
145 3300045051 Ga0451576_0118008 Ga0451576_0118008_871_2613 554
146 3300046454 Ga0495592_0001655 Ga0495592_0001655_8002_9708 554
147 3300046454 Ga0495592_0012915 Ga0495592_0012915_2492_4198 554
148 3300046459 Ga0495629_0083872 Ga0495629_0083872_107_1813 554
149 3300046461 Ga0495641_0010479 Ga0495641_0010479_2681_4387 554
150 3300046475 Ga0495639_0002795 Ga0495639_0002795_4770_6476 554
151 3300046516 Ga0495628_0053758 Ga0495628_0053758_220_1926 554
152 3300046517 Ga0495630_0000139 Ga0495630_0000139_5732_7438 554
153 3300046526 Ga0495666_0011157 Ga0495666_0011157_1463_3169 554
154 3300046529 Ga0495652_0009814 Ga0495652_0009814_5510_7216 554
155 3300046536 Ga0495587_0037894 Ga0495587_0037894_600_2306 554
156 3300046543 Ga0495645_0000629 Ga0495645_0000629_14832_16538 554
157 3300046559 Ga0495667_0113660 Ga0495667_0113660_30_1736 554
158 3300046678 Ga0495599_0001044 Ga0495599_0001044_7978_9684 554
159 3300046678 Ga0495599_0010627 Ga0495599_0010627_2671_4377 554
160 3300046809 Ga0495600_0003884 Ga0495600_0003884_1040_2746 554
161 3300047319 Ga0495674_0049515 Ga0495674_0049515_1549_3255 554
162 3300047444 Ga0495675_0003549 Ga0495675_0003549_76_1782 554
163 3300049742 Ga0501080_0051353 Ga0501080_0051353_1891_3597 554
164 3300049743 Ga0501081_0019773 Ga0501081_0019773_25_1737 554
165 3300053077 Ga0495601_0001562 Ga0495601_0001562_1732_3438 554
166 iso_pu_bacteria 2526164512 2526211942 554
167 3300005330 Ga0070690_100000795 Ga0070690_10000079516 555
168 3300005336 Ga0070680_100016059 Ga0070680_1000160597 555
169 3300005338 Ga0068868_100054806 Ga0068868_1000548062 555
170 3300005340 Ga0070689_100009848 Ga0070689_1000098487 555
171 3300005341 Ga0070691_10002241 Ga0070691_100022414 555
172 3300005436 Ga0070713_100000130 Ga0070713_10000013028 555
173 3300005438 Ga0070701_10000187 Ga0070701_1000018716 555
174 3300005441 Ga0070700_100000243 Ga0070700_10000024321 555
175 3300005444 Ga0070694_100009696 Ga0070694_1000096962 555
176 3300005459 Ga0068867_100000937 Ga0068867_10000093720 555
177 3300005544 Ga0070686_100000137 Ga0070686_10000013742 555
178 3300005545 Ga0070695_100022828 Ga0070695_1000228282 555
179 3300005547 Ga0070693_100009711 Ga0070693_1000097114 555
180 3300005549 Ga0070704_100004923 Ga0070704_1000049237 555
181 3300005549 Ga0070704_100038377 Ga0070704_1000383771 555
182 3300005615 Ga0070702_100000955 Ga0070702_10000095513 555
183 3300005617 Ga0068859_100003870 Ga0068859_10000387018 555
184 3300005718 Ga0068866_10000779 Ga0068866_1000077916 555
185 3300005719 Ga0068861_100001670 Ga0068861_10000167011 555
186 3300005840 Ga0068870_10001240 Ga0068870_100012409 555
187 3300005842 Ga0068858_100001035 Ga0068858_10000103526 555
188 3300005844 Ga0068862_100006182 Ga0068862_1000061829 555
189 3300006237 Ga0097621_100000302 Ga0097621_10000030221 555
190 3300006358 Ga0068871_100006939 Ga0068871_1000069398 555
191 3300006871 Ga0075434_100107092 Ga0075434_1001070922 555
192 3300006881 Ga0068865_100000054 Ga0068865_10000005440 555
193 3300006914 Ga0075436_100015929 Ga0075436_1000159294 555
194 3300006931 Ga0097620_100003871 Ga0097620_10000387118 555
195 3300009094 Ga0111539_10168158 Ga0111539_101681582 555
196 3300009098 Ga0105245_10000196 Ga0105245_1000019621 555
197 3300009148 Ga0105243_10000403 Ga0105243_1000040320 555
198 3300009176 Ga0105242_10006185 Ga0105242_100061857 555
199 3300013297 Ga0157378_10000156 Ga0157378_1000015631 555
200 3300013297 Ga0157378_10092805 Ga0157378_100928052 555
