F454009

General Info

Members Datasets Scaffolds Average Seq Length
490 396 226 347

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0224409|Ga0501034_0224409_604_1770
Length 388
Sequence MNDAACGAAGLTTNLSSFVILRLDPGIHALPIGNERPMTVSPFDHPYLSGLLGDEAVAALFSVAAELEAMLAFEVALARAEAEAGVIPSDAARAIEAAAHRFSPDVASLRTATARDGVVVPDFVRQLRAAVGEPHGRHVHVGATSQDVVDSGLMLRLSRVLPVLEKRLEGLAGMLDGLAATFGDRELMGRTRMQAAIPITVADRVEAWRAPLERHRMRLNGLMEEGLAVQFGGAAGTLEKLGGRAPAVRAALARGLGLADAPQWHSQRDRIMDLAALLSGITGSLGKIGQDIALMADRSEEIALAGGGSSSAMPHKQNPVAAEGLVTLARFNAAQLGGLGQAMVHEQERSGAAWTLEWLILPQMVVAAGAALRLADALLSSIRRLGAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2516143018 Ensifer sp. BR816 Isolate Nodule
12 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
13 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
14 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
15 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
16 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
17 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
18 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
19 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
20 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
21 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
22 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
23 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
24 2643221557 Ensifer sp. Root558 Isolate Unclassified
25 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
26 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
27 2643221610 Ensifer sp. Root74 Isolate Unclassified
28 2643221618 Ensifer sp. Root231 Isolate Unclassified
29 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
30 2643221626 Ensifer sp. Root31 Isolate Unclassified
31 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
32 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
33 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
34 2643221655 Ensifer sp. Root1252 Isolate Unclassified
35 2643221659 Ensifer sp. Root127 Isolate Unclassified
36 2643221668 Ensifer sp. Root423 Isolate Unclassified
37 2643221675 Ensifer sp. Root1298 Isolate Unclassified
38 2643221680 Ensifer sp. Root1312 Isolate Unclassified
39 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
40 2643221698 Ensifer sp. Root142 Isolate Unclassified
41 2643221712 Ensifer sp. Root258 Isolate Unclassified
42 2643221719 Rhizobium sp. Root274 Isolate Unclassified
43 2643221723 Ensifer sp. Root278 Isolate Unclassified
44 2643221726 Ensifer sp. Root954 Isolate Unclassified
45 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
46 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
47 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
48 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
49 2738543024 Aminobacter sp. AP02 Isolate Unclassified
50 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
51 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
52 2773857925 Microvirga vignae BR3299 Isolate Unclassified
53 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
54 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
55 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
56 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
57 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
58 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
59 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
60 2844163670 Ensifer sp. 1H6 Isolate Unclassified
61 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
62 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
63 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
64 2854911287 Brucella lupini LUP21 Isolate Unclassified
65 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
66 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
67 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
68 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
69 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
70 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
71 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
72 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
73 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
74 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
75 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
76 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
77 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
78 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
79 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
80 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
81 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
82 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
83 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
84 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
85 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
86 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
87 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
88 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
89 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
90 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
91 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
92 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
93 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
94 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
95 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
96 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
97 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
98 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
99 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
100 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
101 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
102 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
103 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
104 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
105 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
106 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
107 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
108 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
109 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
110 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
111 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
112 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
113 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
114 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
115 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
116 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
117 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
118 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
119 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
120 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
121 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
122 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
123 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
124 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
125 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
