F453783

General Info

Members Datasets Scaffolds Average Seq Length
489 251 978 149

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10111690|Ga0163163_101116903
Length 161
Sequence MIAASQGRSGLMRHSKWLSLVCIPLVAIVAATAQQPKTFKTRLAPVPIDVSMQATIAGSGSVSAVLTGTKLAVTGAFEGLKSPATIAQIHKSPVRGVRGPNVLDLTVTRTDASSGTIAGAFDLTPIQIADLEKGRLYVQLHSEKAADGNLWGWLMPQENRR

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 4.91
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 34.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10111690 3300014325 Bacteria 2762
2 JGI24751J29686_10016144 3300002459 Bacteria 1541
3 Ga0065715_10027658 3300005293 Bacteria 1526
4 Ga0070658_10102119 3300005327 Bacteria 2371
5 Ga0070676_10677077 3300005328 Bacteria 751
6 Ga0070690_100330438 3300005330 Bacteria 1101
7 Ga0070670_100028346 3300005331 Bacteria 4820
8 Ga0070670_100206701 3300005331 Bacteria 1706
9 Ga0070670_100307768 3300005331 Bacteria 1387
10 Ga0070670_101118633 3300005331 Unclassified 719
11 Ga0068869_100993203 3300005334 Unclassified 730
12 Ga0068869_101135161 3300005334 Bacteria 685
13 Ga0070666_10022416 3300005335 Bacteria 4100
14 Ga0070666_10112647 3300005335 Bacteria 1882
15 Ga0070666_11212709 3300005335 Bacteria 562
16 Ga0070682_100147194 3300005337 Bacteria 1612
17 Ga0070682_100581862 3300005337 Bacteria 881
18 Ga0068868_100145542 3300005338 Bacteria 1948
19 Ga0068868_100835544 3300005338 Unclassified 833
20 Ga0068868_101370048 3300005338 Unclassified 659
21 Ga0070689_100019154 3300005340 Bacteria 5057
22 Ga0070689_100243811 3300005340 Bacteria 1481
23 Ga0070689_100486653 3300005340 Unclassified 1055
24 Ga0070689_101469391 3300005340 Unclassified 617
25 Ga0070691_10765553 3300005341 Unclassified 585
26 Ga0070687_100014681 3300005343 Bacteria 3524
27 Ga0070687_100087148 3300005343 Bacteria 1718
28 Ga0070687_100456053 3300005343 Unclassified 851
29 Ga0070692_10100063 3300005345 Bacteria 1588
30 Ga0070669_100015534 3300005353 Bacteria 5427
31 Ga0070669_100203082 3300005353 Bacteria 1560
32 Ga0070671_100005194 3300005355 Bacteria 10374
33 Ga0070674_100036282 3300005356 Bacteria 3308
34 Ga0070674_101613484 3300005356 Unclassified 585
35 Ga0070673_100077415 3300005364 Bacteria 2688
36 Ga0070673_100470645 3300005364 Bacteria 1133
37 Ga0070673_101038383 3300005364 Bacteria 764
38 Ga0070688_100013316 3300005365 Bacteria 4633
39 Ga0070659_101302973 3300005366 Bacteria 644
40 Ga0070667_100060089 3300005367 Bacteria 3217
41 Ga0070703_10131241 3300005406 Unclassified 920
42 Ga0070703_10254946 3300005406 Bacteria 713
43 Ga0070705_101303927 3300005440 Bacteria 602
44 Ga0070705_101348136 3300005440 Bacteria 593
45 Ga0070694_100868923 3300005444 Bacteria 743
46 Ga0070694_101255219 3300005444 Bacteria 622
47 Ga0070708_100716983 3300005445 Bacteria 941
48 Ga0070662_100030768 3300005457 Bacteria 3761
49 Ga0070662_100309156 3300005457 Bacteria 1286
50 Ga0070662_100899825 3300005457 Bacteria 755
51 Ga0070681_10095928 3300005458 Bacteria 2914
52 Ga0068867_100057824 3300005459 Bacteria 2872
53 Ga0068867_100308543 3300005459 Unclassified 1307
54 Ga0068867_100837871 3300005459 Unclassified 823
55 Ga0070685_10060726 3300005466 Bacteria 2211
56 Ga0070685_10344051 3300005466 Bacteria 1018
57 Ga0070706_100784854 3300005467 Bacteria 882
58 Ga0070706_100829963 3300005467 Unclassified 855
59 Ga0070707_100284811 3300005468 Bacteria 1606
60 Ga0070707_101080063 3300005468 Unclassified 768
61 Ga0070698_100234171 3300005471 Bacteria 1769
62 Ga0070698_100331539 3300005471 Bacteria 1453
63 Ga0070698_100367303 3300005471 Bacteria 1371
64 Ga0070698_100563696 3300005471 Bacteria 1079
65 Ga0070684_100457170 3300005535 Bacteria 1180
66 Ga0070697_100272080 3300005536 Bacteria 1452
67 Ga0068853_100912014 3300005539 Unclassified 844
68 Ga0070672_100137358 3300005543 Bacteria 2014
69 Ga0070686_100025022 3300005544 Bacteria 3585
70 Ga0070686_100413472 3300005544 Bacteria 1029
71 Ga0070686_100589242 3300005544 Bacteria 875
72 Ga0070695_100851258 3300005545 Bacteria 734
73 Ga0070695_101593787 3300005545 Bacteria 545
74 Ga0070696_100545519 3300005546 Unclassified 928
75 Ga0070696_100835153 3300005546 Unclassified 760
76 Ga0070696_101103446 3300005546 Bacteria 667
77 Ga0070693_100460811 3300005547 Bacteria 894
78 Ga0070665_100002710 3300005548 Bacteria 19212
79 Ga0070665_100118666 3300005548 Bacteria 2647
80 Ga0070704_100058677 3300005549 Bacteria 2742
81 Ga0070704_100116291 3300005549 Bacteria 2045
82 Ga0070704_101258422 3300005549 Unclassified 676
83 Ga0070704_102198509 3300005549 Bacteria 513
84 Ga0068857_100557175 3300005577 Bacteria 1080
85 Ga0068854_100030098 3300005578 Bacteria 3763
86 Ga0068854_101163092 3300005578 Bacteria 690
87 Ga0068856_100172687 3300005614 Unclassified 2174