201 3300014326 Ga0157380_10002798 Ga0157380_100027989 555
202 3300014968 Ga0157379_10005908 Ga0157379_1000590812 555
203 3300025927 Ga0207687_10000422 Ga0207687_100004225 555
204 3300025928 Ga0207700_10000262 Ga0207700_1000026230 555
205 3300025935 Ga0207709_10005049 Ga0207709_100050496 555
206 3300025936 Ga0207670_10039786 Ga0207670_100397862 555
207 3300025938 Ga0207704_10000369 Ga0207704_100003697 555
208 3300025942 Ga0207689_10000727 Ga0207689_1000072719 555
209 3300026035 Ga0207703_10002424 Ga0207703_100024242 555
210 3300026075 Ga0207708_10000071 Ga0207708_1000007129 555
211 3300026089 Ga0207648_10000132 Ga0207648_1000013232 555
212 3300026118 Ga0207675_100002782 Ga0207675_1000027823 555
213 3300026121 Ga0207683_10006378 Ga0207683_100063788 555
214 3300027671 Ga0209588_1014627 Ga0209588_10146272 555
215 3300032137 Ga0316585_10004163 Ga0316585_100041633 555
216 3300035695 Ga0373927_0003208 Ga0373927_0003208_2013_3722 555
217 3300036712 Ga0316584_0004158 Ga0316584_0004158_379_2100 555
218 3300049744 Ga0501083_0010603 Ga0501083_0010603_1972_3681 555
219 3300050512 nmdc:mga0n895_236945_c1 nmdc:mga0n895_236945_c1_43_1752 555
220 3300050514 nmdc:mga08x19_16341_c1 nmdc:mga08x19_16341_c1_827_2548 555
221 3300050515 nmdc:mga0a205_105440_c1 nmdc:mga0a205_105440_c1_349_2070 555
222 3300001991 JGI24743J22301_10001686 JGI24743J22301_100016862 556
223 3300005327 Ga0070658_10022741 Ga0070658_100227413 556
224 3300005328 Ga0070676_10000107 Ga0070676_1000010720 556
225 3300005329 Ga0070683_100001691 Ga0070683_1000016912 556
226 3300005329 Ga0070683_100018712 Ga0070683_1000187123 556
227 3300005330 Ga0070690_100010694 Ga0070690_1000106944 556
228 3300005331 Ga0070670_100010043 Ga0070670_1000100439 556
229 3300005331 Ga0070670_100023064 Ga0070670_1000230643 556
230 3300005333 Ga0070677_10001867 Ga0070677_100018677 556
231 3300005334 Ga0068869_100001901 Ga0068869_10000190110 556
232 3300005335 Ga0070666_10003823 Ga0070666_100038232 556
233 3300005335 Ga0070666_10008469 Ga0070666_100084692 556
234 3300005338 Ga0068868_100079535 Ga0068868_1000795352 556
235 3300005338 Ga0068868_100091905 Ga0068868_1000919052 556
236 3300005339 Ga0070660_100002423 Ga0070660_1000024237 556
237 3300005340 Ga0070689_100000650 Ga0070689_10000065017 556
238 3300005344 Ga0070661_100003243 Ga0070661_10000324310 556
239 3300005344 Ga0070661_100007985 Ga0070661_1000079856 556
240 3300005347 Ga0070668_100031968 Ga0070668_1000319683 556
241 3300005354 Ga0070675_100000802 Ga0070675_10000080222 556
242 3300005355 Ga0070671_100005736 Ga0070671_1000057363 556
243 3300005355 Ga0070671_100034501 Ga0070671_1000345014 556
244 3300005356 Ga0070674_100054328 Ga0070674_1000543281 556
245 3300005364 Ga0070673_100001459 Ga0070673_10000145910 556
246 3300005364 Ga0070673_100088724 Ga0070673_1000887242 556
247 3300005366 Ga0070659_100004273 Ga0070659_1000042735 556
248 3300005366 Ga0070659_100016207 Ga0070659_1000162074 556
249 3300005367 Ga0070667_100005261 Ga0070667_1000052613 556
250 3300005367 Ga0070667_100010030 Ga0070667_1000100304 556
251 3300005435 Ga0070714_100003295 Ga0070714_1000032958 556
252 3300005435 Ga0070714_100014358 Ga0070714_1000143584 556
253 3300005436 Ga0070713_100007064 Ga0070713_1000070649 556
254 3300005437 Ga0070710_10003771 Ga0070710_100037717 556
255 3300005438 Ga0070701_10004859 Ga0070701_100048596 556
256 3300005439 Ga0070711_100008289 Ga0070711_1000082893 556
257 3300005441 Ga0070700_100006010 Ga0070700_1000060102 556
258 3300005455 Ga0070663_100007543 Ga0070663_1000075433 556