126 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
127 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
128 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
129 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
130 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
131 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
132 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
133 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
134 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
135 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
136 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
137 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
138 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
139 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
140 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
141 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
142 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
143 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
144 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
145 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
146 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
147 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
148 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
149 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
150 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
151 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
152 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
153 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
154 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
155 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
156 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
157 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
158 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
159 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
160 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
161 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
162 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
163 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
164 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
165 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
166 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
167 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
168 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
169 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
170 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
171 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
172 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
173 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
174 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
175 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
176 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
177 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
178 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
179 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
180 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
181 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
182 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
183 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
184 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
185 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
186 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
187 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
188 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
189 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
190 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
191 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
192 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
193 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
194 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
195 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
196 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
197 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
198 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
199 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
200 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
201 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
202 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
203 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
204 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
205 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
206 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
207 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
208 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
209 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
210 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
211 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
212 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
213 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
214 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
215 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
216 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
217 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
218 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
219 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
220 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
221 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
222 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
223 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
224 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
225 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
226 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
227 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
228 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
229 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
230 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
231 3004167301 Mesorhizobium loti 582 Isolate Unclassified
232 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
233 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
234 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
235 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
236 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
237 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
238 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
239 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
240 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
241 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
242 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
243 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
244 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
245 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
246 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
247 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
248 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