88 Ga0070702_100305240 3300005615 Bacteria 1103
89 Ga0068859_100022539 3300005617 Bacteria 6316
90 Ga0068859_100046290 3300005617 Bacteria 4369
91 Ga0068864_100004558 3300005618 Bacteria 11376
92 Ga0068864_100027838 3300005618 Unclassified 4776
93 Ga0068864_100041635 3300005618 Bacteria 3929
94 Ga0068864_100603619 3300005618 Unclassified 1065
95 Ga0068866_10124733 3300005718 Bacteria 1456
96 Ga0068861_100087771 3300005719 Bacteria 2448
97 Ga0068861_100372540 3300005719 Bacteria 1259
98 Ga0068863_100013431 3300005841 Bacteria 7897
99 Ga0068863_100379097 3300005841 Unclassified 1381
100 Ga0068863_100987331 3300005841 Archaea 844
101 Ga0068858_100049489 3300005842 Bacteria 3892
102 Ga0068858_100085094 3300005842 Bacteria 2942
103 Ga0068858_100363262 3300005842 Bacteria 1388
104 Ga0068858_100583119 3300005842 Unclassified 1084
105 Ga0068858_101250049 3300005842 Unclassified 730
106 Ga0068860_100157012 3300005843 Bacteria 2193
107 Ga0068860_100303727 3300005843 Unclassified 1564
108 Ga0068860_101075223 3300005843 Unclassified 823
109 Ga0068860_101196229 3300005843 Unclassified 780
110 Ga0068860_101538006 3300005843 Bacteria 687
111 Ga0068860_101759941 3300005843 Unclassified 641
112 Ga0068862_100101264 3300005844 Bacteria 2520
113 Ga0068862_102079205 3300005844 Unclassified 579
114 Ga0068862_102476735 3300005844 Unclassified 531
115 Ga0081455_10095050 3300005937 Bacteria 2406
116 Ga0070716_100191569 3300006173 Bacteria 1351
117 Ga0097621_100007856 3300006237 Bacteria 7651
118 Ga0097621_100047789 3300006237 Bacteria 3468
119 Ga0097621_100556443 3300006237 Unclassified 1044
120 Ga0097621_100761281 3300006237 Unclassified 895
121 Ga0068871_100123005 3300006358 Bacteria 2194
122 Ga0068871_100804057 3300006358 Unclassified 867
123 Ga0068871_101121014 3300006358 Unclassified 736
124 Ga0075428_100012673 3300006844 Bacteria 9375
125 Ga0075428_100120842 3300006844 Unclassified 2852
126 Ga0075428_100132333 3300006844 Bacteria 2712
127 Ga0075428_100162082 3300006844 Bacteria 2427
128 Ga0075428_100583991 3300006844 Bacteria 1194
129 Ga0075428_100793595 3300006844 Bacteria 1007
130 Ga0075430_100001254 3300006846 Bacteria 20438
131 Ga0075430_100102927 3300006846 Bacteria 2384
132 Ga0075431_100000840 3300006847 Bacteria 26878
133 Ga0075431_100005175 3300006847 Bacteria 12844
134 Ga0075431_100613178 3300006847 Bacteria 1071
135 Ga0075431_100641772 3300006847 Bacteria 1043
136 Ga0075433_10218326 3300006852 Unclassified 1694
137 Ga0075433_10308762 3300006852 Unclassified 1400
138 Ga0075433_10793558 3300006852 Unclassified 827
139 Ga0075433_10997163 3300006852 Bacteria 730
140 Ga0075434_100001676 3300006871 Bacteria 18914
141 Ga0075434_100046322 3300006871 Bacteria 4315
142 Ga0075434_100091888 3300006871 Bacteria 3037
143 Ga0075434_100092047 3300006871 Bacteria 3034
144 Ga0075434_100157610 3300006871 Bacteria 2289
145 Ga0075434_101553625 3300006871 Unclassified 671
146 Ga0075429_100004178 3300006880 Bacteria 12364
147 Ga0075429_100109225 3300006880 Bacteria 2418
148 Ga0068865_100015216 3300006881 Bacteria 4903
149 Ga0068865_100368658 3300006881 Unclassified 1168
150 Ga0075436_100003173 3300006914 Bacteria 11279
151 Ga0075436_100069971 3300006914 Bacteria 2425
152 Ga0075436_100079652 3300006914 Bacteria 2269
153 Ga0075436_100188920 3300006914 Unclassified 1457
154 Ga0075436_100334037 3300006914 Unclassified 1090
155 Ga0075436_100344160 3300006914 Bacteria 1074
156 Ga0075436_100520284 3300006914 Bacteria 872
157 Ga0097620_100022539 3300006931 Bacteria 6316
158 Ga0097620_100046288 3300006931 Bacteria 4369
159 Ga0075435_100000462 3300007076 Bacteria 24787
160 Ga0075435_100001057 3300007076 Bacteria 17470
161 Ga0075435_100185916 3300007076 Bacteria 1757
162 Ga0105240_10158823 3300009093 Bacteria 2687
163 Ga0105240_10224640 3300009093 Bacteria 2185
164 Ga0105240_11376583 3300009093 Bacteria 742
165 Ga0111539_10015851 3300009094 Bacteria 9362
166 Ga0111539_10165335 3300009094 Bacteria 2587
167 Ga0111539_10454616 3300009094 Unclassified 1491
168 Ga0111539_10616235 3300009094 Unclassified 1264
169 Ga0111539_11009990 3300009094 Bacteria 967
170 Ga0105245_10006383 3300009098 Bacteria 10373
171 Ga0105245_10541677 3300009098 Bacteria 1185
172 Ga0105245_11827570 3300009098 Bacteria 660
173 Ga0105245_12290510 3300009098 Unclassified 594
174 Ga0105247_10006853 3300009101 Bacteria 7021
175 Ga0105247_10333416 3300009101 Unclassified 1062
176 Ga0105247_10382717 3300009101 Unclassified 998
177 Ga0114129_10006332 3300009147 Bacteria 16787
178 Ga0114129_10048117 3300009147 Bacteria 5992
179 Ga0114129_10100580 3300009147 Unclassified 4001
180 Ga0114129_10111472 3300009147 Bacteria 3775
181 Ga0114129_10177599 3300009147 Bacteria 2899
