metagRoot

F453754

General Info

Members	Datasets	Scaffolds	Average Seq Length
489	300	448	176

Family's Representative Sequence

Representative Sequence	3300006358\|Ga0068871_100723415\|Ga0068871_1007234152
Length	191
Sequence	MAASVWAATTEVLAAEFSDVPDLPQVLRIAVRLLLASVLGFLLGFEREQHGKAAGVRTHMLVAIGSAMFVLVPQQAGIAPADMSRVIQGLVAGVGFLCAGTILKQGRDEQHVQGLTTAAGLWMTAAIGMACGLGRELTAILSALLALAVLALVPRLVALMERVVGPPGDEDGATRVIAAADDNKGERPPPR

Samples

	Sample ID	Description	Type	Environment
1	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
2	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
3	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
4	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
5	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
6	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
7	2643221672	Variovorax sp. Root434	Isolate	Unclassified
8	2643221683	Variovorax sp. Root473	Isolate	Unclassified
9	2738541277	Variovorax sp. GV051	Isolate	Unclassified
10	2738541307	Variovorax sp. GV008	Isolate	Unclassified
11	2738543013	Variovorax sp. BT01	Isolate	Unclassified
12	2738543019	Variovorax sp. GV040	Isolate	Unclassified
13	2818991446	Variovorax sp. 1180	Isolate	Unclassified
14	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
15	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
16	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
17	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
18	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
19	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
20	2885198086	Variovorax sp. 679	Isolate	Unclassified
21	2885211737	Variovorax sp. 553	Isolate	Unclassified
22	2899924645	Variovorax sp. 369	Isolate	Unclassified
23	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
24	2904456579	Variovorax sp. 2002	Isolate	Unclassified
25	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
26	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
27	2928037797	Variovorax sp. 1126	Isolate	Unclassified
28	2928044640	Variovorax sp. 1128	Isolate	Unclassified
29	2928051484	Variovorax sp. 1133	Isolate	Unclassified
30	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
31	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
32	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
33	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
34	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
35	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
36	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
37	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
38	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
39	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
40	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
41	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
42	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
43	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
44	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
45	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
46	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
47	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
48	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
49	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
50	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
51	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
52	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
53	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
54	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
55	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
56	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
57	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
58	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
59	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
60	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
61	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
62	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
63	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
64	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
65	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
66	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
67	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
68	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
69	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
70	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
71	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
72	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
73	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
74	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
75	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
76	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
77	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
78	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
79	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
80	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
81	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
82	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
83	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
84	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
85	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
86	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
87	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
88	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
89	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
90	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
91	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
92	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
93	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
94	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
95	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
96	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