249 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
250 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
251 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
252 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
253 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
254 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
255 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
256 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
257 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
258 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
259 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
260 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
261 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
262 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
263 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
264 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
265 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
266 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
267 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
268 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
269 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
270 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
271 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
272 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
273 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
274 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
275 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
276 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
277 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
278 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
279 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
280 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
281 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
282 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
284 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
285 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
286 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
288 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
295 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
307 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
308 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
309 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
310 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
311 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
312 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
313 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
314 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
320 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
327 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
366 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
367 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
368 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
369 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
370 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
373 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
378 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
379 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
382 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
383 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
384 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
385 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
386 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
387 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
388 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
389 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
390 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
391 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
392 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
393 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
394 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
395 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
396 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.12
Metatranscriptomes 0
Isolates 53.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.18
Nodule 38.57
Rhizoplane 1.22
Rhizosphere 22.04
Stem 0
Stem Tuber 0
Unclassified 18.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000347 3300002739 Bacteria 10132
2 JGI25152J39213_1005724 3300002773 Bacteria 3551
3 JGI25152J39213_1005868 3300002773 Bacteria 3473
4 JGI25159J45721_1000083 3300002987 Bacteria 44911
5 JGI25159J45721_1000259 3300002987 Bacteria 24699
6 JGI25159J45721_1000466 3300002987 Bacteria 18688
7 JGI25151J46595_10018172 3300003187 Bacteria 3030
8 JGI25153J46596_10012993 3300003215 Bacteria 3551
9 JGI25153J46596_10013350 3300003215 Bacteria 3473
10 JGI25153J46596_10030831 3300003215 Bacteria 1817
11 rootH1_10061295 3300003316 Bacteria 1551
12 JGI25160J50197_1000005 3300003354 Bacteria 417280
13 JGI25160J50197_1006181 3300003354 Bacteria 4875
14 JGI25161J50226_1000025 3300003374 Bacteria 148471
15 JGI25161J50226_1001121 3300003374 Bacteria 8987
16 Ga0055542_1000227 3300003762 Bacteria 67082
17 Ga0055526_1002592 3300003771 Bacteria 12087
18 Ga0055526_1007836 3300003771 Bacteria 5462
19 Ga0055524_1000581 3300003775 Bacteria 26755
20 Ga0055536_1000467 3300003781 Bacteria 28376
21 Ga0055531_10020629 3300003794 Bacteria 2597
22 Ga0055543_1000021 3300004625 Bacteria 150116
23 Ga0055543_1000324 3300004625 Bacteria 33093
24 Ga0065165_1000002 3300005262 Bacteria 444192
25 Ga0070659_100176116 3300005366 Bacteria 1754
26 Ga0070665_100069048 3300005548 Bacteria 3542
27 Ga0068857_100059870 3300005577 Bacteria 3384
28 Ga0068852_100070158 3300005616 Bacteria 3074
29 Ga0081540_1010250 3300005983 Bacteria 6364
30 Ga0075365_10215042 3300006038 Bacteria 1348
31 Ga0075364_10000018 3300006051 Bacteria 55324
32 Ga0075364_10001924 3300006051 Bacteria 11562
33 Ga0075364_10091320 3300006051 Bacteria 2020
34 Ga0075367_10001150 3300006178 Bacteria 11036
35 Ga0075367_10008246 3300006178 Bacteria 5388
36 Ga0075369_10045840 3300006186 Bacteria 1881
37 Ga0075369_10097623 3300006186 Bacteria 1316
38 Ga0105240_10058545 3300009093 Bacteria 4810
39 Ga0105240_10079788 3300009093 Bacteria 4027
40 Ga0105240_10122032 3300009093 Bacteria 3137
41 Ga0105237_10322003 3300009545 Bacteria 1550
42 Ga0105238_10007244 3300009551 Bacteria 11103
43 Ga0105238_10197142 3300009551 Bacteria 1989
44 Ga0105239_10074454 3300010375 Bacteria 3733
45 Ga0105239_10078448 3300010375 Bacteria 3634
46 Ga0105239_10485557 3300010375 Bacteria 1404
47 Ga0157370_10080624 3300013104 Bacteria 3064
48 Ga0171463_1013 3300013249 Bacteria 94945
49 Ga0163162_10140642 3300013306 Bacteria 2527
50 Ga0214544_1000130 3300021320 Bacteria 108844
51 Ga0214544_1000329 3300021320 Bacteria 82143
52 Ga0214542_1000014 3300021321 Bacteria 233825
53 Ga0214542_1000084 3300021321 Bacteria 120499
54 Ga0214543_1000025 3300021327 Bacteria 225351
55 Ga0214543_1000076 3300021327 Bacteria 120483
56 Ga0214543_1000146 3300021327 Bacteria 98609
57 Ga0209436_100044 3300025208 Bacteria 70547
58 Ga0209436_100162 3300025208 Bacteria 32237