182 Ga0114129_10189492 3300009147 Bacteria 2794
183 Ga0114129_10782409 3300009147 Bacteria 1219
184 Ga0114129_11123637 3300009147 Unclassified 983
185 Ga0114129_11343849 3300009147 Unclassified 884
186 Ga0114129_12214998 3300009147 Unclassified 661
187 Ga0105243_10425677 3300009148 Unclassified 1239
188 Ga0105243_10910760 3300009148 Unclassified 875
189 Ga0105241_10127379 3300009174 Bacteria 2057
190 Ga0105241_10550209 3300009174 Unclassified 1036
191 Ga0105242_10041568 3300009176 Bacteria 3708
192 Ga0105242_10840452 3300009176 Bacteria 913
193 Ga0105242_10881602 3300009176 Bacteria 893
194 Ga0105242_11095935 3300009176 Unclassified 810
195 Ga0105248_10001169 3300009177 Bacteria 29323
196 Ga0105248_10006522 3300009177 Bacteria 12793
197 Ga0105248_10081660 3300009177 Bacteria 3634
198 Ga0105248_10275162 3300009177 Unclassified 1896
199 Ga0105248_10492464 3300009177 Bacteria 1382
200 Ga0105237_10217962 3300009545 Bacteria 1908
201 Ga0105249_10336859 3300009553 Archaea 1524
202 Ga0105249_11228575 3300009553 Unclassified 821
203 Ga0105239_10567473 3300010375 Bacteria 1293
204 Ga0105246_10270170 3300011119 Bacteria 1359
205 Ga0105246_11483005 3300011119 Unclassified 636
206 Ga0157324_1000876 3300012506 Bacteria 1532
207 Ga0157370_10538618 3300013104 Bacteria 1071
208 Ga0157369_11075101 3300013105 Bacteria 823
209 Ga0157374_10013781 3300013296 Bacteria 7062
210 Ga0157378_10141929 3300013297 Bacteria 2231
211 Ga0157378_10259323 3300013297 Bacteria 1667
212 Ga0163162_10207631 3300013306 Bacteria 2088
213 Ga0163162_10260302 3300013306 Bacteria 1867
214 Ga0163162_11565867 3300013306 Bacteria 751
215 Ga0157375_10050736 3300013308 Bacteria 4071
216 Ga0157375_10733251 3300013308 Unclassified 1140
217 Ga0157375_12479086 3300013308 Unclassified 619
218 Ga0163163_10107034 3300014325 Bacteria 2822
219 Ga0163163_10291718 3300014325 Bacteria 1683
220 Ga0157380_10035308 3300014326 Unclassified 3861
221 Ga0157380_10061848 3300014326 Bacteria 2997
222 Ga0157380_10077787 3300014326 Bacteria 2705
223 Ga0157380_11002681 3300014326 Bacteria 869
224 Ga0157377_10047659 3300014745 Bacteria 2401
225 Ga0157379_10028747 3300014968 Bacteria 4944
226 Ga0157379_10033413 3300014968 Bacteria 4588
227 Ga0157379_10136544 3300014968 Bacteria 2209
228 Ga0157379_10627501 3300014968 Bacteria 1005
229 Ga0157379_10855028 3300014968 Bacteria 861
230 Ga0157376_10014768 3300014969 Bacteria 5875
231 Ga0157376_10060656 3300014969 Unclassified 3177
232 Ga0157376_10548279 3300014969 Unclassified 1144
233 Ga0157376_10847708 3300014969 Unclassified 929
234 Ga0163161_10269913 3300017792 Bacteria 1331
235 Ga0207653_10057938 3300025885 Unclassified 1301
236 Ga0207682_10608041 3300025893 Unclassified 515
237 Ga0207642_10138821 3300025899 Unclassified 1279
238 Ga0207642_10348297 3300025899 Bacteria 873
239 Ga0207688_10361870 3300025901 Bacteria 895
240 Ga0207680_10047446 3300025903 Bacteria 2545
241 Ga0207680_10123738 3300025903 Bacteria 1695
242 Ga0207643_10066071 3300025908 Bacteria 2073
243 Ga0207654_10256982 3300025911 Bacteria 1173
244 Ga0207707_10334629 3300025912 Bacteria 1306
245 Ga0207695_10462648 3300025913 Unclassified 1151
246 Ga0207660_10588894 3300025917 Bacteria 906
247 Ga0207662_10016283 3300025918 Bacteria 4193
248 Ga0207662_10336852 3300025918 Bacteria 1010
249 Ga0207649_10113068 3300025920 Bacteria 1818
250 Ga0207681_10006360 3300025923 Bacteria 7252
251 Ga0207681_10148684 3300025923 Bacteria 1753
252 Ga0207681_10340618 3300025923 Bacteria 1198
253 Ga0207650_10038135 3300025925 Bacteria 3507
254 Ga0207650_10719595 3300025925 Bacteria 844
255 Ga0207650_11029077 3300025925 Bacteria 701
256 Ga0207687_10440462 3300025927 Bacteria 1079
257 Ga0207687_10451853 3300025927 Unclassified 1066
258 Ga0207644_10007372 3300025931 Bacteria 7165
259 Ga0207644_11047261 3300025931 Bacteria 685
260 Ga0207690_11238144 3300025932 Unclassified 623
261 Ga0207706_10039106 3300025933 Bacteria 4206
262 Ga0207706_10039518 3300025933 Bacteria 4184
263 Ga0207706_10343610 3300025933 Bacteria 1298
264 Ga0207686_10034546 3300025934 Bacteria 3027
265 Ga0207686_10117400 3300025934 Bacteria 1805
266 Ga0207686_10514286 3300025934 Bacteria 931
267 Ga0207709_10617034 3300025935 Unclassified 860
268 Ga0207670_10108344 3300025936 Bacteria 1997
269 Ga0207669_10940313 3300025937 Bacteria 724
270 Ga0207704_10012982 3300025938 Bacteria 4153
271 Ga0207704_10261021 3300025938 Unclassified 1306
272 Ga0207665_10842078 3300025939 Bacteria 726
273 Ga0207691_10039727 3300025940 Bacteria 4352
274 Ga0207711_10059894 3300025941 Bacteria 3279
275 Ga0207711_10134275 3300025941 Unclassified 2221
276 Ga0207711_10224063 3300025941 Bacteria 1721
277 Ga0207711_10287521 3300025941 Unclassified 1515