97	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
98	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
99	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
100	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
101	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
102	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
103	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
104	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
107	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
108	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
109	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
110	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
111	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
112	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
113	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
114	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
119	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
121	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
122	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
123	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
125	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
128	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
131	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
154	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
155	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
156	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
157	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
158	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
159	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
160	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
161	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
162	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
163	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
164	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
165	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
166	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
167	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
168	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
169	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
170	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
171	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
172	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
173	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
174	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
175	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
176	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
177	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
178	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
179	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
180	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
181	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
182	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
183	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
184	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
185	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
186	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
187	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
188	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
189	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
190	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
191	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
192	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
193	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
194	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
195	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
196	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
197	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
198	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
199	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
200	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
201	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
202	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
203	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
204	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
205	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
206	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
207	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
208	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
209	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
210	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
211	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
212	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
213	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
214	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
215	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
216	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
217	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
218	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
219	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
220	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
221	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
222	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
223	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
224	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
225	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
226	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
227	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
228	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
229	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
230	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
231	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
232	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
233	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
234	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
235	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
236	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
237	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
238	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
239	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
240	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
241	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
242	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
243	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
244	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
245	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
246	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
247	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
248	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
249	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
250	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
251	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
252	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
253	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
254	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
255	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
256	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
257	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
258	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
259	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
260	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
261	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
262	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
263	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
264	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
265	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
266	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
267	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
268	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
269	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
270	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
271	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
272	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
273	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
274	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
275	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
276	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
277	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
278	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
279	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
280	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
281	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
282	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
283	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
284	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
285	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
286	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
287	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
288	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
289	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
290	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
291	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
292	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
293	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
294	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
295	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
296	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
297	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
298	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
299	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
300	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.8
Metatranscriptomes	0.82
Isolates	8.38

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	32.92
Nodule	0.82
Rhizoplane	4.7
Rhizosphere	50.51
Stem	0
Stem Tuber	0
Unclassified	11.04

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10034404	3300001989	Bacteria	1727
2	JGI25152J39213_1008454	3300002773	Bacteria	2554
3	JGI25152J39213_1011392	3300002773	Bacteria	1969
4	JGI25150J39212_1001338	3300002774	Bacteria	7002
5	JGI25150J39212_1025187	3300002774	Bacteria	870
6	JGI25159J45721_1019865	3300002987	Bacteria	1311
7	JGI25151J46595_10008110	3300003187	Bacteria	5087
8	JGI25151J46595_10024029	3300003187	Bacteria	2500
9	JGI25153J46596_10018236	3300003215	Bacteria	2734
10	rootH1_10061875	3300003323	Bacteria	2631
11	rootH1_10067267	3300003323	Bacteria	2720
12	rootH1_10401955	3300003323	Bacteria	1169
13	JGI25160J50197_1022931	3300003354	Bacteria	1818
14	JGI25161J50226_1001469	3300003374	Bacteria	7056
15	Ga0006562J51391_1022160	3300003578	Bacteria	2860
16	Ga0006562J51391_1022162	3300003578	Bacteria	3440
17	Ga0006562J51391_1080333	3300003578	Bacteria	9052
18	Ga0006562J51391_1080335	3300003578	Bacteria	5850
19	Ga0055535_1000069	3300003761	Bacteria	115207
20	Ga0055542_1000084	3300003762	Bacteria	125518
21	Ga0055526_1005138	3300003771	Bacteria	7626
22	Ga0055537_1000232	3300003773	Bacteria	40738
23	Ga0055537_1002044	3300003773	Bacteria	7119
24	Ga0055524_1003484	3300003775	Bacteria	7626
25	Ga0055536_1007752	3300003781	Bacteria	4748
26	Ga0055536_1021169	3300003781	Bacteria	1983
27	Ga0055534_1000212	3300003784	Bacteria	42993
28	Ga0055534_1000240	3300003784	Bacteria	39034
29	Ga0055534_1007758	3300003784	Bacteria	2513
30	Ga0055534_1033401	3300003784	Bacteria	783
31	Ga0055528_1004089	3300003790	Bacteria	7119
32	Ga0055528_1007620	3300003790	Bacteria	4758
33	Ga0055530_10001195	3300003791	Bacteria	20077
34	Ga0055540_1001630	3300003792	Bacteria	13027
35	Ga0055540_1002823	3300003792	Bacteria	8875
36	Ga0055540_1003994	3300003792	Bacteria	6870