59 Ga0207425_1000563 3300025245 Bacteria 21840
60 Ga0207425_1006512 3300025245 Bacteria 3186
61 Ga0207425_1014567 3300025245 Bacteria 1782
62 Ga0209646_1010392 3300025246 Bacteria 1460
63 Ga0209026_1000025 3300025250 Bacteria 352548
64 Ga0209148_1000057 3300025254 Bacteria 360463
65 Ga0209759_1000197 3300025256 Bacteria 95422
66 Ga0209129_1004815 3300025258 Bacteria 5088
67 Ga0209129_1006772 3300025258 Bacteria 3603
68 Ga0209129_1006906 3300025258 Bacteria 3525
69 Ga0209233_1000010 3300025261 Bacteria 1194329
70 Ga0209455_1000224 3300025272 Bacteria 77325
71 Ga0209130_1000001 3300025284 Bacteria 831557
72 Ga0209130_1000010 3300025284 Bacteria 444920
73 Ga0209676_1005657 3300025292 Bacteria 6436
74 Ga0209025_1002603 3300025294 Bacteria 18593
75 Ga0209025_1004543 3300025294 Bacteria 11960
76 Ga0209025_1012184 3300025294 Bacteria 5548
77 Ga0209564_1000025 3300025295 Bacteria 520535
78 Ga0209564_1001278 3300025295 Bacteria 27680
79 Ga0209564_1028218 3300025295 Bacteria 1801
80 Ga0209758_1000115 3300025297 Bacteria 199268
81 Ga0209758_1001361 3300025297 Bacteria 29297
82 Ga0209758_1001669 3300025297 Bacteria 25096
83 Ga0209758_1001814 3300025297 Bacteria 23603
84 Ga0209758_1011938 3300025297 Bacteria 4941
85 Ga0209050_1012499 3300025298 Bacteria 3885
86 Ga0209256_1000828 3300025299 Bacteria 39174
87 Ga0209256_1005449 3300025299 Bacteria 7325
88 Ga0209256_1006490 3300025299 Bacteria 6158
89 Ga0207426_1000005 3300025302 Bacteria 1037188
90 Ga0207426_1000036 3300025302 Bacteria 444920
91 Ga0209051_1012393 3300025303 Bacteria 4127
92 Ga0209257_1001018 3300025304 Bacteria 37731
93 Ga0209257_1019400 3300025304 Bacteria 2563
94 Ga0207642_10053354 3300025899 Bacteria 1839
95 Ga0207688_10033070 3300025901 Bacteria 2859
96 Ga0207647_10004710 3300025904 Bacteria 10101
97 Ga0207647_10041929 3300025904 Bacteria 2874
98 Ga0207705_10048791 3300025909 Bacteria 3047
99 Ga0207695_10063883 3300025913 Bacteria 3793
100 Ga0207671_10005869 3300025914 Bacteria 11152
101 Ga0207694_10003375 3300025924 Bacteria 12715
102 Ga0207694_10255643 3300025924 Bacteria 1434
103 Ga0207639_10010731 3300026041 Bacteria 6346
104 Ga0268266_10131420 3300028379 Bacteria 2239
105 Ga0307408_100155278 3300031548 Bacteria 1811
106 Ga0307405_10310451 3300031731 Bacteria 1200
107 Ga0307410_10237231 3300031852 Bacteria 1411
108 Ga0307406_10031412 3300031901 Bacteria 3234
109 Ga0307412_10119793 3300031911 Bacteria 1893
110 Ga0307412_10153919 3300031911 Bacteria 1700
111 Ga0307409_100122154 3300031995 Bacteria 2208
112 Ga0436363_1371666 3300039450 Bacteria 1171
113 Ga0439465_0017127 3300041413 Bacteria 2261
114 Ga0439432_020066 3300042006 Bacteria 2224
115 Ga0466966_0063500 3300044684 Bacteria 2327
116 Ga0466971_0028265 3300044719 Bacteria 2510
117 Ga0466959_0252093 3300045049 Bacteria 1217
118 Ga0495638_0021565 3300046460 Bacteria 4242
119 Ga0495606_0042306 3300046507 Bacteria 3048
120 Ga0495610_0012498 3300046512 Bacteria 5105
121 Ga0495632_0000202 3300046519 Bacteria 60620
122 Ga0495643_0002915 3300046522 Bacteria 12974
123 Ga0495588_0018926 3300046674 Bacteria 3366
124 Ga0495649_0077876 3300046694 Bacteria 1774
125 Ga0495660_0036677 3300046810 Bacteria 2734
126 Ga0495681_0002764 3300047470 Bacteria 12417
127 Ga0495626_0064298 3300048091 Bacteria 1662
128 Ga0496106_0000269 3300048909 Bacteria 36744
129 Ga0496106_0145093 3300048909 Bacteria 1869
130 Ga0496112_0017411 3300048915 Bacteria 6750
131 Ga0496116_0026777 3300048919 Bacteria 4207
132 Ga0496117_0109476 3300048920 Bacteria 1725
133 Ga0496118_0090309 3300048921 Bacteria 2111
134 Ga0496119_0055029 3300048922 Bacteria 2419
135 Ga0496119_0062796 3300048922 Bacteria 2212
136 Ga0496119_0083162 3300048922 Bacteria 1839
137 Ga0496120_0009699 3300048923 Bacteria 6793
138 Ga0496121_0001905 3300048924 Bacteria 33397
139 Ga0496121_0069792 3300048924 Bacteria 2833
140 Ga0496121_0071388 3300048924 Bacteria 2792
141 Ga0496121_0159272 3300048924 Bacteria 1653
142 Ga0496121_0175539 3300048924 Bacteria 1551
143 Ga0496123_0013715 3300048926 Bacteria 6777
144 Ga0496124_0001598 3300048927 Bacteria 32591
145 Ga0496124_0030008 3300048927 Bacteria 4835
146 Ga0496124_0041261 3300048927 Bacteria 3984
147 Ga0496124_0069789 3300048927 Bacteria 2916
148 Ga0496124_0267334 3300048927 Bacteria 1254
149 Ga0496125_0052318 3300048928 Bacteria 3359
150 Ga0496125_0054421 3300048928 Bacteria 3270
151 Ga0496125_0077925 3300048928 Bacteria 2551
152 Ga0496125_0115410 3300048928 Bacteria 1931
153 Ga0496126_0000808 3300048929 Bacteria 56013
154 Ga0496126_0088806 3300048929 Bacteria 2722
155 Ga0496126_0126393 3300048929 Bacteria 2213
156 Ga0496126_0200990 3300048929 Bacteria 1683
157 Ga0501031_0000010 3300049568 Bacteria 146435
158 Ga0501031_0067820 3300049568 Bacteria 2323
159 Ga0501031_0142466 3300049568 Bacteria 1567
160 Ga0501032_0000023 3300049569 Bacteria 146435
161 Ga0501032_0042316 3300049569 Bacteria 3090
162 Ga0501033_0000104 3300049570 Bacteria 81029
163 Ga0501033_0001071 3300049570 Bacteria 24862
164 Ga0501033_0039506 3300049570 Bacteria 3524
165 Ga0501034_0000116 3300049571 Bacteria 146442
166 Ga0501034_0001376 3300049571 Bacteria 32684
167 Ga0501034_0224409 3300049571 Bacteria 1830
168 Ga0501034_0444085 3300049571 Bacteria 1216
169 Ga0501036_0000015 3300049572 Bacteria 146442
170 Ga0501036_0000366 3300049572 Bacteria 31773
171 Ga0501037_0000023 3300049573 Bacteria 146542
172 Ga0501037_0000029 3300049573 Bacteria 139680
173 Ga0501037_0077885 3300049573 Bacteria 2405
174 Ga0501038_0000025 3300049574 Bacteria 146542
175 Ga0501038_0001873 3300049574 Bacteria 19437
176 Ga0501038_0023128 3300049574 Bacteria 5561
177 Ga0501039_0000037 3300049575 Bacteria 122286
178 Ga0501039_0001165 3300049575 Bacteria 19327
179 Ga0501040_0006421 3300049576 Bacteria 7635
180 Ga0501043_0000070 3300049579 Bacteria 89839
181 Ga0501043_0001622 3300049579 Bacteria 19584
182 Ga0501043_0132008 3300049579 Bacteria 1957
183 Ga0501047_0002287 3300049581 Bacteria 18325
184 Ga0501047_0128770 3300049581 Bacteria 2412
185 Ga0501068_0081947 3300049584 Bacteria 1981
186 Ga0501070_0022526 3300049586 Bacteria 5277
187 Ga0501073_0137351 3300049589 Bacteria 1694
188 Ga0501083_0010111 3300049744 Bacteria 6647
189 Ga0501035_0000057 3300049822 Bacteria 135297
190 Ga0501035_0000074 3300049822 Bacteria 122269
191 Ga0501035_0115408 3300049822 Bacteria 2350
192 Ga0501044_0000069 3300049823 Bacteria 125974
193 Ga0501044_0034203 3300049823 Bacteria 5332
194 Ga0501044_0158202 3300049823 Bacteria 2244
195 Ga0501045_0161464 3300049824 Bacteria 1668
196 nmdc:mga03n38_139717_c1 3300050490 Bacteria 1208
197 nmdc:mga03n38_17700_c1 3300050490 Bacteria 2796
198 nmdc:mga00v17_510_c1 3300050491 Bacteria 21768
199 nmdc:mga0yw44_114197_c1 3300050492 Bacteria 1733
200 nmdc:mga0yw44_17647_c1 3300050492 Bacteria 3889
201 nmdc:mga0yw44_2420_c1 3300050492 Bacteria 7946
202 nmdc:mga0yw44_4168_c1 3300050492 Bacteria 6573
203 nmdc:mga0yw44_84656_c1 3300050492 Bacteria 1994
204 nmdc:mga06z11_1261_c1 3300050494 Bacteria 9369
205 nmdc:mga06z11_92708_c1 3300050494 Bacteria 1643
206 nmdc:mga04h51_16775_c1 3300050495 Bacteria 2131
207 nmdc:mga07m45_16294_c1 3300050496 Bacteria 1593
208 nmdc:mga0sz30_14269_c1 3300050516 Bacteria 3124