278 Ga0207711_10483502 3300025941 Bacteria 1154
279 Ga0207689_10170564 3300025942 Bacteria 1793
280 Ga0207689_10814418 3300025942 Unclassified 788
281 Ga0207679_10022404 3300025945 Unclassified 4301
282 Ga0207651_10045971 3300025960 Bacteria 2932
283 Ga0207651_10088625 3300025960 Bacteria 2256
284 Ga0207712_10139661 3300025961 Archaea 1857
285 Ga0207640_10004920 3300025981 Bacteria 7256
286 Ga0207640_11460273 3300025981 Bacteria 614
287 Ga0207658_10693296 3300025986 Unclassified 920
288 Ga0207677_10025800 3300026023 Bacteria 3673
289 Ga0207703_10023023 3300026035 Unclassified 4891
290 Ga0207703_10027393 3300026035 Bacteria 4489
291 Ga0207703_12009107 3300026035 Unclassified 554
292 Ga0207708_10182176 3300026075 Unclassified 1668
293 Ga0207641_10000519 3300026088 Bacteria 43225
294 Ga0207641_11008485 3300026088 Archaea 829
295 Ga0207648_10074741 3300026089 Bacteria 2953
296 Ga0207648_10209973 3300026089 Bacteria 1728
297 Ga0207648_10259141 3300026089 Bacteria 1551
298 Ga0207676_10029650 3300026095 Bacteria 4099
299 Ga0207676_10126375 3300026095 Unclassified 2166
300 Ga0207676_10226664 3300026095 Unclassified 1668
301 Ga0207674_10317194 3300026116 Bacteria 1508
302 Ga0207674_10456529 3300026116 Unclassified 1235
303 Ga0207674_10669492 3300026116 Bacteria 1002
304 Ga0207675_100050576 3300026118 Bacteria 3878
305 Ga0207675_100134623 3300026118 Bacteria 2344
306 Ga0207675_100715837 3300026118 Bacteria 1011
307 Ga0207683_11386643 3300026121 Unclassified 650
308 Ga0207428_10605088 3300027907 Unclassified 789
309 Ga0268266_10004990 3300028379 Bacteria 12544
310 Ga0268266_10065639 3300028379 Bacteria 3137
311 Ga0268265_10262123 3300028380 Bacteria 1537
312 Ga0268264_10189188 3300028381 Bacteria 1875
313 Ga0268264_10242030 3300028381 Bacteria 1672
314 Ga0268264_11025433 3300028381 Bacteria 832
315 Ga0268264_11050419 3300028381 Unclassified 822
316 Ga0268264_11997369 3300028381 Unclassified 589
317 Ga0307408_100953492 3300031548 Unclassified 788
318 Ga0307408_101579037 3300031548 Bacteria 622
319 Ga0307405_10030485 3300031731 Bacteria 3163
320 Ga0307413_10303769 3300031824 Bacteria 1211
321 Ga0307406_11501607 3300031901 Unclassified 593
322 Ga0307409_100690445 3300031995 Bacteria 1019
323 Ga0307409_100987777 3300031995 Unclassified 859
324 Ga0307416_100044763 3300032002 Bacteria 3478
325 Ga0307414_10298335 3300032004 Bacteria 1362
326 Ga0307415_101526701 3300032126 Unclassified 640
327 Ga0373930_0001505 3300034816 Bacteria 3484
328 Ga0373948_0021344 3300034817 Bacteria 1239
329 Ga0373959_0001079 3300034820 Bacteria 4471
330 Ga0373938_0002663 3300034957 Bacteria 2884
331 Ga0373928_0003882 3300035084 Bacteria 2853
332 Ga0373949_0001731 3300035090 Bacteria 6035
333 Ga0373949_0156002 3300035090 Bacteria 663
334 Ga0373951_0000806 3300035091 Bacteria 8545
335 Ga0373952_0000775 3300035092 Bacteria 5746
336 Ga0373952_0037363 3300035092 Unclassified 1108
337 Ga0373923_0471237 3300035111 Unclassified 610
338 Ga0373932_0001042 3300035112 Bacteria 7989
339 Ga0373932_0084637 3300035112 Unclassified 1008
340 Ga0373936_0298912 3300035113 Unclassified 726
341 Ga0373939_0000727 3300035114 Bacteria 8153
342 Ga0373945_0341558 3300035116 Unclassified 648
343 Ga0373953_0218604 3300035117 Unclassified 825
344 Ga0373954_0170469 3300035118 Unclassified 1066
345 Ga0373956_0202049 3300035119 Unclassified 942
346 Ga0373957_0237665 3300035120 Unclassified 765
347 Ga0373960_0000702 3300035121 Bacteria 6948
348 Ga0373946_0475744 3300035171 Unclassified 638
349 Ga0373955_0112411 3300035172 Bacteria 1576
350 Ga0373942_0002545 3300035207 Bacteria 4410
351 Ga0373961_0001777 3300035241 Bacteria 5949
352 Ga0373961_0095179 3300035241 Unclassified 957
353 Ga0373962_0002114 3300035242 Bacteria 4744
354 Ga0373931_0619801 3300035691 Unclassified 709
355 Ga0373947_0148180 3300035725 Unclassified 1510
356 Ga0373937_0097398 3300036401 Bacteria 2728
357 Ga0373937_0580183 3300036401 Bacteria 1065
358 Ga0373925_0393904 3300037068 Unclassified 1129
359 Ga0373925_0450360 3300037068 Unclassified 1054
360 Ga0439443_107431 3300042003 Bacteria 539
361 Ga0451576_0796411 3300045051 Unclassified 992
362 Ga0451576_0834306 3300045051 Unclassified 968
363 Ga0495603_0074125 3300046455 Bacteria 1999
364 Ga0495629_0126014 3300046459 Bacteria 1784
365 Ga0495641_0269737 3300046461 Unclassified 766
366 Ga0495582_0312883 3300046473 Unclassified 903
367 Ga0495639_0273180 3300046475 Bacteria 839
368 Ga0495664_0146911 3300046477 Unclassified 1430
369 Ga0495594_0490100 3300046499 Unclassified 698
370 Ga0495608_0591917 3300046511 Unclassified 666
371 Ga0495642_0446181 3300046528 Bacteria 572
372 Ga0495640_0102498 3300046533 Bacteria 1878
373 Ga0495586_0187816 3300046535 Unclassified 1170