37	Ga0055540_1009083	3300003792	Bacteria	3486
38	Ga0055540_1017682	3300003792	Bacteria	1981
39	Ga0055531_10001733	3300003794	Bacteria	15608
40	Ga0055531_10019548	3300003794	Bacteria	2734
41	Ga0055531_10027677	3300003794	Bacteria	1981
42	Ga0055543_1000698	3300004625	Bacteria	17147
43	Ga0065165_1004952	3300005262	Bacteria	7835
44	Ga0065165_1020984	3300005262	Bacteria	2280
45	Ga0065714_10006388	3300005288	Bacteria	3931
46	Ga0065704_10133246	3300005289	Bacteria	1602
47	Ga0070666_10176067	3300005335	Bacteria	1500
48	Ga0068868_100310334	3300005338	Bacteria	1342
49	Ga0070660_100463867	3300005339	Bacteria	1052
50	Ga0070661_100093447	3300005344	Bacteria	2229
51	Ga0070668_100145027	3300005347	Bacteria	1916
52	Ga0070669_100016550	3300005353	Bacteria	5263
53	Ga0070671_100030070	3300005355	Bacteria	4482
54	Ga0070674_100383050	3300005356	Bacteria	1145
55	Ga0070674_100524837	3300005356	Bacteria	990
56	Ga0070659_100659215	3300005366	Bacteria	903
57	Ga0070659_101499318	3300005366	Bacteria	601
58	Ga0070667_100095104	3300005367	Bacteria	2568
59	Ga0070667_100211750	3300005367	Bacteria	1723
60	Ga0070678_100226468	3300005456	Bacteria	1557
61	Ga0070678_100257174	3300005456	Bacteria	1467
62	Ga0070662_100068200	3300005457	Bacteria	2614
63	Ga0070662_100769609	3300005457	Bacteria	817
64	Ga0068867_100805987	3300005459	Bacteria	838
65	Ga0068853_100239204	3300005539	Bacteria	1663
66	Ga0068855_100043769	3300005563	Bacteria	5301
67	Ga0070664_100006820	3300005564	Bacteria	9209
68	Ga0068854_100655687	3300005578	Bacteria	902
69	Ga0068852_100144373	3300005616	Bacteria	2206
70	Ga0068852_100294452	3300005616	Bacteria	1569
71	Ga0068851_10006495	3300005834	Bacteria	5339
72	Ga0075365_10027126	3300006038	Bacteria	3641
73	Ga0075363_100002982	3300006048	Bacteria	7067
74	Ga0075363_100008315	3300006048	Bacteria	4826
75	Ga0075363_100069599	3300006048	Bacteria	1909
76	Ga0075363_100105678	3300006048	Bacteria	1561
77	Ga0075363_100325339	3300006048	Bacteria	895
78	Ga0075364_10008381	3300006051	Bacteria	6177
79	Ga0075364_10228577	3300006051	Bacteria	1263
80	Ga0075432_10003135	3300006058	Bacteria	5583
81	Ga0075362_10005466	3300006177	Bacteria	4651
82	Ga0075362_10011171	3300006177	Bacteria	3531
83	Ga0075362_10058674	3300006177	Bacteria	1736
84	Ga0075362_10102834	3300006177	Bacteria	1337
85	Ga0075366_10002056	3300006195	Bacteria	10216
86	Ga0075366_10023943	3300006195	Bacteria	3558
87	Ga0075366_10051080	3300006195	Bacteria	2457
88	Ga0075366_10063212	3300006195	Bacteria	2200
89	Ga0075366_10128515	3300006195	Bacteria	1529
90	Ga0075370_10000501	3300006353	Bacteria	14852
91	Ga0075370_10001916	3300006353	Bacteria	9367
92	Ga0075370_10014095	3300006353	Bacteria	4258
93	Ga0075370_10029649	3300006353	Bacteria	3048
94	Ga0075370_10121749	3300006353	Bacteria	1519
95	Ga0075370_10187951	3300006353	Bacteria	1217
96	Ga0075370_10200331	3300006353	Bacteria	1177
97	Ga0068871_100169454	3300006358	Bacteria	1871
98	Ga0068871_100193530	3300006358	Bacteria	1753
99	Ga0068871_100723415	3300006358	Bacteria	913
100	Ga0099826_10000873	3300006948	Bacteria	16445
101	Ga0099826_10124680	3300006948	Bacteria	1511
102	Ga0105244_10005868	3300009036	Bacteria	8061
103	Ga0105240_10077823	3300009093	Bacteria	4086
104	Ga0105245_10209977	3300009098	Bacteria	1873
105	Ga0105243_10004578	3300009148	Bacteria	10909
106	Ga0105243_10008424	3300009148	Bacteria	7914
107	Ga0105243_10102686	3300009148	Bacteria	2376
108	Ga0105242_11428300	3300009176	Bacteria	720
109	Ga0105248_11062524	3300009177	Bacteria	915
110	Ga0105237_10061664	3300009545	Bacteria	3749
111	Ga0105238_10500816	3300009551	Bacteria	1215
112	Ga0105239_10084524	3300010375	Bacteria	3496
113	Ga0157373_10013592	3300013100	Bacteria	5971
114	Ga0157373_10605655	3300013100	Bacteria	798
115	Ga0157370_10020546	3300013104	Bacteria	6593
116	Ga0157370_10762022	3300013104	Bacteria	882
117	Ga0157375_10101939	3300013308	Bacteria	2954
118	Ga0163163_10402265	3300014325	Bacteria	1427
119	Ga0182008_10000065	3300014497	Bacteria	88652
120	Ga0182008_10001055	3300014497	Bacteria	19093
121	Ga0182008_10002045	3300014497	Bacteria	12942
122	Ga0182008_10003530	3300014497	Bacteria	9401
123	Ga0182008_10026117	3300014497	Bacteria	2962
124	Ga0182008_10026495	3300014497	Bacteria	2940
125	Ga0157376_11154099	3300014969	Bacteria	802
126	Ga0182006_1000912	3300015261	Bacteria	19708
127	Ga0182006_1037433	3300015261	Bacteria	1923
128	Ga0182006_1190196	3300015261	Bacteria	682
129	Ga0182007_10000369	3300015262	Bacteria	28440
130	Ga0182007_10141774	3300015262	Bacteria	813
131	Ga0182005_1045924	3300015265	Bacteria	1186
132	Ga0182005_1049787	3300015265	Bacteria	1139
133	Ga0183362_10003	3300015683	Bacteria	977584
134	Ga0163161_10001053	3300017792	Bacteria	20949
135	Ga0163161_10166953	3300017792	Bacteria	1681
136	Ga0163161_10892754	3300017792	Bacteria	752
137	Ga0209436_101775	3300025208	Bacteria	7061
138	Ga0209672_100822	3300025228	Bacteria	14569
139	Ga0209147_100554	3300025229	Bacteria	21099
140	Ga0209258_100093	3300025242	Bacteria	223559
141	Ga0207425_1000552	3300025245	Bacteria	22339
142	Ga0207425_1012510	3300025245	Bacteria	1989
143	Ga0209148_1000007	3300025254	Bacteria	1592273
144	Ga0209129_1000147	3300025258	Bacteria	115120
145	Ga0209565_1000117	3300025263	Bacteria	113536
146	Ga0209565_1000282	3300025263	Bacteria	50138
147	Ga0209565_1009059	3300025263	Bacteria	2559
148	Ga0209673_1000218	3300025273	Bacteria	113542
149	Ga0209673_1001256	3300025273	Bacteria	26191
150	Ga0209130_1001555	3300025284	Bacteria	14566
151	Ga0209130_1007259	3300025284	Bacteria	3451
152	Ga0209675_1000113	3300025291	Bacteria	113542
153	Ga0209675_1000745	3300025291	Bacteria	21972
154	Ga0209675_1006270	3300025291	Bacteria	4806
155	Ga0209675_1037842	3300025291	Bacteria	1080
156	Ga0209676_1000028	3300025292	Bacteria	559745
157	Ga0209676_1000135	3300025292	Bacteria	182756
158	Ga0209676_1000216	3300025292	Bacteria	125759
159	Ga0209676_1000486	3300025292	Bacteria	64563
160	Ga0209676_1005087	3300025292	Bacteria	7023
161	Ga0209025_1000503	3300025294	Bacteria	75048