209 Ga0495655_0008019 3300053083 Bacteria 1990
210 Ga0500646_0003493 3300053090 Bacteria 4028
211 Ga0500654_089420 3300053099 Bacteria 1382
212 Ga0500618_000122 3300053125 Bacteria 63970
213 Ga0500642_0044091 3300053130 Bacteria 1940
214 Ga0500658_0024481 3300053134 Bacteria 2313
215 Ga0500568_0000695 3300053139 Bacteria 24132
216 Ga0500568_0066157 3300053139 Bacteria 1390
217 Ga0500588_0000823 3300053146 Bacteria 5390
218 Ga0500604_0017069 3300053151 Bacteria 2004
219 Ga0500604_0018916 3300053151 Bacteria 1924
220 Ga0500616_0000104 3300053153 Bacteria 159954
221 Ga0500620_000018 3300053155 Bacteria 33396
222 Ga0500622_0000185 3300053156 Bacteria 66073
223 Ga0500633_0019408 3300053160 Bacteria 2032
224 Ga0500634_0000848 3300053161 Bacteria 10833
225 Ga0500636_0000038 3300053177 Bacteria 70653
226 Ga0501082_0452424 3300060353 Bacteria 1122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053151 Ga0500604_0017069 Ga0500604_0017069_1142_1984 266
2 3300009551 Ga0105238_10197142 Ga0105238_101971423 273
3 3300025924 Ga0207694_10255643 Ga0207694_102556432 273
4 3300025899 Ga0207642_10053354 Ga0207642_100533542 293
5 3300021327 Ga0214543_1000025 Ga0214543_10000254 299
6 3300044684 Ga0466966_0063500 Ga0466966_0063500_795_1853 299
7 3300044719 Ga0466971_0028265 Ga0466971_0028265_346_1404 299
8 3300045049 Ga0466959_0252093 Ga0466959_0252093_66_1124 299
9 iso_pu_bacteria 3004248173 3004251383 300
10 3300006186 Ga0075369_10097623 Ga0075369_100976232 302
11 3300049568 Ga0501031_0142466 Ga0501031_0142466_20_1009 302
12 3300049571 Ga0501034_0444085 Ga0501034_0444085_16_966 302
13 3300050495 nmdc:mga04h51_16775_c1 nmdc:mga04h51_16775_c1_10_975 302
14 3300050516 nmdc:mga0sz30_14269_c1 nmdc:mga0sz30_14269_c1_203_1267 303
15 3300010375 Ga0105239_10485557 Ga0105239_104855572 304
16 3300053125 Ga0500618_000122 Ga0500618_000122_53156_54214 306
17 iso_pu_bacteria 2958108152 2958114630 306
18 3300021320 Ga0214544_1000329 Ga0214544_100032969 308
19 3300021321 Ga0214542_1000084 Ga0214542_100008469 308
20 3300021327 Ga0214543_1000076 Ga0214543_100007669 308
21 3300048922 Ga0496119_0083162 Ga0496119_0083162_826_1821 309
22 iso_pu_bacteria 2885312484 2885318661 310
23 3300046674 Ga0495588_0018926 Ga0495588_0018926_2077_3138 316
24 3300047470 Ga0495681_0002764 Ga0495681_0002764_11069_12130 316
25 3300006038 Ga0075365_10215042 Ga0075365_102150422 317
26 3300050492 nmdc:mga0yw44_114197_c1 nmdc:mga0yw44_114197_c1_273_1325 317
27 3300003762 Ga0055542_1000227 Ga0055542_100022749 318
28 3300010375 Ga0105239_10074454 Ga0105239_100744544 318
29 3300025254 Ga0209148_1000057 Ga0209148_100005754 318
30 3300025272 Ga0209455_1000224 Ga0209455_100022410 318
31 3300050496 nmdc:mga07m45_16294_c1 nmdc:mga07m45_16294_c1_304_1356 318
32 iso_pu_bacteria 3004239961 3004244484 318
33 3300046519 Ga0495632_0000202 Ga0495632_0000202_40301_41350 319
34 iso_pu_bacteria 2906427513 2906435363 319
35 3300002987 JGI25159J45721_1000083 JGI25159J45721_100008341 322
36 3300002987 JGI25159J45721_1000466 JGI25159J45721_100046612 322
37 3300003354 JGI25160J50197_1000005 JGI25160J50197_100000545 322
38 3300003374 JGI25161J50226_1001121 JGI25161J50226_10011214 322
39 3300003771 Ga0055526_1002592 Ga0055526_100259212 322
40 3300004625 Ga0055543_1000324 Ga0055543_100032425 322
41 3300005262 Ga0065165_1000002 Ga0065165_1000002345 322
42 3300025208 Ga0209436_100162 Ga0209436_10016217 322
43 3300025284 Ga0209130_1000010 Ga0209130_1000010341 322
44 3300025292 Ga0209676_1005657 Ga0209676_10056577 322
45 3300025295 Ga0209564_1000025 Ga0209564_10000254 322
46 3300025298 Ga0209050_1012499 Ga0209050_10124994 322
47 3300025299 Ga0209256_1006490 Ga0209256_10064903 322
48 3300025302 Ga0207426_1000036 Ga0207426_1000036341 322
49 3300025303 Ga0209051_1012393 Ga0209051_10123933 322
50 3300025304 Ga0209257_1019400 Ga0209257_10194003 322
51 3300053161 Ga0500634_0000848 Ga0500634_0000848_720_1772 322
52 3300046460 Ga0495638_0021565 Ga0495638_0021565_1263_2315 323
53 3300049568 Ga0501031_0067820 Ga0501031_0067820_708_1763 323
54 3300049569 Ga0501032_0042316 Ga0501032_0042316_893_1948 323
55 3300049570 Ga0501033_0039506 Ga0501033_0039506_1447_2502 323
56 3300049573 Ga0501037_0077885 Ga0501037_0077885_573_1628 323
57 3300049574 Ga0501038_0023128 Ga0501038_0023128_3504_4559 323
58 3300049822 Ga0501035_0115408 Ga0501035_0115408_256_1311 323
59 3300049823 Ga0501044_0034203 Ga0501044_0034203_2399_3454 323
60 3300049824 Ga0501045_0161464 Ga0501045_0161464_528_1583 323
61 3300005366 Ga0070659_100176116 Ga0070659_1001761162 324
62 3300048922 Ga0496119_0062796 Ga0496119_0062796_771_1829 324
63 3300048929 Ga0496126_0126393 Ga0496126_0126393_1116_2174 324
64 3300010375 Ga0105239_10078448 Ga0105239_100784483 325
65 3300042006 Ga0439432_020066 Ga0439432_020066_551_1603 325
66 3300048915 Ga0496112_0017411 Ga0496112_0017411_1211_2263 325
67 3300053090 Ga0500646_0003493 Ga0500646_0003493_708_1775 326
68 3300053130 Ga0500642_0044091 Ga0500642_0044091_381_1448 326
69 3300053139 Ga0500568_0066157 Ga0500568_0066157_172_1239 326
70 3300053146 Ga0500588_0000823 Ga0500588_0000823_174_1241 326
71 iso_pu_bacteria 8005246636 8005250285 326
72 iso_pu_bacteria 2738541317 2738946740 327
73 iso_pu_bacteria 2775506901 2776260534 327
74 iso_pu_bacteria 2913308742 2913311902 327
75 3300046512 Ga0495610_0012498 Ga0495610_0012498_813_1859 328
76 3300046522 Ga0495643_0002915 Ga0495643_0002915_1577_2623 328
77 3300046694 Ga0495649_0077876 Ga0495649_0077876_683_1729 328
78 3300048919 Ga0496116_0026777 Ga0496116_0026777_2667_3713 328
79 3300048920 Ga0496117_0109476 Ga0496117_0109476_174_1220 328
80 3300048921 Ga0496118_0090309 Ga0496118_0090309_715_1761 328
81 3300048924 Ga0496121_0175539 Ga0496121_0175539_449_1495 328
82 3300048927 Ga0496124_0069789 Ga0496124_0069789_1361_2407 328
83 3300048928 Ga0496125_0054421 Ga0496125_0054421_170_1216 328
84 3300053156 Ga0500622_0000185 Ga0500622_0000185_53571_54617 328
85 iso_pu_bacteria 2643221653 2644299451 328
86 iso_pu_bacteria 2643221719 2644657679 328
87 iso_pu_bacteria 2773857925 2774872914 328
88 iso_pu_bacteria 2869264136 2869268529 328
89 iso_pu_bacteria 2882456835 2882457930 328
90 iso_pu_bacteria 2989776772 2989780563 328
91 iso_pu_bacteria 2503198000 2503203913 329
92 iso_pu_bacteria 2508501050 2508732738 329
93 iso_pu_bacteria 2508501114 2509075606 329
94 iso_pu_bacteria 2510065059 2510316812 329
95 iso_pu_bacteria 2512875016 2512929289 329
96 iso_pu_bacteria 2512875024 2512964101 329
97 iso_pu_bacteria 2513237090 2513611404 329
98 iso_pu_bacteria 2516143018 2516207836 329
99 iso_pu_bacteria 2582581306 2585267279 329
100 iso_pu_bacteria 2582581865 2585386348 329
101 iso_pu_bacteria 2588253730 2588514844 329
102 iso_pu_bacteria 2599185301 2599936860 329
103 iso_pu_bacteria 2643221564 2643839630 329
104 iso_pu_bacteria 2643221595 2643986295 329
105 iso_pu_bacteria 2643221627 2644152527 329
106 iso_pu_bacteria 2693429783 2694630966 329
107 iso_pu_bacteria 2693429784 2694636536 329
108 iso_pu_bacteria 2756170246 2756672779 329
109 iso_pu_bacteria 2791355123 2792745812 329
110 iso_pu_bacteria 2835312727 2835319037 329
111 iso_pu_bacteria 2844002411 2844005236 329
112 iso_pu_bacteria 2847670302 2847675543 329