259 3300005455 Ga0070663_100025017 Ga0070663_1000250172 556
260 3300005456 Ga0070678_100004178 Ga0070678_1000041782 556
261 3300005457 Ga0070662_100001028 Ga0070662_10000102817 556
262 3300005458 Ga0070681_10144907 Ga0070681_101449072 556
263 3300005466 Ga0070685_10008515 Ga0070685_100085154 556
264 3300005518 Ga0070699_100012310 Ga0070699_1000123104 556
265 3300005535 Ga0070684_100009129 Ga0070684_1000091295 556
266 3300005535 Ga0070684_100070515 Ga0070684_1000705152 556
267 3300005539 Ga0068853_100006241 Ga0068853_1000062417 556
268 3300005539 Ga0068853_100015435 Ga0068853_1000154353 556
269 3300005543 Ga0070672_100000305 Ga0070672_10000030510 556
270 3300005543 Ga0070672_100021726 Ga0070672_1000217264 556
271 3300005546 Ga0070696_100012305 Ga0070696_1000123056 556
272 3300005548 Ga0070665_100000755 Ga0070665_10000075531 556
273 3300005548 Ga0070665_100003824 Ga0070665_1000038249 556
274 3300005548 Ga0070665_100155540 Ga0070665_1001555402 556
275 3300005563 Ga0068855_100006361 Ga0068855_1000063618 556
276 3300005563 Ga0068855_100011706 Ga0068855_1000117064 556
277 3300005564 Ga0070664_100002297 Ga0070664_10000229717 556
278 3300005578 Ga0068854_100001483 Ga0068854_1000014837 556
279 3300005578 Ga0068854_100007847 Ga0068854_1000078477 556
280 3300005578 Ga0068854_100024639 Ga0068854_1000246393 556
281 3300005614 Ga0068856_100000937 Ga0068856_10000093718 556
282 3300005614 Ga0068856_100002173 Ga0068856_10000217321 556
283 3300005616 Ga0068852_100000776 Ga0068852_10000077611 556
284 3300005617 Ga0068859_100024820 Ga0068859_1000248205 556
285 3300005618 Ga0068864_100005645 Ga0068864_1000056454 556
286 3300005834 Ga0068851_10000578 Ga0068851_100005789 556
287 3300005834 Ga0068851_10000631 Ga0068851_1000063111 556
288 3300005841 Ga0068863_100002509 Ga0068863_10000250916 556
289 3300005842 Ga0068858_100022672 Ga0068858_1000226723 556
290 3300005842 Ga0068858_100023972 Ga0068858_1000239722 556
291 3300005844 Ga0068862_100007849 Ga0068862_1000078499 556
292 3300006358 Ga0068871_100003043 Ga0068871_1000030432 556
293 3300006871 Ga0075434_100116412 Ga0075434_1001164122 556
294 3300006931 Ga0097620_100024819 Ga0097620_1000248195 556
295 3300009093 Ga0105240_10006271 Ga0105240_100062718 556
296 3300009093 Ga0105240_10012937 Ga0105240_100129374 556
297 3300009093 Ga0105240_10197439 Ga0105240_101974391 556
298 3300009174 Ga0105241_10010823 Ga0105241_100108236 556
299 3300009545 Ga0105237_10015284 Ga0105237_100152845 556
300 3300009551 Ga0105238_10015483 Ga0105238_100154833 556
301 3300009553 Ga0105249_10080514 Ga0105249_100805143 556
302 3300009987 Ga0105030_101536 Ga0105030_1015362 556
303 3300013100 Ga0157373_10002304 Ga0157373_100023048 556
304 3300013100 Ga0157373_10006431 Ga0157373_100064314 556
305 3300013102 Ga0157371_10000446 Ga0157371_100004461 556
306 3300013104 Ga0157370_10005412 Ga0157370_100054129 556
307 3300013104 Ga0157370_10028721 Ga0157370_100287216 556
308 3300013104 Ga0157370_10076141 Ga0157370_100761412 556
309 3300013297 Ga0157378_10015713 Ga0157378_100157133 556
310 3300013306 Ga0163162_10042079 Ga0163162_100420794 556
311 3300013307 Ga0157372_10109343 Ga0157372_101093432 556
312 3300013308 Ga0157375_10001555 Ga0157375_1000155512 556
313 3300014325 Ga0163163_10004410 Ga0163163_100044109 556
314 3300014326 Ga0157380_10022040 Ga0157380_100220403 556
315 3300014968 Ga0157379_10003359 Ga0157379_100033596 556
316 3300014968 Ga0157379_10006367 Ga0157379_100063674 556