162	Ga0209025_1001127	3300025294	Bacteria	38261
163	Ga0209025_1015406	3300025294	Bacteria	4610
164	Ga0209025_1073805	3300025294	Bacteria	1195
165	Ga0209564_1000327	3300025295	Bacteria	92740
166	Ga0209758_1000199	3300025297	Bacteria	133164
167	Ga0209758_1010766	3300025297	Bacteria	5417
168	Ga0209050_1000072	3300025298	Bacteria	293619
169	Ga0209050_1000100	3300025298	Bacteria	231385
170	Ga0209050_1000133	3300025298	Bacteria	184688
171	Ga0209050_1011456	3300025298	Bacteria	4199
172	Ga0209050_1076348	3300025298	Bacteria	728
173	Ga0209256_1000206	3300025299	Bacteria	111425
174	Ga0207426_1000049	3300025302	Bacteria	401954
175	Ga0209051_1000015	3300025303	Bacteria	546798
176	Ga0209051_1000067	3300025303	Bacteria	227181
177	Ga0209051_1000255	3300025303	Bacteria	89418
178	Ga0209051_1000370	3300025303	Bacteria	64642
179	Ga0209051_1000440	3300025303	Bacteria	56410
180	Ga0209051_1012891	3300025303	Bacteria	4015
181	Ga0209257_1000037	3300025304	Bacteria	612915
182	Ga0209257_1000095	3300025304	Bacteria	259437
183	Ga0209257_1006840	3300025304	Bacteria	7161
184	Ga0209257_1020393	3300025304	Bacteria	2452
185	Ga0207656_10003746	3300025321	Bacteria	5265
186	Ga0207655_1000689	3300025728	Bacteria	39302
187	Ga0207680_10119142	3300025903	Bacteria	1724
188	Ga0207671_10058924	3300025914	Bacteria	2847
189	Ga0207657_10196983	3300025919	Bacteria	1622
190	Ga0207681_10123126	3300025923	Bacteria	1905
191	Ga0207694_10035770	3300025924	Bacteria	3810
192	Ga0207706_10039768	3300025933	Bacteria	4170
193	Ga0207709_10000320	3300025935	Bacteria	52414
194	Ga0207709_10001078	3300025935	Bacteria	20070
195	Ga0207709_10137286	3300025935	Bacteria	1676
196	Ga0207689_10440047	3300025942	Bacteria	1089
197	Ga0207679_10013445	3300025945	Bacteria	5367
198	Ga0207667_10026911	3300025949	Bacteria	6274
199	Ga0207651_10586662	3300025960	Bacteria	973
200	Ga0207658_10015383	3300025986	Bacteria	5249
201	Ga0207658_10283979	3300025986	Bacteria	1420
202	Ga0207677_10536402	3300026023	Bacteria	1017
203	Ga0207677_10741722	3300026023	Bacteria	875
204	Ga0207639_10002635	3300026041	Bacteria	12045
205	Ga0207674_10945018	3300026116	Bacteria	830
206	Ga0207683_10035227	3300026121	Bacteria	4353
207	Ga0207683_10214093	3300026121	Bacteria	1754
208	Ga0207698_10579277	3300026142	Bacteria	1104
209	Ga0207698_10875541	3300026142	Bacteria	904
210	Ga0209282_1000188	3300027666	Bacteria	32983
211	Ga0207428_10052866	3300027907	Bacteria	3241
212	Ga0307515_10004165	3300028794	Bacteria	30102
213	Ga0316177_1013268	3300030731	Bacteria	2828
214	Ga0314311_1021624	3300030733	Bacteria	8363
215	Ga0316179_1047388	3300030734	Bacteria	1911
216	Ga0316178_1101787	3300030735	Bacteria	822
217	Ga0316183_1001871	3300030742	Bacteria	11499
218	Ga0316181_1002978	3300030744	Bacteria	2419
219	Ga0316182_1278050	3300030745	Bacteria	4024
220	Ga0316182_1385976	3300030745	Bacteria	3640
221	Ga0265331_10013942	3300031250	Bacteria	4299
222	Ga0265327_10011972	3300031251	Bacteria	5910
223	Ga0307408_100000167	3300031548	Bacteria	73538
224	Ga0307408_100031931	3300031548	Bacteria	3669
225	Ga0307408_100070783	3300031548	Bacteria	2576
226	Ga0307408_100946052	3300031548	Bacteria	791
227	Ga0307514_10013497	3300031649	Bacteria	6774
228	Ga0307405_10081138	3300031731	Bacteria	2119
229	Ga0307405_10349844	3300031731	Bacteria	1139
230	Ga0307405_10881905	3300031731	Bacteria	755
231	Ga0307413_10772361	3300031824	Bacteria	805
232	Ga0307406_10003412	3300031901	Bacteria	8653
233	Ga0307406_10003983	3300031901	Bacteria	8033
234	Ga0307406_10516157	3300031901	Bacteria	971
235	Ga0307407_10896603	3300031903	Bacteria	680
236	Ga0307412_10007802	3300031911	Bacteria	6090
237	Ga0307412_10018922	3300031911	Bacteria	4157
238	Ga0307412_10109485	3300031911	Bacteria	1969
239	Ga0307414_10091756	3300032004	Bacteria	2258
240	Ga0307411_10085490	3300032005	Bacteria	2185
241	Ga0307411_10098085	3300032005	Bacteria	2064
242	Ga0307411_10163994	3300032005	Bacteria	1668
243	Ga0307411_10234157	3300032005	Bacteria	1433
244	Ga0307411_10236825	3300032005	Bacteria	1426
245	Ga0307411_10372355	3300032005	Bacteria	1172
246	Ga0307411_10724277	3300032005	Bacteria	869
247	Ga0439436_0009076	3300041404	Bacteria	3049
248	Ga0439436_0133061	3300041404	Bacteria	697
249	Ga0439438_042940	3300041405	Bacteria	1168
250	Ga0439438_044134	3300041405	Bacteria	1149
251	Ga0439439_0011018	3300041406	Bacteria	2169
252	Ga0439439_0045752	3300041406	Bacteria	1142
253	Ga0439447_025524	3300041407	Bacteria	1522
254	Ga0439447_054862	3300041407	Bacteria	945
255	Ga0439461_0009560	3300041410	Bacteria	1761
256	Ga0439461_0088585	3300041410	Bacteria	739
257	Ga0439466_0014983	3300041411	Bacteria	2817
258	Ga0439466_0023860	3300041411	Bacteria	2148
259	Ga0439466_0072464	3300041411	Bacteria	1095
260	Ga0439465_0011259	3300041413	Bacteria	2808
261	Ga0439465_0058969	3300041413	Bacteria	1269
262	Ga0451789_0403566	3300041443	Bacteria	737
263	Ga0451793_0651684	3300041452	Bacteria	926
264	Ga0451807_1200035	3300041486	Bacteria	725
265	Ga0439431_0030534	3300041997	Bacteria	1335
266	Ga0439433_0000209	3300041999	Bacteria	9561
267	Ga0439433_0031256	3300041999	Bacteria	1218
268	Ga0439442_006709	3300042002	Bacteria	2312
269	Ga0439445_0023153	3300042004	Bacteria	1571
270	Ga0439445_0029524	3300042004	Bacteria	1417
271	Ga0439445_0045881	3300042004	Bacteria	1170
272	Ga0439445_0065911	3300042004	Bacteria	997
273	Ga0439432_000191	3300042006	Bacteria	21948
274	Ga0439432_036257	3300042006	Bacteria	1578
275	Ga0439432_037055	3300042006	Bacteria	1558
276	Ga0439449_0002334	3300042007	Bacteria	7438
277	Ga0439449_0002704	3300042007	Bacteria	6904
278	Ga0439449_0018145	3300042007	Bacteria	2640
279	Ga0439449_0031768	3300042007	Bacteria	1968
280	Ga0439452_000437	3300042010	Bacteria	23932
281	Ga0439452_039728	3300042010	Bacteria	1112
282	Ga0439455_0088838	3300042012	Bacteria	846
283	Ga0439457_026395	3300042014	Bacteria	1286
284	Ga0439462_0029044	3300042015	Bacteria	1462
285	Ga0439462_0035855	3300042015	Bacteria	1319