374 Ga0495586_0458010 3300046535 Unclassified 735
375 Ga0495645_0101827 3300046543 Bacteria 2041
376 Ga0495633_0531489 3300046558 Unclassified 530
377 Ga0495667_0806070 3300046559 Unclassified 579
378 Ga0495611_0573597 3300046648 Bacteria 510
379 Ga0495635_0184329 3300046663 Unclassified 1418
380 Ga0495635_0588426 3300046663 Bacteria 727
381 Ga0495659_0033878 3300046664 Bacteria 1794
382 Ga0495588_0253436 3300046674 Bacteria 928
383 Ga0495647_0098133 3300046681 Bacteria 1210
384 Ga0495647_0113359 3300046681 Unclassified 1134
385 Ga0495647_0200064 3300046681 Unclassified 876
386 Ga0495658_0202468 3300046683 Unclassified 1238
387 Ga0495658_0375036 3300046683 Unclassified 905
388 Ga0495613_0233216 3300046689 Bacteria 1289
389 Ga0495624_0493205 3300046690 Unclassified 733
390 Ga0495624_0499105 3300046690 Unclassified 728
391 Ga0495600_0267201 3300046809 Bacteria 1085
392 Ga0495581_0383541 3300047315 Unclassified 820
393 Ga0495674_0352262 3300047319 Bacteria 1195
394 Ga0495672_0477119 3300047320 Unclassified 558
395 Ga0495684_0130421 3300047471 Bacteria 1888
396 Ga0495593_0337624 3300047673 Unclassified 753
397 Ga0495614_0490404 3300048089 Unclassified 584
398 Ga0496102_0441666 3300048905 Unclassified 1221
399 Ga0496103_0517173 3300048906 Unclassified 763
400 Ga0496104_0182653 3300048907 Unclassified 2008
401 Ga0496104_0329850 3300048907 Unclassified 1439
402 Ga0496104_1163231 3300048907 Unclassified 675
403 Ga0496106_0245499 3300048909 Bacteria 1431
404 Ga0496106_0255607 3300048909 Bacteria 1401
405 Ga0496106_0274608 3300048909 Bacteria 1350
406 Ga0496108_0122581 3300048911 Bacteria 2230
407 Ga0496109_0368582 3300048912 Bacteria 1357
408 Ga0496109_2008525 3300048912 Unclassified 510
409 Ga0496110_0201961 3300048913 Bacteria 1806
410 Ga0496110_0347529 3300048913 Unclassified 1351
411 Ga0496111_0142601 3300048914 Unclassified 1776
412 Ga0496112_0921618 3300048915 Bacteria 795
413 Ga0496112_1055027 3300048915 Bacteria 731
414 Ga0496113_0456779 3300048916 Bacteria 1026
415 Ga0496113_1466660 3300048916 Unclassified 527
416 Ga0496114_0174474 3300048917 Bacteria 1875
417 Ga0496114_0373967 3300048917 Bacteria 1261
418 Ga0496114_0645332 3300048917 Bacteria 931
419 Ga0496114_0712884 3300048917 Bacteria 879
420 Ga0496114_0983971 3300048917 Unclassified 726
421 Ga0496115_0688959 3300048918 Unclassified 804
422 Ga0501033_0210716 3300049570 Unclassified 1386
423 Ga0501037_0242972 3300049573 Unclassified 1262
424 Ga0501039_0030389 3300049575 Bacteria 4166
425 Ga0501042_0194397 3300049578 Unclassified 1463
426 Ga0501046_0046408 3300049580 Bacteria 3448
427 Ga0501048_0187200 3300049582 Unclassified 1467
428 Ga0501067_0767319 3300049583 Bacteria 543
429 Ga0501071_0074833 3300049587 Unclassified 2472
430 Ga0501072_0003557 3300049588 Bacteria 11727
431 Ga0501072_0578518 3300049588 Bacteria 886
432 Ga0501074_0355527 3300049590 Unclassified 1040
433 Ga0501075_0022514 3300049591 Unclassified 4603
434 Ga0501076_0012060 3300049592 Bacteria 6459
435 Ga0501077_0086714 3300049593 Unclassified 1984
436 Ga0501079_0062320 3300049741 Bacteria 2877
437 Ga0501080_0136038 3300049742 Bacteria 2274
438 Ga0501081_0221832 3300049743 Unclassified 1375
439 Ga0501081_1152537 3300049743 Unclassified 587
440 Ga0501283_087813 3300049779 Unclassified 592
441 Ga0501045_0699273 3300049824 Bacteria 748
442 nmdc:mga05p37_1465607_c1 3300050507 Unclassified 682
443 nmdc:mga05p37_197379_c1 3300050507 Unclassified 2439
444 nmdc:mga05p37_2004727_c1 3300050507 Unclassified 547
445 nmdc:mga05p37_222046_c1 3300050507 Unclassified 2280
446 nmdc:mga05p37_364172_c1 3300050507 Bacteria 1699
447 nmdc:mga05p37_6412_c1 3300050507 Bacteria 13868
448 nmdc:mga05p37_65907_c1 3300050507 Bacteria 4455
449 nmdc:mga05p37_682611_c1 3300050507 Bacteria 1144
450 nmdc:mga09592_1007212_c1 3300050508 Unclassified 696
451 nmdc:mga09592_11726_c1 3300050508 Bacteria 7129
452 nmdc:mga0qj67_14696_c1 3300050509 Bacteria 5919
453 nmdc:mga0qj67_47381_c1 3300050509 Bacteria 3395
454 nmdc:mga06r32_26823_c1 3300050510 Bacteria 5376
455 nmdc:mga06r32_5162_c1 3300050510 Bacteria 11734
456 nmdc:mga08y16_1028015_c1 3300050511 Unclassified 803
457 nmdc:mga08y16_1619723_c1 3300050511 Unclassified 605
458 nmdc:mga08y16_193665_c1 3300050511 Bacteria 2108
459 nmdc:mga08y16_450161_c1 3300050511 Unclassified 1313
460 nmdc:mga0n895_102745_c1 3300050512 Bacteria 2869
461 nmdc:mga0n895_140306_c1 3300050512 Bacteria 2445
462 nmdc:mga0n895_156951_c1 3300050512 Bacteria 2306
463 nmdc:mga0n895_337602_c1 3300050512 Bacteria 1526
464 nmdc:mga0n895_429268_c1 3300050512 Unclassified 1335
465 nmdc:mga0n895_433054_c1 3300050512 Unclassified 1329
466 nmdc:mga0n895_78_c1 3300050512 Bacteria 55918