317 3300017792 Ga0163161_10021624 Ga0163161_100216244 556
318 3300025290 Ga0207673_1001014 Ga0207673_10010142 556
319 3300025315 Ga0207697_10000474 Ga0207697_1000047412 556
320 3300025321 Ga0207656_10038865 Ga0207656_100388652 556
321 3300025893 Ga0207682_10000146 Ga0207682_100001462 556
322 3300025893 Ga0207682_10000224 Ga0207682_1000022420 556
323 3300025901 Ga0207688_10001248 Ga0207688_100012489 556
324 3300025907 Ga0207645_10000488 Ga0207645_1000048822 556
325 3300025907 Ga0207645_10005545 Ga0207645_100055459 556
326 3300025907 Ga0207645_10010214 Ga0207645_100102146 556
327 3300025908 Ga0207643_10000241 Ga0207643_1000024117 556
328 3300025909 Ga0207705_10037869 Ga0207705_100378693 556
329 3300025912 Ga0207707_10006997 Ga0207707_100069979 556
330 3300025913 Ga0207695_10021594 Ga0207695_100215948 556
331 3300025913 Ga0207695_10021681 Ga0207695_100216813 556
332 3300025913 Ga0207695_10055942 Ga0207695_100559422 556
333 3300025914 Ga0207671_10029876 Ga0207671_100298763 556
334 3300025916 Ga0207663_10028699 Ga0207663_100286993 556
335 3300025918 Ga0207662_10001613 Ga0207662_1000161310 556
336 3300025919 Ga0207657_10001713 Ga0207657_1000171319 556
337 3300025919 Ga0207657_10005085 Ga0207657_100050854 556
338 3300025919 Ga0207657_10125587 Ga0207657_101255871 556
339 3300025920 Ga0207649_10015681 Ga0207649_100156812 556
340 3300025920 Ga0207649_10019468 Ga0207649_100194682 556
341 3300025920 Ga0207649_10043322 Ga0207649_100433223 556
342 3300025921 Ga0207652_10001143 Ga0207652_1000114327 556
343 3300025922 Ga0207646_10134010 Ga0207646_101340102 556
344 3300025924 Ga0207694_10008735 Ga0207694_100087353 556
345 3300025925 Ga0207650_10003314 Ga0207650_1000331410 556
346 3300025926 Ga0207659_10023815 Ga0207659_100238152 556
347 3300025928 Ga0207700_10001882 Ga0207700_100018828 556
348 3300025929 Ga0207664_10001100 Ga0207664_1000110011 556
349 3300025929 Ga0207664_10003842 Ga0207664_100038425 556
350 3300025929 Ga0207664_10004554 Ga0207664_100045547 556
351 3300025929 Ga0207664_10040901 Ga0207664_100409012 556
352 3300025931 Ga0207644_10006660 Ga0207644_100066604 556
353 3300025931 Ga0207644_10014239 Ga0207644_100142394 556
354 3300025931 Ga0207644_10052172 Ga0207644_100521722 556
355 3300025932 Ga0207690_10001030 Ga0207690_1000103011 556
356 3300025933 Ga0207706_10000045 Ga0207706_1000004548 556
357 3300025933 Ga0207706_10000488 Ga0207706_1000048834 556
358 3300025940 Ga0207691_10000310 Ga0207691_1000031039 556
359 3300025940 Ga0207691_10003983 Ga0207691_100039834 556
360 3300025940 Ga0207691_10027030 Ga0207691_100270302 556
361 3300025940 Ga0207691_10038315 Ga0207691_100383153 556
362 3300025942 Ga0207689_10000719 Ga0207689_1000071920 556
363 3300025944 Ga0207661_10017440 Ga0207661_100174403 556
364 3300025945 Ga0207679_10001171 Ga0207679_100011719 556
365 3300025945 Ga0207679_10089430 Ga0207679_100894301 556
366 3300025949 Ga0207667_10001912 Ga0207667_1000191228 556
367 3300025949 Ga0207667_10028768 Ga0207667_100287683 556
368 3300025960 Ga0207651_10002673 Ga0207651_100026732 556
369 3300025960 Ga0207651_10019465 Ga0207651_100194652 556
370 3300025972 Ga0207668_10002080 Ga0207668_100020809 556
371 3300025986 Ga0207658_10001222 Ga0207658_1000122211 556
372 3300026035 Ga0207703_10001973 Ga0207703_1000197315 556
373 3300026041 Ga0207639_10001920 Ga0207639_100019207 556
374 3300026041 Ga0207639_10007954 Ga0207639_100079548 556
375 3300026041 Ga0207639_10012916 Ga0207639_100129163 556
376 3300026041 Ga0207639_10105387 Ga0207639_101053872 556