286	Ga0450911_015435	3300042115	Bacteria	1011
287	Ga0450911_017100	3300042115	Bacteria	957
288	Ga0450921_000516	3300042123	Bacteria	1865
289	Ga0450923_005013	3300042125	Bacteria	2115
290	Ga0450923_028185	3300042125	Bacteria	1133
291	Ga0450897_001043	3300042128	Bacteria	1773
292	Ga0450894_008386	3300042131	Bacteria	1336
293	Ga0450898_003338	3300042134	Bacteria	2300
294	Ga0450906_000680	3300042145	Bacteria	7278
295	Ga0450907_015492	3300042146	Bacteria	1273
296	Ga0450910_001755	3300042147	Bacteria	2785
297	Ga0439446_0021480	3300042156	Bacteria	1824
298	Ga0439446_0126779	3300042156	Bacteria	825
299	Ga0450908_008597	3300042184	Bacteria	1911
300	Ga0450908_030045	3300042184	Bacteria	944
301	Ga0450909_002329	3300042185	Bacteria	2693
302	Ga0439434_0001295	3300042435	Bacteria	7199
303	Ga0439434_0039193	3300042435	Bacteria	1453
304	Ga0450918_008738	3300042531	Bacteria	1779
305	Ga0450893_0010795	3300042532	Bacteria	1504
306	Ga0450893_0049542	3300042532	Bacteria	785
307	Ga0466965_0017935	3300044683	Bacteria	3387
308	Ga0466957_1074514	3300044842	Bacteria	580
309	Ga0495627_006153	3300046453	Bacteria	4732
310	Ga0495629_0360920	3300046459	Bacteria	990
311	Ga0495629_0509214	3300046459	Bacteria	811
312	Ga0495638_0006266	3300046460	Bacteria	8685
313	Ga0495638_0007557	3300046460	Bacteria	7775
314	Ga0495639_0005608	3300046475	Bacteria	5404
315	Ga0495594_0252249	3300046499	Bacteria	1005
316	Ga0495607_0022049	3300046501	Bacteria	4004
317	Ga0495606_0103600	3300046507	Bacteria	1728
318	Ga0495610_0007865	3300046512	Bacteria	7010
319	Ga0495616_0004664	3300046513	Bacteria	8599
320	Ga0495620_0006209	3300046515	Bacteria	6583
321	Ga0495631_0000007	3300046518	Bacteria	130158
322	Ga0495631_0206010	3300046518	Bacteria	841
323	Ga0495632_0009981	3300046519	Bacteria	5665
324	Ga0495637_0002632	3300046520	Bacteria	9835
325	Ga0495637_0008941	3300046520	Bacteria	4902
326	Ga0495637_0037944	3300046520	Bacteria	2088
327	Ga0495643_0047620	3300046522	Bacteria	2321
328	Ga0495663_0027560	3300046525	Bacteria	1668
329	Ga0495654_0011667	3300046530	Bacteria	4747
330	Ga0495654_0018839	3300046530	Bacteria	3612
331	Ga0495654_0050512	3300046530	Bacteria	2032
332	Ga0495654_0199956	3300046530	Bacteria	856
333	Ga0495621_0003176	3300046539	Bacteria	4503
334	Ga0495622_0152792	3300046557	Bacteria	1044
335	Ga0495622_0164270	3300046557	Bacteria	1000
336	Ga0495633_0160685	3300046558	Bacteria	1037
337	Ga0495625_0000329	3300046660	Bacteria	72358
338	Ga0495625_0020265	3300046660	Bacteria	5137
339	Ga0495625_0059712	3300046660	Bacteria	2704
340	Ga0495661_0139518	3300046665	Bacteria	1320
341	Ga0495588_0130658	3300046674	Bacteria	1325
342	Ga0495658_0133002	3300046683	Bacteria	1516
343	Ga0495624_0105886	3300046690	Bacteria	1731
344	Ga0495671_0008992	3300046692	Bacteria	5605
345	Ga0495649_0007412	3300046694	Bacteria	6689
346	Ga0495649_0021868	3300046694	Bacteria	3582
347	Ga0495589_0006218	3300046794	Bacteria	6306
348	Ga0495660_0087303	3300046810	Bacteria	1627
349	Ga0495676_0113153	3300047321	Bacteria	1987
350	Ga0495681_0141199	3300047470	Bacteria	1017
351	Ga0495681_0168137	3300047470	Bacteria	909
352	Ga0495593_0121748	3300047673	Bacteria	1327
353	Ga0495602_0137363	3300048088	Bacteria	1940
354	Ga0495614_0015292	3300048089	Bacteria	3345
355	Ga0496100_0004437	3300048903	Bacteria	7438
356	Ga0496101_0001066	3300048904	Bacteria	16227
357	Ga0496101_0051980	3300048904	Bacteria	2953
358	Ga0496102_0018763	3300048905	Bacteria	6083
359	Ga0496103_0003524	3300048906	Bacteria	9563
360	Ga0496104_0000492	3300048907	Bacteria	34067
361	Ga0496105_0018916	3300048908	Bacteria	5548
362	Ga0496106_0040288	3300048909	Bacteria	3498
363	Ga0496107_0082402	3300048910	Bacteria	2346
364	Ga0496107_0967812	3300048910	Bacteria	618
365	Ga0496108_0049069	3300048911	Bacteria	3531
366	Ga0496109_0571048	3300048912	Bacteria	1066
367	Ga0496110_0040648	3300048913	Bacteria	4053
368	Ga0496110_0070394	3300048913	Bacteria	3099
369	Ga0496111_0043617	3300048914	Bacteria	3224
370	Ga0496113_0219179	3300048916	Bacteria	1516
371	Ga0496114_0051259	3300048917	Bacteria	3436
372	Ga0496116_0024915	3300048919	Bacteria	4411
373	Ga0496117_0081223	3300048920	Bacteria	2128
374	Ga0496117_0112833	3300048920	Bacteria	1689
375	Ga0496117_0284600	3300048920	Bacteria	883
376	Ga0496118_0033749	3300048921	Bacteria	4191
377	Ga0496118_0116765	3300048921	Bacteria	1752
378	Ga0496118_0148069	3300048921	Bacteria	1474
379	Ga0496118_0330614	3300048921	Bacteria	822
380	Ga0496121_0043886	3300048924	Bacteria	3865
381	Ga0496121_0096494	3300048924	Bacteria	2293
382	Ga0496122_0000319	3300048925	Bacteria	105543
383	Ga0496122_0189054	3300048925	Bacteria	1218
384	Ga0496122_0193809	3300048925	Bacteria	1196
385	Ga0496123_0000117	3300048926	Bacteria	161679
386	Ga0496123_0032350	3300048926	Bacteria	3789
387	Ga0496123_0110848	3300048926	Bacteria	1569
388	Ga0496123_0207319	3300048926	Bacteria	999
389	Ga0496123_0266256	3300048926	Bacteria	837
390	Ga0496124_0081463	3300048927	Bacteria	2660
391	Ga0496124_0134490	3300048927	Bacteria	1959
392	Ga0496124_0149861	3300048927	Bacteria	1831
393	Ga0496125_0037932	3300048928	Bacteria	4182
394	Ga0495678_174114	3300049459	Bacteria	679
395	Ga0501238_009950	3300049671	Bacteria	1266
396	Ga0501262_002177	3300049759	Bacteria	2219
397	nmdc:mga03683_1258_c1	3300050489	Bacteria	7511
398	nmdc:mga03683_33705_c1	3300050489	Bacteria	2069
399	nmdc:mga03683_48640_c1	3300050489	Bacteria	1763
400	nmdc:mga03683_82147_c1	3300050489	Bacteria	1393
401	nmdc:mga03n38_276698_c1	3300050490	Bacteria	895
402	nmdc:mga00v17_137766_c1	3300050491	Bacteria	1563
403	nmdc:mga00v17_2256_c1	3300050491	Bacteria	9872
404	nmdc:mga0yw44_2645_c1	3300050492	Bacteria	7716
405	nmdc:mga0yw44_334616_c1	3300050492	Bacteria	1018
406	nmdc:mga0k408_159898_c1	3300050493	Bacteria	1342
407	nmdc:mga0k408_385427_c1	3300050493	Bacteria	835
408	nmdc:mga0k408_396365_c1	3300050493	Bacteria	822
409	nmdc:mga0k408_63391_c1	3300050493	Bacteria	2150
410	nmdc:mga0k408_64248_c1	3300050493	Bacteria	2136