467 nmdc:mga0n895_913083_c1 3300050512 Unclassified 863
468 nmdc:mga0rr50_220069_c1 3300050513 Unclassified 1567
469 nmdc:mga0rr50_387001_c1 3300050513 Unclassified 1180
470 nmdc:mga0rr50_560_c1 3300050513 Bacteria 19950
471 nmdc:mga0rr50_56139_c1 3300050513 Bacteria 2941
472 nmdc:mga0rr50_568982_c1 3300050513 Unclassified 965
473 nmdc:mga0rr50_6_c1 3300050513 Bacteria 310626
474 nmdc:mga08x19_402_c1 3300050514 Bacteria 30381
475 nmdc:mga08x19_438845_c1 3300050514 Bacteria 918
476 nmdc:mga08x19_695332_c1 3300050514 Bacteria 722
477 nmdc:mga08x19_795786_c1 3300050514 Bacteria 672
478 nmdc:mga0a205_179049_c1 3300050515 Bacteria 2014
479 nmdc:mga0a205_246448_c1 3300050515 Bacteria 1667
480 nmdc:mga0a205_3237_c1 3300050515 Bacteria 14478
481 Ga0495601_0019832 3300053077 Bacteria 4104
482 Ga0495601_0236113 3300053077 Unclassified 1194
483 Ga0495595_0070076 3300053084 Bacteria 1656
484 Ga0495619_0115104 3300053085 Bacteria 1840
485 Ga0495619_0657230 3300053085 Bacteria 715
486 Ga0500566_0174814 3300053094 Unclassified 1107
487 Ga0500658_0220876 3300053134 Bacteria 869
488 Ga0501082_1765467 3300060353 Unclassified 540
489 Ga0530510_0007307 3300061734 Bacteria 7686
490 Ga0163163_10111690
491 JGI24751J29686_10016144
492 Ga0065715_10027658
493 Ga0070658_10102119
494 Ga0070676_10677077
495 Ga0070690_100330438
496 Ga0070670_100028346
497 Ga0070670_100206701
498 Ga0070670_100307768
499 Ga0070670_101118633
500 Ga0068869_100993203
501 Ga0068869_101135161
502 Ga0070666_10022416
503 Ga0070666_10112647
504 Ga0070666_11212709
505 Ga0070682_100147194
506 Ga0070682_100581862
507 Ga0068868_100145542
508 Ga0068868_100835544
509 Ga0068868_101370048
510 Ga0070689_100019154
511 Ga0070689_100243811
512 Ga0070689_100486653
513 Ga0070689_101469391
514 Ga0070691_10765553
515 Ga0070687_100014681
516 Ga0070687_100087148
517 Ga0070687_100456053
518 Ga0070692_10100063
519 Ga0070669_100015534
520 Ga0070669_100203082
521 Ga0070671_100005194
522 Ga0070674_100036282
523 Ga0070674_101613484
524 Ga0070673_100077415
525 Ga0070673_100470645
526 Ga0070673_101038383
527 Ga0070688_100013316
528 Ga0070659_101302973
529 Ga0070667_100060089
530 Ga0070703_10131241
531 Ga0070703_10254946
532 Ga0070705_101303927
533 Ga0070705_101348136
534 Ga0070694_100868923
535 Ga0070694_101255219
536 Ga0070708_100716983
537 Ga0070662_100030768
538 Ga0070662_100309156
539 Ga0070662_100899825
540 Ga0070681_10095928
541 Ga0068867_100057824
542 Ga0068867_100308543
543 Ga0068867_100837871
544 Ga0070685_10060726
545 Ga0070685_10344051
546 Ga0070706_100784854
547 Ga0070706_100829963
548 Ga0070707_100284811
549 Ga0070707_101080063
550 Ga0070698_100234171
551 Ga0070698_100331539
552 Ga0070698_100367303
553 Ga0070698_100563696
554 Ga0070684_100457170
555 Ga0070697_100272080
556 Ga0068853_100912014
557 Ga0070672_100137358
558 Ga0070686_100025022
559 Ga0070686_100413472
560 Ga0070686_100589242
561 Ga0070695_100851258
562 Ga0070695_101593787
563 Ga0070696_100545519
564 Ga0070696_100835153
565 Ga0070696_101103446
566 Ga0070693_100460811
567 Ga0070665_100002710
568 Ga0070665_100118666
569 Ga0070704_100058677
570 Ga0070704_100116291
571 Ga0070704_101258422
572 Ga0070704_102198509
573 Ga0068857_100557175
574 Ga0068854_100030098
575 Ga0068854_101163092
576 Ga0068856_100172687
577 Ga0070702_100305240
578 Ga0068859_100022539
579 Ga0068859_100046290
580 Ga0068864_100004558
581 Ga0068864_100027838
582 Ga0068864_100041635
583 Ga0068864_100603619
584 Ga0068866_10124733
585 Ga0068861_100087771
586 Ga0068861_100372540
587 Ga0068863_100013431
588 Ga0068863_100379097
589 Ga0068863_100987331
590 Ga0068858_100049489
591 Ga0068858_100085094
592 Ga0068858_100363262
593 Ga0068858_100583119
594 Ga0068858_101250049
595 Ga0068860_100157012
596 Ga0068860_100303727
597 Ga0068860_101075223
598 Ga0068860_101196229
599 Ga0068860_101538006
600 Ga0068860_101759941
601 Ga0068862_100101264
602 Ga0068862_102079205
603 Ga0068862_102476735
604 Ga0081455_10095050
605 Ga0070716_100191569
606 Ga0097621_100007856
607 Ga0097621_100047789
608 Ga0097621_100556443
609 Ga0097621_100761281
610 Ga0068871_100123005
611 Ga0068871_100804057
612 Ga0068871_101121014
613 Ga0075428_100012673
614 Ga0075428_100120842
615 Ga0075428_100132333
616 Ga0075428_100162082
617 Ga0075428_100583991
618 Ga0075428_100793595
619 Ga0075430_100001254
620 Ga0075430_100102927
621 Ga0075431_100000840
622 Ga0075431_100005175
623 Ga0075431_100613178
624 Ga0075431_100641772
625 Ga0075433_10218326
626 Ga0075433_10308762
627 Ga0075433_10793558
628 Ga0075433_10997163
629 Ga0075434_100001676
630 Ga0075434_100046322
631 Ga0075434_100091888
632 Ga0075434_100092047
633 Ga0075434_100157610
634 Ga0075434_101553625
635 Ga0075429_100004178
636 Ga0075429_100109225
637 Ga0068865_100015216