377 3300026067 Ga0207678_10002562 Ga0207678_100025625 556
378 3300026067 Ga0207678_10045421 Ga0207678_100454213 556
379 3300026075 Ga0207708_10011589 Ga0207708_100115897 556
380 3300026078 Ga0207702_10006443 Ga0207702_100064434 556
381 3300026089 Ga0207648_10001796 Ga0207648_1000179620 556
382 3300026089 Ga0207648_10007103 Ga0207648_100071032 556
383 3300026095 Ga0207676_10003996 Ga0207676_100039964 556
384 3300026116 Ga0207674_10000357 Ga0207674_100003573 556
385 3300026121 Ga0207683_10000218 Ga0207683_1000021829 556
386 3300026121 Ga0207683_10001799 Ga0207683_100017993 556
387 3300026142 Ga0207698_10003091 Ga0207698_100030913 556
388 3300026142 Ga0207698_10011611 Ga0207698_100116114 556
389 3300027682 Ga0209971_1001066 Ga0209971_10010664 556
390 3300028379 Ga0268266_10005809 Ga0268266_100058099 556
391 3300028800 Ga0265338_10047488 Ga0265338_100474884 556
392 3300035691 Ga0373931_0016865 Ga0373931_0016865_762_2474 556
393 3300037471 Ga0395905_0069351 Ga0395905_0069351_811_2523 556
394 3300048903 Ga0496100_0040346 Ga0496100_0040346_203_1918 556
395 3300048907 Ga0496104_0010541 Ga0496104_0010541_5369_7084 556
396 3300048909 Ga0496106_0002307 Ga0496106_0002307_7784_9496 556
397 3300048909 Ga0496106_0015996 Ga0496106_0015996_2156_3871 556
398 3300048910 Ga0496107_0003606 Ga0496107_0003606_3896_5608 556
399 3300048911 Ga0496108_0002799 Ga0496108_0002799_9250_10965 556
400 3300048912 Ga0496109_0002292 Ga0496109_0002292_4798_6513 556
401 3300048913 Ga0496110_0032155 Ga0496110_0032155_1782_3497 556
402 3300048914 Ga0496111_0017145 Ga0496111_0017145_2254_3969 556
403 3300048915 Ga0496112_0005023 Ga0496112_0005023_8002_9717 556
404 3300049572 Ga0501036_0003526 Ga0501036_0003526_3005_4723 556
405 3300049575 Ga0501039_0004511 Ga0501039_0004511_8144_9862 556
406 3300049577 Ga0501041_0001159 Ga0501041_0001159_1202_2920 556
407 3300049578 Ga0501042_0017893 Ga0501042_0017893_2993_4711 556
408 3300049582 Ga0501048_0008821 Ga0501048_0008821_1187_2905 556
409 3300049588 Ga0501072_0009360 Ga0501072_0009360_1544_3262 556
410 3300049589 Ga0501073_0057819 Ga0501073_0057819_940_2661 556
411 3300049591 Ga0501075_0000249 Ga0501075_0000249_1589_3307 556
412 3300049592 Ga0501076_0000138 Ga0501076_0000138_22697_24415 556
413 3300049742 Ga0501080_0007684 Ga0501080_0007684_6714_8432 556
414 3300049743 Ga0501081_0000818 Ga0501081_0000818_6388_8106 556
415 3300049824 Ga0501045_0003461 Ga0501045_0003461_4357_6075 556
416 3300050513 nmdc:mga0rr50_61101_c1 nmdc:mga0rr50_61101_c1_621_2345 556
417 3300053153 Ga0500616_0000030 Ga0500616_0000030_301381_303117 556
418 3300054114 Ga0501084_0003891 Ga0501084_0003891_113_1831 556
419 3300060353 Ga0501082_0017614 Ga0501082_0017614_195_1916 556
420 3300060353 Ga0501082_0093396 Ga0501082_0093396_848_2566 556
421 3300061734 Ga0530510_0000432 Ga0530510_0000432_2561_4279 556
422 3300005544 Ga0070686_100015578 Ga0070686_1000155783 557
423 3300005842 Ga0068858_100017523 Ga0068858_1000175234 557
424 3300006237 Ga0097621_100001156 Ga0097621_10000115614 557
425 3300006358 Ga0068871_100001427 Ga0068871_1000014273 557
426 3300009093 Ga0105240_10126331 Ga0105240_101263312 557
427 3300025949 Ga0207667_10121924 Ga0207667_101219242 557
428 3300026035 Ga0207703_10012276 Ga0207703_100122764 557
429 3300030521 Ga0307511_10001782 Ga0307511_1000178223 557
430 3300035172 Ga0373955_0015602 Ga0373955_0015602_829_2547 557
431 3300053151 Ga0500604_0001095 Ga0500604_0001095_4305_6050 557
432 iso_pu_bacteria 2508501125 2509131101 557