113 iso_pu_bacteria 2854911287 2854916455 329
114 iso_pu_bacteria 2854916844 2854920916 329
115 iso_pu_bacteria 2856314179 2856314234 329
116 iso_pu_bacteria 2856314179 2856319429 329
117 iso_pu_bacteria 2856334872 2856339485 329
118 iso_pu_bacteria 2856364286 2856369363 329
119 iso_pu_bacteria 2857349434 2857351255 329
120 iso_pu_bacteria 2857367948 2857372265 329
121 iso_pu_bacteria 2869249662 2869255668 329
122 iso_pu_bacteria 2869271264 2869273578 329
123 iso_pu_bacteria 2869285874 2869286564 329
124 iso_pu_bacteria 2871429161 2871434717 329
125 iso_pu_bacteria 2871435913 2871442079 329
126 iso_pu_bacteria 2871451962 2871456855 329
127 iso_pu_bacteria 2871459585 2871460647 329
128 iso_pu_bacteria 2871466892 2871472990 329
129 iso_pu_bacteria 2871481445 2871482352 329
130 iso_pu_bacteria 2871495908 2871496611 329
131 iso_pu_bacteria 2874109183 2874111249 329
132 iso_pu_bacteria 2874116593 2874122884 329
133 iso_pu_bacteria 2874123672 2874123917 329
134 iso_pu_bacteria 2874131515 2874133119 329
135 iso_pu_bacteria 2874146452 2874149922 329
136 iso_pu_bacteria 2874155637 2874158180 329
137 iso_pu_bacteria 2874162495 2874164324 329
138 iso_pu_bacteria 2874168670 2874173907 329
139 iso_pu_bacteria 2876363079 2876367155 329
140 iso_pu_bacteria 2876369609 2876372905 329
141 iso_pu_bacteria 2876386047 2876391187 329
142 iso_pu_bacteria 2876392853 2876398340 329
143 iso_pu_bacteria 2876399893 2876404071 329
144 iso_pu_bacteria 2876406927 2876411238 329
145 iso_pu_bacteria 2876413966 2876416384 329
146 iso_pu_bacteria 2876420981 2876424023 329
147 iso_pu_bacteria 2878035449 2878040663 329
148 iso_pu_bacteria 2878730984 2878736737 329
149 iso_pu_bacteria 2878745973 2878751850 329
150 iso_pu_bacteria 2878753008 2878758785 329
151 iso_pu_bacteria 2878760144 2878760838 329
152 iso_pu_bacteria 2878767105 2878767801 329
153 iso_pu_bacteria 2878774303 2878779410 329
154 iso_pu_bacteria 2878781027 2878786473 329
155 iso_pu_bacteria 2881147464 2881151214 329
156 iso_pu_bacteria 2881155292 2881161712 329
157 iso_pu_bacteria 2881161766 2881167429 329
158 iso_pu_bacteria 2881845957 2881846176 329
159 iso_pu_bacteria 2881861095 2881862454 329
160 iso_pu_bacteria 2882632389 2882636174 329
161 iso_pu_bacteria 2882912400 2882915097 329
162 iso_pu_bacteria 2885312484 2885312791 329
163 iso_pu_bacteria 2885318864 2885319398 329
164 iso_pu_bacteria 2885350715 2885356006 329
165 iso_pu_bacteria 2889010040 2889010588 329
166 iso_pu_bacteria 2889016732 2889017710 329
167 iso_pu_bacteria 2891048133 2891048272 329
168 iso_pu_bacteria 2894232714 2894233289 329
169 iso_pu_bacteria 2903448605 2903453377 329
170 iso_pu_bacteria 2903492973 2903503976 329
171 iso_pu_bacteria 2903492973 2903504796 329
172 iso_pu_bacteria 2903513507 2903520767 329
173 iso_pu_bacteria 2903521522 2903526646 329
174 iso_pu_bacteria 2903528002 2903530735 329
175 iso_pu_bacteria 2903540706 2903541409 329
176 iso_pu_bacteria 2904659560 2904664895 329
177 iso_pu_bacteria 2906308376 2906314248 329
178 iso_pu_bacteria 2906321335 2906327414 329
179 iso_pu_bacteria 2906363423 2906368799 329
180 iso_pu_bacteria 2906370794 2906373098 329
181 iso_pu_bacteria 2906378014 2906385046 329
182 iso_pu_bacteria 2906386501 2906392053 329
183 iso_pu_bacteria 2906393657 2906395567 329
184 iso_pu_bacteria 2906401398 2906403702 329
185 iso_pu_bacteria 2906408224 2906412258 329
186 iso_pu_bacteria 2906414383 2906414656 329
187 iso_pu_bacteria 2906414383 2906420149 329
188 iso_pu_bacteria 2922151315 2922152165 329
189 iso_pu_bacteria 2922172374 2922175457 329
190 iso_pu_bacteria 2922178524 2922181335 329
191 iso_pu_bacteria 2924710171 2924716396 329
192 iso_pu_bacteria 2924733363 2924738806 329
193 iso_pu_bacteria 2924748358 2924751996 329
194 iso_pu_bacteria 2924762789 2924765018 329
195 iso_pu_bacteria 2924784321 2924788987 329
196 iso_pu_bacteria 2937813078 2937815642 329
197 iso_pu_bacteria 2937822353 2937824352 329
198 iso_pu_bacteria 2937848649 2937850325 329
199 iso_pu_bacteria 2937861824 2937868712 329
200 iso_pu_bacteria 2937868953 2937874244 329
201 iso_pu_bacteria 2937994558 2937995265 329
202 iso_pu_bacteria 2958064165 2958068238 329
203 iso_pu_bacteria 2958100919 2958107280 329
204 iso_pu_bacteria 2958122699 2958127824 329
205 iso_pu_bacteria 2958130278 2958130967 329
206 iso_pu_bacteria 2958137437 2958143343 329
207 iso_pu_bacteria 2958165035 2958165741 329
208 iso_pu_bacteria 2958172287 2958176950 329
209 iso_pu_bacteria 2958179912 2958184888 329
210 iso_pu_bacteria 2961077736 2961083055 329
211 iso_pu_bacteria 2961114664 2961119894 329
212 iso_pu_bacteria 2961127735 2961132619 329
213 iso_pu_bacteria 2961163497 2961164200 329
214 iso_pu_bacteria 2961170736 2961176137 329
215 iso_pu_bacteria 2961183825 2961190522 329
216 iso_pu_bacteria 2963644680 2963649948 329
217 iso_pu_bacteria 2965018300 2965019189 329
218 iso_pu_bacteria 2965025482 2965027009 329
219 iso_pu_bacteria 2965040258 2965045881 329
220 iso_pu_bacteria 2965047637 2965048871 329
221 iso_pu_bacteria 2965102966 2965106955 329
222 iso_pu_bacteria 2965110997 2965111511 329
223 iso_pu_bacteria 2967996073 2968002024 329
224 iso_pu_bacteria 2968003550 2968008952 329
225 iso_pu_bacteria 2968083720 2968086741 329
226 iso_pu_bacteria 2968110612 2968116251 329
227 iso_pu_bacteria 2968117919 2968119852 329
228 iso_pu_bacteria 2968171901 2968172600 329
229 iso_pu_bacteria 2970489779 2970491872 329
230 iso_pu_bacteria 2970503327 2970508803 329
231 iso_pu_bacteria 2970510686 2970514710 329
232 iso_pu_bacteria 2970532167 2970538561 329
233 iso_pu_bacteria 2970547951 2970549749 329
234 iso_pu_bacteria 2970554993 2970555693 329
235 iso_pu_bacteria 2970619444 2970626417 329
236 iso_pu_bacteria 2970627176 2970628633 329
237 iso_pu_bacteria 2977821940 2977827325 329
238 iso_pu_bacteria 2977828996 2977836595 329
239 iso_pu_bacteria 2977843712 2977845878 329
240 iso_pu_bacteria 2977851361 2977855682 329
241 iso_pu_bacteria 2977872689 2977873274 329
242 iso_pu_bacteria 2977915119 2977919550 329
243 iso_pu_bacteria 2977922695 2977927986 329
244 iso_pu_bacteria 2977935797 2977941162 329
245 iso_pu_bacteria 2977942078 2977942650 329
246 iso_pu_bacteria 2977950692 2977952659 329
247 iso_pu_bacteria 2977957713 2977960403 329
248 iso_pu_bacteria 2977971508 2977974373 329
249 iso_pu_bacteria 2977986579 2977991678 329
250 iso_pu_bacteria 2979710463 2979717578 329
251 iso_pu_bacteria 2979793036 2979797486 329
252 iso_pu_bacteria 2979808191 2979811549 329
253 iso_pu_bacteria 2987636660 2987638439 329
254 iso_pu_bacteria 2987645492 2987648049 329
255 iso_pu_bacteria 2987652177 2987654550 329
256 iso_pu_bacteria 2987659509 2987660206 329
257 iso_pu_bacteria 2987666974 2987667924 329
258 iso_pu_bacteria 2987673487 2987675238 329
259 iso_pu_bacteria 2996310559 2996315596 329
260 iso_pu_bacteria 2996386984 2996391263 329
261 iso_pu_bacteria 3004167301 3004171488 329
262 iso_pu_bacteria 3004188549 3004189255 329
263 iso_pu_bacteria 3004195979 3004200309 329
264 iso_pu_bacteria 3004203850 3004205318 329
265 iso_pu_bacteria 3004211236 3004213630 329
266 iso_pu_bacteria 3004218560 3004223221 329
267 iso_pu_bacteria 3004232784 3004239098 329
268 iso_pu_bacteria 3004268573 3004270282 329