638 Ga0068865_100368658
639 Ga0075436_100003173
640 Ga0075436_100069971
641 Ga0075436_100079652
642 Ga0075436_100188920
643 Ga0075436_100334037
644 Ga0075436_100344160
645 Ga0075436_100520284
646 Ga0097620_100022539
647 Ga0097620_100046288
648 Ga0075435_100000462
649 Ga0075435_100001057
650 Ga0075435_100185916
651 Ga0105240_10158823
652 Ga0105240_10224640
653 Ga0105240_11376583
654 Ga0111539_10015851
655 Ga0111539_10165335
656 Ga0111539_10454616
657 Ga0111539_10616235
658 Ga0111539_11009990
659 Ga0105245_10006383
660 Ga0105245_10541677
661 Ga0105245_11827570
662 Ga0105245_12290510
663 Ga0105247_10006853
664 Ga0105247_10333416
665 Ga0105247_10382717
666 Ga0114129_10006332
667 Ga0114129_10048117
668 Ga0114129_10100580
669 Ga0114129_10111472
670 Ga0114129_10177599
671 Ga0114129_10189492
672 Ga0114129_10782409
673 Ga0114129_11123637
674 Ga0114129_11343849
675 Ga0114129_12214998
676 Ga0105243_10425677
677 Ga0105243_10910760
678 Ga0105241_10127379
679 Ga0105241_10550209
680 Ga0105242_10041568
681 Ga0105242_10840452
682 Ga0105242_10881602
683 Ga0105242_11095935
684 Ga0105248_10001169
685 Ga0105248_10006522
686 Ga0105248_10081660
687 Ga0105248_10275162
688 Ga0105248_10492464
689 Ga0105237_10217962
690 Ga0105249_10336859
691 Ga0105249_11228575
692 Ga0105239_10567473
693 Ga0105246_10270170
694 Ga0105246_11483005
695 Ga0157324_1000876
696 Ga0157370_10538618
697 Ga0157369_11075101
698 Ga0157374_10013781
699 Ga0157378_10141929
700 Ga0157378_10259323
701 Ga0163162_10207631
702 Ga0163162_10260302
703 Ga0163162_11565867
704 Ga0157375_10050736
705 Ga0157375_10733251
706 Ga0157375_12479086
707 Ga0163163_10107034
708 Ga0163163_10291718
709 Ga0157380_10035308
710 Ga0157380_10061848
711 Ga0157380_10077787
712 Ga0157380_11002681
713 Ga0157377_10047659
714 Ga0157379_10028747
715 Ga0157379_10033413
716 Ga0157379_10136544
717 Ga0157379_10627501
718 Ga0157379_10855028
719 Ga0157376_10014768
720 Ga0157376_10060656
721 Ga0157376_10548279
722 Ga0157376_10847708
723 Ga0163161_10269913
724 Ga0207653_10057938
725 Ga0207682_10608041
726 Ga0207642_10138821
727 Ga0207642_10348297
728 Ga0207688_10361870
729 Ga0207680_10047446
730 Ga0207680_10123738
731 Ga0207643_10066071
732 Ga0207654_10256982
733 Ga0207707_10334629
734 Ga0207695_10462648
735 Ga0207660_10588894
736 Ga0207662_10016283
737 Ga0207662_10336852
738 Ga0207649_10113068
739 Ga0207681_10006360
740 Ga0207681_10148684
741 Ga0207681_10340618
742 Ga0207650_10038135
743 Ga0207650_10719595
744 Ga0207650_11029077
745 Ga0207687_10440462
746 Ga0207687_10451853
747 Ga0207644_10007372
748 Ga0207644_11047261
749 Ga0207690_11238144
750 Ga0207706_10039106
751 Ga0207706_10039518
752 Ga0207706_10343610
753 Ga0207686_10034546
754 Ga0207686_10117400
755 Ga0207686_10514286
756 Ga0207709_10617034
757 Ga0207670_10108344
758 Ga0207669_10940313
759 Ga0207704_10012982
760 Ga0207704_10261021
761 Ga0207665_10842078
762 Ga0207691_10039727
763 Ga0207711_10059894
764 Ga0207711_10134275
765 Ga0207711_10224063
766 Ga0207711_10287521
767 Ga0207711_10483502
768 Ga0207689_10170564
769 Ga0207689_10814418
770 Ga0207679_10022404
771 Ga0207651_10045971
772 Ga0207651_10088625
773 Ga0207712_10139661
774 Ga0207640_10004920
775 Ga0207640_11460273
776 Ga0207658_10693296
777 Ga0207677_10025800
778 Ga0207703_10023023
779 Ga0207703_10027393
780 Ga0207703_12009107
781 Ga0207708_10182176
782 Ga0207641_10000519
783 Ga0207641_11008485
784 Ga0207648_10074741
785 Ga0207648_10209973
786 Ga0207648_10259141
787 Ga0207676_10029650
788 Ga0207676_10126375
789 Ga0207676_10226664
790 Ga0207674_10317194
791 Ga0207674_10456529
792 Ga0207674_10669492
793 Ga0207675_100050576
794 Ga0207675_100134623
795 Ga0207675_100715837
796 Ga0207683_11386643
797 Ga0207428_10605088
798 Ga0268266_10004990
799 Ga0268266_10065639
800 Ga0268265_10262123
801 Ga0268264_10189188
802 Ga0268264_10242030
803 Ga0268264_11025433
804 Ga0268264_11050419
805 Ga0268264_11997369
806 Ga0307408_100953492
807 Ga0307408_101579037
808 Ga0307405_10030485
809 Ga0307413_10303769
810 Ga0307406_11501607
811 Ga0307409_100690445
812 Ga0307409_100987777
813 Ga0307416_100044763
814 Ga0307414_10298335
815 Ga0307415_101526701
816 Ga0373930_0001505
817 Ga0373948_0021344
818 Ga0373959_0001079
819 Ga0373938_0002663
820 Ga0373928_0003882
821 Ga0373949_0001731
822 Ga0373949_0156002
823 Ga0373951_0000806
824 Ga0373952_0000775
825 Ga0373952_0037363
826 Ga0373923_0471237
827 Ga0373932_0001042
828 Ga0373932_0084637
829 Ga0373936_0298912
830 Ga0373939_0000727
831 Ga0373945_0341558
832 Ga0373953_0218604
833 Ga0373954_0170469
834 Ga0373956_0202049
835 Ga0373957_0237665
836 Ga0373960_0000702
837 Ga0373946_0475744
838 Ga0373955_0112411
839 Ga0373942_0002545
840 Ga0373961_0001777
841 Ga0373961_0095179