433 iso_pu_bacteria 2526164713 2527080107 557
434 iso_pu_bacteria 2596583598 2597031739 557
435 iso_pu_bacteria 2599185178 2599446434 557
436 iso_pu_bacteria 2885266251 2885270247 557
437 iso_pu_bacteria 2900577576 2900581819 557
438 iso_pu_bacteria 2928058823 2928061499 557
439 3300006042 Ga0075368_10006730 Ga0075368_100067302 558
440 3300006048 Ga0075363_100050045 Ga0075363_1000500452 558
441 3300006178 Ga0075367_10055253 Ga0075367_100552532 558
442 3300031344 Ga0265316_10062127 Ga0265316_100621272 558
443 3300031616 Ga0307508_10039090 Ga0307508_100390904 558
444 3300044712 Ga0453684_0027336 Ga0453684_0027336_5701_7431 558
445 3300044712 Ga0453684_0062868 Ga0453684_0062868_1240_2970 558
446 3300050491 nmdc:mga00v17_8034_c1 nmdc:mga00v17_8034_c1_3649_5385 558
447 3300050494 nmdc:mga06z11_34748_c1 nmdc:mga06z11_34748_c1_279_2015 558
448 3300001915 JGI24741J21665_1000220 JGI24741J21665_100022011 561
449 3300001979 JGI24740J21852_10000198 JGI24740J21852_1000019816 561
450 3300001979 JGI24740J21852_10000808 JGI24740J21852_1000080811 561
451 3300001979 JGI24740J21852_10011223 JGI24740J21852_100112232 561
452 3300002705 JGI25156J39149_1003726 JGI25156J39149_10037261 561
453 3300003578 Ga0006562J51391_1024980 Ga0006562J51391_10249801 561
454 3300003752 Ga0055539_1000148 Ga0055539_10001481 561
455 3300003756 Ga0055533_1005028 Ga0055533_10050281 561
456 3300003758 Ga0055532_1000072 Ga0055532_100007266 561
457 3300003759 Ga0055525_1000168 Ga0055525_100016849 561
458 3300003761 Ga0055535_1000053 Ga0055535_100005366 561
459 3300003763 Ga0055529_1000099 Ga0055529_100009954 561
460 3300005344 Ga0070661_100000097 Ga0070661_10000009752 561
461 3300005366 Ga0070659_100001035 Ga0070659_10000103515 561
462 3300005455 Ga0070663_100000016 Ga0070663_10000001666 561
463 3300005564 Ga0070664_100000017 Ga0070664_10000001768 561
464 3300005614 Ga0068856_100000450 Ga0068856_10000045035 561
465 3300005614 Ga0068856_100030419 Ga0068856_1000304192 561
466 3300009011 Ga0105251_10001356 Ga0105251_100013561 561
467 3300009093 Ga0105240_10059074 Ga0105240_100590744 561
468 3300013100 Ga0157373_10008754 Ga0157373_100087547 561
469 3300013104 Ga0157370_10002603 Ga0157370_100026032 561
470 3300013105 Ga0157369_10097592 Ga0157369_100975923 561
471 3300013307 Ga0157372_10002351 Ga0157372_100023512 561
472 3300025224 Ga0209784_100063 Ga0209784_10006396 561
473 3300025225 Ga0209566_100048 Ga0209566_10004851 561
474 3300025226 Ga0209674_100071 Ga0209674_100071166 561
475 3300025226 Ga0209674_100151 Ga0209674_10015149 561
476 3300025229 Ga0209147_100002 Ga0209147_10000255 561
477 3300025230 Ga0209563_100085 Ga0209563_100085166 561
478 3300025242 Ga0209258_100002 Ga0209258_10000255 561
479 3300025253 Ga0209677_100040 Ga0209677_10004051 561
480 3300025272 Ga0209455_1000149 Ga0209455_100014967 561
481 3300025913 Ga0207695_10043483 Ga0207695_100434834 561
482 3300025920 Ga0207649_10000051 Ga0207649_1000005136 561
483 3300025945 Ga0207679_10000042 Ga0207679_1000004266 561
484 3300026067 Ga0207678_10000055 Ga0207678_1000005526 561
485 3300026078 Ga0207702_10000156 Ga0207702_1000015630 561
486 3300026078 Ga0207702_10033442 Ga0207702_100334423 561
487 3300026116 Ga0207674_10009935 Ga0207674_100099355 561
488 3300027312 Ga0209371_1002068 Ga0209371_10020688 561
489 3300030500 Ga0268256_1001827 Ga0268256_10018278 561
490 3300044712 Ga0453684_0118806 Ga0453684_0118806_1197_3050 561
491 3300046473 Ga0495582_0008915 Ga0495582_0008915_2587_4323 561