411	nmdc:mga0k408_785_c1	3300050493	Bacteria	17469
412	nmdc:mga06z11_214658_c1	3300050494	Bacteria	1122
413	nmdc:mga06z11_348643_c1	3300050494	Bacteria	886
414	nmdc:mga06z11_53589_c1	3300050494	Bacteria	2075
415	nmdc:mga07m45_109529_c1	3300050496	Bacteria	1590
416	nmdc:mga07m45_1301_c1	3300050496	Bacteria	11345
417	nmdc:mga07m45_16187_c1	3300050496	Bacteria	3992
418	nmdc:mga07m45_39113_c1	3300050496	Bacteria	2650
419	nmdc:mga07m45_90044_c1	3300050496	Bacteria	1757
420	nmdc:mga07m45_9092_c1	3300050496	Bacteria	5134
421	nmdc:mga0sz30_3421_c1	3300050516	Bacteria	5716
422	Ga0500610_0003655	3300053079	Bacteria	5955
423	Ga0500643_019448	3300053087	Bacteria	2234
424	Ga0500643_060439	3300053087	Bacteria	1065
425	Ga0500651_0003305	3300053093	Bacteria	8782
426	Ga0500569_011150	3300053109	Bacteria	2139
427	Ga0500571_000094	3300053110	Bacteria	28973
428	Ga0500572_059810	3300053111	Bacteria	1156
429	Ga0500592_006961	3300053116	Bacteria	1800
430	Ga0500593_000418	3300053117	Bacteria	16802
431	Ga0500594_0002466	3300053118	Bacteria	4024
432	Ga0500607_007240	3300053121	Bacteria	6883
433	Ga0500608_086187	3300053122	Bacteria	1475
434	Ga0500626_011614	3300053128	Bacteria	3742
435	Ga0500628_064217	3300053129	Bacteria	904
436	Ga0500655_002551	3300053133	Bacteria	3307
437	Ga0500658_0000294	3300053134	Bacteria	22583
438	Ga0500658_0006263	3300053134	Bacteria	4423
439	Ga0500559_0019648	3300053136	Bacteria	2854
440	Ga0500559_0049493	3300053136	Bacteria	1851
441	Ga0500564_021741	3300053138	Bacteria	2940
442	Ga0500568_0000934	3300053139	Bacteria	20169
443	Ga0500616_0024757	3300053153	Bacteria	3332
444	Ga0500634_0005044	3300053161	Bacteria	6217
445	Ga0500634_0100346	3300053161	Bacteria	1450
446	Ga0500638_025511	3300053162	Bacteria	2826
447	Ga0500636_0100672	3300053177	Bacteria	1643
448	Ga0500625_113578	3300053729	Bacteria	1105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044842	Ga0466957_1074514	Ga0466957_1074514_31_546	137
2	3300025291	Ga0209675_1037842	Ga0209675_10378422	148
3	3300032005	Ga0307411_10372355	Ga0307411_103723552	148
4	3300050493	nmdc:mga0k408_396365_c1	nmdc:mga0k408_396365_c1_14_502	150
5	3300005459	Ga0068867_100805987	Ga0068867_1008059871	151
6	3300046507	Ga0495606_0103600	Ga0495606_0103600_408_932	151
7	3300046520	Ga0495637_0002632	Ga0495637_0002632_1646_2170	151
8	3300046522	Ga0495643_0047620	Ga0495643_0047620_942_1466	151
9	3300046694	Ga0495649_0021868	Ga0495649_0021868_1413_1937	151
10	3300003792	Ga0055540_1003994	Ga0055540_10039946	153
11	3300006177	Ga0075362_10005466	Ga0075362_100054665	153
12	3300025303	Ga0209051_1000370	Ga0209051_10003706	153
13	3300041404	Ga0439436_0133061	Ga0439436_0133061_44_610	153
14	3300041411	Ga0439466_0023860	Ga0439466_0023860_225_791	153
15	3300041413	Ga0439465_0058969	Ga0439465_0058969_327_893	153
16	3300041997	Ga0439431_0030534	Ga0439431_0030534_35_601	153
17	3300042004	Ga0439445_0045881	Ga0439445_0045881_309_875	153
18	3300042115	Ga0450911_017100	Ga0450911_017100_169_735	153
19	3300042123	Ga0450921_000516	Ga0450921_000516_477_1043	153
20	3300042125	Ga0450923_005013	Ga0450923_005013_141_707	153
21	3300042134	Ga0450898_003338	Ga0450898_003338_1229_1795	153
22	3300042145	Ga0450906_000680	Ga0450906_000680_6158_6724	153
23	3300042146	Ga0450907_015492	Ga0450907_015492_191_757	153
24	3300042147	Ga0450910_001755	Ga0450910_001755_1603_2169	153
25	3300042184	Ga0450908_008597	Ga0450908_008597_1255_1821	153
26	3300042531	Ga0450918_008738	Ga0450918_008738_1023_1589	153
27	3300042532	Ga0450893_0049542	Ga0450893_0049542_137_703	153
28	3300046460	Ga0495638_0007557	Ga0495638_0007557_3561_4070	153
29	3300046501	Ga0495607_0022049	Ga0495607_0022049_2364_2888	153
30	3300046519	Ga0495632_0009981	Ga0495632_0009981_2420_2944	153
31	3300046520	Ga0495637_0008941	Ga0495637_0008941_2732_3256	153
32	3300046530	Ga0495654_0011667	Ga0495654_0011667_3080_3589	153
33	3300046694	Ga0495649_0007412	Ga0495649_0007412_3392_3916	153
34	3300046794	Ga0495589_0006218	Ga0495589_0006218_2602_3126	153
35	3300048914	Ga0496111_0043617	Ga0496111_0043617_1171_1659	153
36	3300050489	nmdc:mga03683_1258_c1	nmdc:mga03683_1258_c1_1266_1838	153
37	3300050492	nmdc:mga0yw44_334616_c1	nmdc:mga0yw44_334616_c1_394_966	153
38	3300050516	nmdc:mga0sz30_3421_c1	nmdc:mga0sz30_3421_c1_2218_2790	153
39	3300031731	Ga0307405_10349844	Ga0307405_103498442	156
40	3300031911	Ga0307412_10018922	Ga0307412_100189222	156
41	3300032005	Ga0307411_10085490	Ga0307411_100854902	156
42	3300041405	Ga0439438_044134	Ga0439438_044134_216_779	156
43	3300041406	Ga0439439_0011018	Ga0439439_0011018_1004_1567	156
44	3300041407	Ga0439447_025524	Ga0439447_025524_250_813	156
45	3300041410	Ga0439461_0088585	Ga0439461_0088585_43_606	156
46	3300041999	Ga0439433_0031256	Ga0439433_0031256_515_1078	156
47	3300042002	Ga0439442_006709	Ga0439442_006709_1633_2196	156
48	3300042006	Ga0439432_036257	Ga0439432_036257_682_1245	156
49	3300042007	Ga0439449_0002704	Ga0439449_0002704_5845_6408	156
50	3300042015	Ga0439462_0035855	Ga0439462_0035855_413_976	156
51	3300042125	Ga0450923_028185	Ga0450923_028185_491_1054	156
52	3300042128	Ga0450897_001043	Ga0450897_001043_317_880	156
53	3300042131	Ga0450894_008386	Ga0450894_008386_650_1213	156
54	3300042156	Ga0439446_0126779	Ga0439446_0126779_23_565	156
55	3300042184	Ga0450908_030045	Ga0450908_030045_106_669	156
56	3300042185	Ga0450909_002329	Ga0450909_002329_1744_2307	156
57	3300046525	Ga0495663_0027560	Ga0495663_0027560_305_832	156
58	3300017792	Ga0163161_10001053	Ga0163161_1000105320	158
59	3300030745	Ga0316182_1385976	Ga0316182_13859762	158
60	3300041404	Ga0439436_0009076	Ga0439436_0009076_965_1525	158
61	3300041406	Ga0439439_0045752	Ga0439439_0045752_45_605	158
62	3300041407	Ga0439447_054862	Ga0439447_054862_205_765	158
63	3300041411	Ga0439466_0014983	Ga0439466_0014983_2048_2608	158
64	3300041411	Ga0439466_0072464	Ga0439466_0072464_185_745	158
65	3300041413	Ga0439465_0011259	Ga0439465_0011259_743_1303	158
66	3300041999	Ga0439433_0000209	Ga0439433_0000209_6992_7552	158