269 iso_pu_bacteria 3004334049 3004338799 329
270 iso_pu_bacteria 3005409236 3005414026 329
271 iso_pu_bacteria 637000159 637079047 329
272 iso_pu_bacteria 649633066 649875067 329
273 iso_pu_bacteria 8004300914 8004303614 329
274 iso_pu_bacteria 8004312739 8004316541 329
275 iso_pu_bacteria 8004361976 8004365937 329
276 iso_pu_bacteria 8004374579 8004380306 329
277 iso_pu_bacteria 8004387939 8004393738 329
278 iso_pu_bacteria 8004640170 8004640938 329
279 iso_pu_bacteria 8004695233 8004696790 329
280 iso_pu_bacteria 8004714634 8004720506 329
281 iso_pu_bacteria 8004727605 8004733787 329
282 iso_pu_bacteria 8005658619 8005662100 329
283 iso_pu_bacteria 2510917026 2511168542 330
284 iso_pu_bacteria 2510917030 2511196475 330
285 iso_pu_bacteria 2558860983 2561467724 330
286 iso_pu_bacteria 2582581283 2585169666 330
287 iso_pu_bacteria 2582581294 2585202817 330
288 iso_pu_bacteria 2582581298 2585221686 330
289 iso_pu_bacteria 2585427529 2585544144 330
290 iso_pu_bacteria 2585427633 2585992470 330
291 iso_pu_bacteria 2585427634 2586003222 330
292 iso_pu_bacteria 2599185352 2600197970 330
293 iso_pu_bacteria 2643221618 2644110444 330
294 iso_pu_bacteria 2643221623 2644130503 330
295 iso_pu_bacteria 2643221626 2644144979 330
296 iso_pu_bacteria 2643221643 2644242032 330
297 iso_pu_bacteria 2643221655 2644307196 330
298 iso_pu_bacteria 2643221659 2644337080 330
299 iso_pu_bacteria 2643221689 2644499524 330
300 iso_pu_bacteria 2643221698 2644540596 330
301 iso_pu_bacteria 2643221712 2644613276 330
302 iso_pu_bacteria 2657244999 2657686009 330
303 iso_pu_bacteria 2738543024 2739310166 330
304 iso_pu_bacteria 2751185821 2753463195 330
305 iso_pu_bacteria 2791355082 2792584777 330
306 iso_pu_bacteria 2802429268 2804755285 330
307 iso_pu_bacteria 2838074704 2838075889 330
308 iso_pu_bacteria 2844163670 2844167870 330
309 iso_pu_bacteria 2847417321 2847422123 330
310 iso_pu_bacteria 2848992105 2848998381 330
311 iso_pu_bacteria 2855872281 2855875566 330
312 iso_pu_bacteria 2896384573 2896388332 330
313 iso_pu_bacteria 2913295892 2913296006 330
314 iso_pu_bacteria 2913295892 2913296548 330
315 iso_pu_bacteria 2919100787 2919103360 330
316 iso_pu_bacteria 2919171160 2919174189 330
317 iso_pu_bacteria 2920760137 2920764440 330
318 iso_pu_bacteria 2920822456 2920828036 330
319 iso_pu_bacteria 2941499720 2941503025 330
320 iso_pu_bacteria 2989349275 2989351860 330
321 iso_pu_bacteria 2989771324 2989773094 330
322 iso_pu_bacteria 3005445848 3005451527 330
323 iso_pu_bacteria 643692032 643823970 330
324 iso_pu_bacteria 8049293176 8049297893 330
325 iso_pu_bacteria 8054558443 8054561603 330
326 3300025901 Ga0207688_10033070 Ga0207688_100330703 331
327 3300053155 Ga0500620_000018 Ga0500620_000018_21023_22072 332
328 iso_pu_bacteria 2885305155 2885309326 332
329 iso_pu_bacteria 2885326080 2885328727 332
330 iso_pu_bacteria 2888350351 2888355652 332
331 iso_pu_bacteria 2906354277 2906355485 332
332 iso_pu_bacteria 2922130491 2922135742 332
333 iso_pu_bacteria 2922185730 2922191286 332
334 3300003316 rootH1_10061295 rootH1_100612952 333
335 3300005577 Ga0068857_100059870 Ga0068857_1000598703 333
336 3300005616 Ga0068852_100070158 Ga0068852_1000701583 333
337 3300005983 Ga0081540_1010250 Ga0081540_10102507 333
338 3300006051 Ga0075364_10001924 Ga0075364_100019246 333
339 3300006051 Ga0075364_10091320 Ga0075364_100913202 333
340 3300006178 Ga0075367_10001150 Ga0075367_100011505 333
341 3300006178 Ga0075367_10008246 Ga0075367_100082467 333
342 3300006186 Ga0075369_10045840 Ga0075369_100458402 333
343 3300009093 Ga0105240_10058545 Ga0105240_100585452 333
344 3300009093 Ga0105240_10079788 Ga0105240_100797882 333
345 3300009093 Ga0105240_10122032 Ga0105240_101220323 333
346 3300009545 Ga0105237_10322003 Ga0105237_103220032 333
347 3300009551 Ga0105238_10007244 Ga0105238_1000724412 333
348 3300013104 Ga0157370_10080624 Ga0157370_100806242 333
349 3300025246 Ga0209646_1010392 Ga0209646_10103922 333
350 3300025250 Ga0209026_1000025 Ga0209026_100002530 333
351 3300025256 Ga0209759_1000197 Ga0209759_10001973 333
352 3300025261 Ga0209233_1000010 Ga0209233_1000010397 333
353 3300025297 Ga0209758_1001361 Ga0209758_100136124 333
354 3300025904 Ga0207647_10004710 Ga0207647_1000471010 333
355 3300025904 Ga0207647_10041929 Ga0207647_100419292 333
356 3300025909 Ga0207705_10048791 Ga0207705_100487912 333
357 3300025913 Ga0207695_10063883 Ga0207695_100638835 333
358 3300025914 Ga0207671_10005869 Ga0207671_100058691 333
359 3300025924 Ga0207694_10003375 Ga0207694_1000337510 333
360 3300026041 Ga0207639_10010731 Ga0207639_100107312 333
361 3300031548 Ga0307408_100155278 Ga0307408_1001552782 333
362 3300031731 Ga0307405_10310451 Ga0307405_103104511 333
363 3300031852 Ga0307410_10237231 Ga0307410_102372312 333
364 3300031911 Ga0307412_10153919 Ga0307412_101539192 333
365 3300046810 Ga0495660_0036677 Ga0495660_0036677_1196_2248 333
366 3300048091 Ga0495626_0064298 Ga0495626_0064298_395_1447 333
367 3300048909 Ga0496106_0145093 Ga0496106_0145093_456_1532 333
368 3300048922 Ga0496119_0055029 Ga0496119_0055029_554_1606 333
369 3300048923 Ga0496120_0009699 Ga0496120_0009699_4374_5426 333
370 3300048924 Ga0496121_0069792 Ga0496121_0069792_994_2061 333
371 3300048924 Ga0496121_0071388 Ga0496121_0071388_1113_2180 333
372 3300048924 Ga0496121_0159272 Ga0496121_0159272_193_1245 333
373 3300048927 Ga0496124_0267334 Ga0496124_0267334_76_1143 333
374 3300048928 Ga0496125_0052318 Ga0496125_0052318_190_1242 333
375 3300048928 Ga0496125_0077925 Ga0496125_0077925_558_1610 333
376 3300048929 Ga0496126_0200990 Ga0496126_0200990_521_1573 333
377 3300049568 Ga0501031_0000010 Ga0501031_0000010_62462_63514 333
378 3300049569 Ga0501032_0000023 Ga0501032_0000023_82922_83974 333
379 3300049570 Ga0501033_0000104 Ga0501033_0000104_17532_18584 333
380 3300049571 Ga0501034_0000116 Ga0501034_0000116_62469_63521 333
381 3300049572 Ga0501036_0000015 Ga0501036_0000015_62469_63521 333
382 3300049573 Ga0501037_0000023 Ga0501037_0000023_62569_63621 333
383 3300049574 Ga0501038_0000025 Ga0501038_0000025_62569_63621 333
384 3300049575 Ga0501039_0000037 Ga0501039_0000037_62469_63521 333
385 3300049576 Ga0501040_0006421 Ga0501040_0006421_1089_2141 333
386 3300049579 Ga0501043_0000070 Ga0501043_0000070_5905_6957 333
387 3300049581 Ga0501047_0002287 Ga0501047_0002287_1086_2138 333
388 3300049586 Ga0501070_0022526 Ga0501070_0022526_2068_3120 333
389 3300049822 Ga0501035_0000074 Ga0501035_0000074_62450_63502 333
390 3300049823 Ga0501044_0000069 Ga0501044_0000069_62454_63506 333
391 3300050490 nmdc:mga03n38_139717_c1 nmdc:mga03n38_139717_c1_25_1077 333
392 3300050490 nmdc:mga03n38_17700_c1 nmdc:mga03n38_17700_c1_567_1619 333
393 3300050492 nmdc:mga0yw44_2420_c1 nmdc:mga0yw44_2420_c1_6731_7783 333
394 3300050492 nmdc:mga0yw44_84656_c1 nmdc:mga0yw44_84656_c1_554_1606 333
395 3300050494 nmdc:mga06z11_1261_c1 nmdc:mga06z11_1261_c1_3968_5020 333
396 3300050494 nmdc:mga06z11_92708_c1 nmdc:mga06z11_92708_c1_544_1596 333
397 3300053083 Ga0495655_0008019 Ga0495655_0008019_494_1546 333
398 3300053099 Ga0500654_089420 Ga0500654_089420_82_1134 333
399 3300053151 Ga0500604_0018916 Ga0500604_0018916_187_1239 333