842 Ga0373962_0002114
843 Ga0373931_0619801
844 Ga0373947_0148180
845 Ga0373937_0097398
846 Ga0373937_0580183
847 Ga0373925_0393904
848 Ga0373925_0450360
849 Ga0439443_107431
850 Ga0451576_0796411
851 Ga0451576_0834306
852 Ga0495603_0074125
853 Ga0495629_0126014
854 Ga0495641_0269737
855 Ga0495582_0312883
856 Ga0495639_0273180
857 Ga0495664_0146911
858 Ga0495594_0490100
859 Ga0495608_0591917
860 Ga0495642_0446181
861 Ga0495640_0102498
862 Ga0495586_0187816
863 Ga0495586_0458010
864 Ga0495645_0101827
865 Ga0495633_0531489
866 Ga0495667_0806070
867 Ga0495611_0573597
868 Ga0495635_0184329
869 Ga0495635_0588426
870 Ga0495659_0033878
871 Ga0495588_0253436
872 Ga0495647_0098133
873 Ga0495647_0113359
874 Ga0495647_0200064
875 Ga0495658_0202468
876 Ga0495658_0375036
877 Ga0495613_0233216
878 Ga0495624_0493205
879 Ga0495624_0499105
880 Ga0495600_0267201
881 Ga0495581_0383541
882 Ga0495674_0352262
883 Ga0495672_0477119
884 Ga0495684_0130421
885 Ga0495593_0337624
886 Ga0495614_0490404
887 Ga0496102_0441666
888 Ga0496103_0517173
889 Ga0496104_0182653
890 Ga0496104_0329850
891 Ga0496104_1163231
892 Ga0496106_0245499
893 Ga0496106_0255607
894 Ga0496106_0274608
895 Ga0496108_0122581
896 Ga0496109_0368582
897 Ga0496109_2008525
898 Ga0496110_0201961
899 Ga0496110_0347529
900 Ga0496111_0142601
901 Ga0496112_0921618
902 Ga0496112_1055027
903 Ga0496113_0456779
904 Ga0496113_1466660
905 Ga0496114_0174474
906 Ga0496114_0373967
907 Ga0496114_0645332
908 Ga0496114_0712884
909 Ga0496114_0983971
910 Ga0496115_0688959
911 Ga0501033_0210716
912 Ga0501037_0242972
913 Ga0501039_0030389
914 Ga0501042_0194397
915 Ga0501046_0046408
916 Ga0501048_0187200
917 Ga0501067_0767319
918 Ga0501071_0074833
919 Ga0501072_0003557
920 Ga0501072_0578518
921 Ga0501074_0355527
922 Ga0501075_0022514
923 Ga0501076_0012060
924 Ga0501077_0086714
925 Ga0501079_0062320
926 Ga0501080_0136038
927 Ga0501081_0221832
928 Ga0501081_1152537
929 Ga0501283_087813
930 Ga0501045_0699273
931 nmdc:mga05p37_1465607_c1
932 nmdc:mga05p37_197379_c1
933 nmdc:mga05p37_2004727_c1
934 nmdc:mga05p37_222046_c1
935 nmdc:mga05p37_364172_c1
936 nmdc:mga05p37_6412_c1
937 nmdc:mga05p37_65907_c1
938 nmdc:mga05p37_682611_c1
939 nmdc:mga09592_1007212_c1
940 nmdc:mga09592_11726_c1
941 nmdc:mga0qj67_14696_c1
942 nmdc:mga0qj67_47381_c1
943 nmdc:mga06r32_26823_c1
944 nmdc:mga06r32_5162_c1
945 nmdc:mga08y16_1028015_c1
946 nmdc:mga08y16_1619723_c1
947 nmdc:mga08y16_193665_c1
948 nmdc:mga08y16_450161_c1
949 nmdc:mga0n895_102745_c1
950 nmdc:mga0n895_140306_c1
951 nmdc:mga0n895_156951_c1
952 nmdc:mga0n895_337602_c1
953 nmdc:mga0n895_429268_c1
954 nmdc:mga0n895_433054_c1
955 nmdc:mga0n895_78_c1
956 nmdc:mga0n895_913083_c1
957 nmdc:mga0rr50_220069_c1
958 nmdc:mga0rr50_387001_c1
959 nmdc:mga0rr50_560_c1
960 nmdc:mga0rr50_56139_c1
961 nmdc:mga0rr50_568982_c1
962 nmdc:mga0rr50_6_c1
963 nmdc:mga08x19_402_c1
964 nmdc:mga08x19_438845_c1
965 nmdc:mga08x19_695332_c1
966 nmdc:mga08x19_795786_c1
967 nmdc:mga0a205_179049_c1
968 nmdc:mga0a205_246448_c1
969 nmdc:mga0a205_3237_c1
970 Ga0495601_0019832
971 Ga0495601_0236113
972 Ga0495595_0070076
973 Ga0495619_0115104
974 Ga0495619_0657230
975 Ga0500566_0174814
976 Ga0500658_0220876
977 Ga0501082_1765467
978 Ga0530510_0007307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07452

CHRD

CHRD domain

40

154

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h2q-assembly1.cif.gz_A human sod1 h80r variant, p21 crystal form 0.6697 31 149
3h2q-assembly2.cif.gz_D human sod1 h80r variant, p21 crystal form 0.6687 31 149
1mfm-assembly1.cif.gz_A monomeric human sod mutant f50e/g51e/e133q at atomic resolution 0.6664 31 149
1oez-assembly2.cif.gz_X zn his46arg mutant of human cu, zn superoxide dismutase 0.6634 31 149
3cqq-assembly1.cif.gz_A human sod1 g85r variant, structure ii 0.6623 32 149
ID Description Score Start End Superfamily
af_Q9Z0E2_402_515_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.8082 34 144 2.60.40.200
af_Q24025_475_583_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7961 34 144 2.60.40.200
af_O57472_402_514_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7907 34 144 2.60.40.200
af_Q9Z0E2_402_515_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7817 34 144 2.60.40.200
af_Q24025_475_583_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7763 34 144 2.60.40.200
ID Description Score Start End GO Terms
AF-A0A3D1IEA5-F1-model_v4 CHRD domain-containing protein 0.9773 58 148
AF-A0A3D0MEW2-F1-model_v4 CHRD domain-containing protein 0.9761 22 148
AF-A0A7W0QP08-F1-model_v4 CHRD domain-containing protein 0.9718 30 152
AF-A0A3D3QEG5-F1-model_v4 deleted 0.9629 27 149
AF-A0A7W0QP08-F1-model_v4 CHRD domain-containing protein 0.9566 30 152

Map