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

390

509

0.95

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

227

590

0.92

PF03129

HGTP_anticodon

Anticodon binding domain

606

700

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5znk-assembly1.cif.gz_A crystal structure of a bacterial prors with ligands 0.9114 1 561
5ucm-assembly1.cif.gz_B crystal structure of prolyl-trna synthetase from pseudomonas aeruginosa 0.9102 1 559
5znj-assembly1.cif.gz_A crystal structure of a bacterial prors with ligands 0.9093 1 561
5znk-assembly1.cif.gz_A crystal structure of a bacterial prors with ligands 0.9082 1 561
5znj-assembly1.cif.gz_A crystal structure of a bacterial prors with ligands 0.9078 1 561
ID Description Score Start End Superfamily
af_P16659_468_566_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9813 457 554 3.40.50.800
2i4oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9692 455 555 3.40.50.800
af_P16659_468_566_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.962 457 554 3.40.50.800
2i4oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9506 455 555 3.40.50.800
5ucmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9506 455 559 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A354SLR6-F1-model_v4 Proline--tRNA ligase 0.9747 397 560 GO:0004827
GO:0005524
GO:0005829
GO:0006433
AF-A0A448MUA6-F1-model_v4 Prolyl-tRNA synthase (EC 6.1.1.15) 0.9716 414 559 GO:0004827
GO:0005829
GO:0006433
AF-X1VYZ4-F1-model_v4 Anticodon-binding domain-containing protein 0.9705 436 560 GO:0004827
GO:0005829
GO:0006433
AF-A0A382U6C9-F1-model_v4 Anticodon-binding domain-containing protein 0.9693 381 556 GO:0004827
GO:0005829
GO:0006433
AF-A0A3D4PLQ3-F1-model_v4 Proline--tRNA ligase 0.9684 396 560 GO:0004827
GO:0005829
GO:0006433

Feature Viewer

pLDDT pTM Quality
92.19 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map