400 3300053177 Ga0500636_0000038 Ga0500636_0000038_15475_16527 333
401 3300002739 JGI25158J39367_1000347 JGI25158J39367_10003475 334
402 3300002773 JGI25152J39213_1005724 JGI25152J39213_10057243 334
403 3300002773 JGI25152J39213_1005868 JGI25152J39213_10058683 334
404 3300002987 JGI25159J45721_1000259 JGI25159J45721_100025926 334
405 3300003187 JGI25151J46595_10018172 JGI25151J46595_100181723 334
406 3300003215 JGI25153J46596_10012993 JGI25153J46596_100129933 334
407 3300003215 JGI25153J46596_10013350 JGI25153J46596_100133503 334
408 3300003215 JGI25153J46596_10030831 JGI25153J46596_100308312 334
409 3300003354 JGI25160J50197_1006181 JGI25160J50197_10061814 334
410 3300003374 JGI25161J50226_1000025 JGI25161J50226_100002570 334
411 3300003771 Ga0055526_1007836 Ga0055526_10078365 334
412 3300003775 Ga0055524_1000581 Ga0055524_10005815 334
413 3300003781 Ga0055536_1000467 Ga0055536_100046719 334
414 3300003794 Ga0055531_10020629 Ga0055531_100206293 334
415 3300004625 Ga0055543_1000021 Ga0055543_1000021125 334
416 3300005548 Ga0070665_100069048 Ga0070665_1000690483 334
417 3300006051 Ga0075364_10000018 Ga0075364_1000001845 334
418 3300013249 Ga0171463_1013 Ga0171463_101365 334
419 3300013306 Ga0163162_10140642 Ga0163162_101406423 334
420 3300021320 Ga0214544_1000130 Ga0214544_100013047 334
421 3300021321 Ga0214542_1000014 Ga0214542_100001458 334
422 3300021327 Ga0214543_1000146 Ga0214543_100014658 334
423 3300025208 Ga0209436_100044 Ga0209436_10004424 334
424 3300025245 Ga0207425_1000563 Ga0207425_10005635 334
425 3300025245 Ga0207425_1006512 Ga0207425_10065122 334
426 3300025245 Ga0207425_1014567 Ga0207425_10145671 334
427 3300025258 Ga0209129_1004815 Ga0209129_10048154 334
428 3300025258 Ga0209129_1006772 Ga0209129_10067723 334
429 3300025258 Ga0209129_1006906 Ga0209129_10069063 334
430 3300025284 Ga0209130_1000001 Ga0209130_1000001144 334
431 3300025294 Ga0209025_1002603 Ga0209025_10026033 334
432 3300025294 Ga0209025_1004543 Ga0209025_10045432 334
433 3300025294 Ga0209025_1012184 Ga0209025_10121844 334
434 3300025295 Ga0209564_1001278 Ga0209564_10012789 334
435 3300025295 Ga0209564_1028218 Ga0209564_10282182 334
436 3300025297 Ga0209758_1000115 Ga0209758_1000115141 334
437 3300025297 Ga0209758_1001669 Ga0209758_10016697 334
438 3300025297 Ga0209758_1001814 Ga0209758_10018147 334
439 3300025297 Ga0209758_1011938 Ga0209758_10119386 334
440 3300025299 Ga0209256_1000828 Ga0209256_100082836 334
441 3300025299 Ga0209256_1005449 Ga0209256_10054496 334
442 3300025302 Ga0207426_1000005 Ga0207426_1000005749 334
443 3300025304 Ga0209257_1001018 Ga0209257_10010186 334
444 3300028379 Ga0268266_10131420 Ga0268266_101314202 334
445 3300031901 Ga0307406_10031412 Ga0307406_100314122 334
446 3300031911 Ga0307412_10119793 Ga0307412_101197932 334
447 3300031995 Ga0307409_100122154 Ga0307409_1001221543 334
448 3300039450 Ga0436363_1371666 Ga0436363_1371666_63_1121 334
449 3300041413 Ga0439465_0017127 Ga0439465_0017127_949_1995 334
450 3300046507 Ga0495606_0042306 Ga0495606_0042306_533_1597 334
451 3300048909 Ga0496106_0000269 Ga0496106_0000269_2096_3142 334
452 3300048924 Ga0496121_0001905 Ga0496121_0001905_32275_33330 334
453 3300048926 Ga0496123_0013715 Ga0496123_0013715_4801_5868 334
454 3300048927 Ga0496124_0001598 Ga0496124_0001598_21426_22490 334
455 3300048927 Ga0496124_0030008 Ga0496124_0030008_846_1910 334
456 3300048927 Ga0496124_0041261 Ga0496124_0041261_525_1592 334
457 3300048928 Ga0496125_0115410 Ga0496125_0115410_854_1918 334
458 3300048929 Ga0496126_0000808 Ga0496126_0000808_10124_11188 334
459 3300048929 Ga0496126_0088806 Ga0496126_0088806_941_2005 334
460 3300049570 Ga0501033_0001071 Ga0501033_0001071_23619_24704 334
461 3300049571 Ga0501034_0001376 Ga0501034_0001376_31441_32526 334
462 3300049571 Ga0501034_0224409 Ga0501034_0224409_604_1770 334
463 3300049572 Ga0501036_0000366 Ga0501036_0000366_131_1216 334
464 3300049573 Ga0501037_0000029 Ga0501037_0000029_136584_137669 334
465 3300049574 Ga0501038_0001873 Ga0501038_0001873_18194_19279 334
466 3300049575 Ga0501039_0001165 Ga0501039_0001165_18194_19279 334
467 3300049579 Ga0501043_0001622 Ga0501043_0001622_18341_19426 334
468 3300049579 Ga0501043_0132008 Ga0501043_0132008_390_1436 334
469 3300049581 Ga0501047_0128770 Ga0501047_0128770_175_1260 334
470 3300049584 Ga0501068_0081947 Ga0501068_0081947_531_1577 334
471 3300049589 Ga0501073_0137351 Ga0501073_0137351_473_1519 334
472 3300049744 Ga0501083_0010111 Ga0501083_0010111_1785_2831 334
473 3300049822 Ga0501035_0000057 Ga0501035_0000057_134073_135158 334
474 3300049823 Ga0501044_0158202 Ga0501044_0158202_132_1217 334
475 3300050491 nmdc:mga00v17_510_c1 nmdc:mga00v17_510_c1_8374_9429 334
476 3300050492 nmdc:mga0yw44_17647_c1 nmdc:mga0yw44_17647_c1_1519_2625 334
477 3300050492 nmdc:mga0yw44_4168_c1 nmdc:mga0yw44_4168_c1_1381_2451 334
478 3300053134 Ga0500658_0024481 Ga0500658_0024481_157_1203 334
479 3300053139 Ga0500568_0000695 Ga0500568_0000695_9314_10360 334
480 3300053153 Ga0500616_0000104 Ga0500616_0000104_52485_53555 334
481 3300053160 Ga0500633_0019408 Ga0500633_0019408_157_1203 334
482 3300060353 Ga0501082_0452424 Ga0501082_0452424_17_1063 334
483 iso_pu_bacteria 2513237144 2513911661 334
484 iso_pu_bacteria 2643221557 2643806951 334
485 iso_pu_bacteria 2643221610 2644068095 334
486 iso_pu_bacteria 2643221668 2644380054 334
487 iso_pu_bacteria 2643221675 2644419003 334
488 iso_pu_bacteria 2643221680 2644452384 334
489 iso_pu_bacteria 2643221723 2644674728 334
490 iso_pu_bacteria 2643221726 2644688224 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00206

Lyase_1

Lyase

54

333

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fen-assembly1.cif.gz_D 3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2 0.9063 2 333
2fen-assembly1.cif.gz_A 3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2 0.9058 2 333
2fen-assembly1.cif.gz_D 3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2 0.8985 2 333
2fen-assembly1.cif.gz_A 3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2 0.898 2 333
2fel-assembly3.cif.gz_L 3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2 0.8979 2 333
ID Description Score Start End Superfamily
3c8tA01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9563 16 106 1.10.275.10
1q5nA01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9473 14 106 1.10.275.10
af_O42889_1_362_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9151 1 330 1.20.200.10
af_O42889_1_362_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.902 1 330 1.20.200.10
2fenB00 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.8996 2 333 1.20.200.10
ID Description Score Start End GO Terms
AF-A0A434I3B7-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.967 1 181 GO:0016853
AF-A0A434I3B7-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.9618 1 181 GO:0016853
AF-A0A520JS51-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.959 15 126 GO:0016853
AF-A0A527INF5-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.9532 1 221 GO:0016853
AF-A0A4Q3UIM3-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.9474 8 235 GO:0016853

Feature Viewer

pLDDT pTM Quality
85.45 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map