67	3300042004	Ga0439445_0029524	Ga0439445_0029524_171_731	158
68	3300042004	Ga0439445_0065911	Ga0439445_0065911_179_739	158
69	3300042006	Ga0439432_000191	Ga0439432_000191_21195_21755	158
70	3300042006	Ga0439432_037055	Ga0439432_037055_771_1331	158
71	3300042007	Ga0439449_0002334	Ga0439449_0002334_3984_4544	158
72	3300042007	Ga0439449_0018145	Ga0439449_0018145_1648_2208	158
73	3300042010	Ga0439452_039728	Ga0439452_039728_494_1054	158
74	3300042014	Ga0439457_026395	Ga0439457_026395_186_746	158
75	3300042015	Ga0439462_0029044	Ga0439462_0029044_199_759	158
76	3300042435	Ga0439434_0001295	Ga0439434_0001295_5378_5938	158
77	3300044683	Ga0466965_0017935	Ga0466965_0017935_1980_2528	158
78	3300014497	Ga0182008_10000065	Ga0182008_1000006520	159
79	3300014969	Ga0157376_11154099	Ga0157376_111540992	159
80	3300015262	Ga0182007_10141774	Ga0182007_101417742	159
81	3300015683	Ga0183362_10003	Ga0183362_10003797	159
82	3300042156	Ga0439446_0021480	Ga0439446_0021480_278_841	159
83	3300042435	Ga0439434_0039193	Ga0439434_0039193_313_876	159
84	3300003323	rootH1_10401955	rootH1_104019552	160
85	3300005289	Ga0065704_10133246	Ga0065704_101332462	160
86	3300006048	Ga0075363_100069599	Ga0075363_1000695992	160
87	3300006177	Ga0075362_10102834	Ga0075362_101028341	160
88	3300006353	Ga0075370_10200331	Ga0075370_102003312	160
89	3300017792	Ga0163161_10166953	Ga0163161_101669532	160
90	3300025294	Ga0209025_1073805	Ga0209025_10738052	160
91	3300025298	Ga0209050_1011456	Ga0209050_10114562	160
92	3300028794	Ga0307515_10004165	Ga0307515_100041657	160
93	3300031250	Ga0265331_10013942	Ga0265331_100139422	160
94	3300031548	Ga0307408_100000167	Ga0307408_10000016726	160
95	3300031901	Ga0307406_10003983	Ga0307406_100039834	160
96	3300032004	Ga0307414_10091756	Ga0307414_100917563	160
97	3300032005	Ga0307411_10098085	Ga0307411_100980852	160
98	3300042532	Ga0450893_0010795	Ga0450893_0010795_628_1185	160
99	3300048919	Ga0496116_0024915	Ga0496116_0024915_944_1516	160
100	3300048920	Ga0496117_0081223	Ga0496117_0081223_645_1217	160
101	3300048924	Ga0496121_0043886	Ga0496121_0043886_1487_2059	160
102	3300048926	Ga0496123_0032350	Ga0496123_0032350_3006_3560	160
103	3300048926	Ga0496123_0207319	Ga0496123_0207319_191_763	160
104	3300050489	nmdc:mga03683_48640_c1	nmdc:mga03683_48640_c1_232_789	160
105	3300050494	nmdc:mga06z11_53589_c1	nmdc:mga06z11_53589_c1_217_780	160
106	3300050496	nmdc:mga07m45_90044_c1	nmdc:mga07m45_90044_c1_1056_1619	160
107	3300006048	Ga0075363_100105678	Ga0075363_1001056782	161
108	3300006177	Ga0075362_10058674	Ga0075362_100586742	161
109	3300031824	Ga0307413_10772361	Ga0307413_107723612	161
110	3300032005	Ga0307411_10234157	Ga0307411_102341572	161
111	3300050489	nmdc:mga03683_82147_c1	nmdc:mga03683_82147_c1_687_1244	161
112	3300053121	Ga0500607_007240	Ga0500607_007240_6290_6856	161
113	3300053729	Ga0500625_113578	Ga0500625_113578_353_919	161
114	3300003187	JGI25151J46595_10008110	JGI25151J46595_100081101	162
115	3300005288	Ga0065714_10006388	Ga0065714_100063883	162
116	3300005356	Ga0070674_100383050	Ga0070674_1003830502	162
117	3300006051	Ga0075364_10228577	Ga0075364_102285772	162
118	3300006195	Ga0075366_10128515	Ga0075366_101285152	162
119	3300025294	Ga0209025_1000503	Ga0209025_100050319	162
120	3300025942	Ga0207689_10440047	Ga0207689_104400472	162
121	3300050493	nmdc:mga0k408_159898_c1	nmdc:mga0k408_159898_c1_49_615	162
122	3300003784	Ga0055534_1033401	Ga0055534_10334011	163
123	3300005356	Ga0070674_100524837	Ga0070674_1005248371	163
124	3300025291	Ga0209675_1006270	Ga0209675_10062702	163
125	3300041452	Ga0451793_0651684	Ga0451793_0651684_259_828	163
126	3300048925	Ga0496122_0000319	Ga0496122_0000319_60592_61134	163
127	3300048926	Ga0496123_0000117	Ga0496123_0000117_58068_58610	163
128	3300005335	Ga0070666_10176067	Ga0070666_101760672	164
129	3300005338	Ga0068868_100310334	Ga0068868_1003103342	164
130	3300005355	Ga0070671_100030070	Ga0070671_1000300702	164
131	3300005367	Ga0070667_100211750	Ga0070667_1002117502	164
132	3300005456	Ga0070678_100257174	Ga0070678_1002571741	164
133	3300006358	Ga0068871_100193530	Ga0068871_1001935301	164
134	3300025960	Ga0207651_10586662	Ga0207651_105866621	164
135	3300026023	Ga0207677_10536402	Ga0207677_105364022	164
136	3300026121	Ga0207683_10214093	Ga0207683_102140932	164
137	iso_pu_bacteria	2643221565	2643844575	164
138	iso_pu_bacteria	8056177738	8056178407	164
139	iso_pu_bacteria	2738543013	2739249510	165
140	3300046530	Ga0495654_0199956	Ga0495654_0199956_57_599	166
141	3300014497	Ga0182008_10026117	Ga0182008_100261173	167
142	3300041405	Ga0439438_042940	Ga0439438_042940_515_1054	167
143	3300042010	Ga0439452_000437	Ga0439452_000437_8346_8885	167
144	3300005456	Ga0070678_100226468	Ga0070678_1002264683	168
145	3300006048	Ga0075363_100002982	Ga0075363_1000029826	168
146	3300006177	Ga0075362_10011171	Ga0075362_100111715	168
147	3300006195	Ga0075366_10002056	Ga0075366_100020566	168
148	3300006353	Ga0075370_10121749	Ga0075370_101217492	168
149	3300006948	Ga0099826_10124680	Ga0099826_101246802	168
150	3300014497	Ga0182008_10026495	Ga0182008_100264952	168
151	3300026121	Ga0207683_10035227	Ga0207683_100352274	168
152	3300050489	nmdc:mga03683_33705_c1	nmdc:mga03683_33705_c1_430_945	168
153	3300050490	nmdc:mga03n38_276698_c1	nmdc:mga03n38_276698_c1_57_572	168
154	3300050493	nmdc:mga0k408_64248_c1	nmdc:mga0k408_64248_c1_261_776	168
155	3300050496	nmdc:mga07m45_39113_c1	nmdc:mga07m45_39113_c1_445_960	168
156	iso_pu_bacteria	2945909444	2945914139	168
157	3300005366	Ga0070659_100659215	Ga0070659_1006592152	169
158	3300009177	Ga0105248_11062524	Ga0105248_110625241	169
159	3300025986	Ga0207658_10283979	Ga0207658_102839792	169
160	3300042115	Ga0450911_015435	Ga0450911_015435_407_916	169
161	iso_pu_bacteria	2928084124	2928089776	169
162	3300002773	JGI25152J39213_1008454	JGI25152J39213_10084542	170
163	3300002774	JGI25150J39212_1001338	JGI25150J39212_10013385	170
164	3300002987	JGI25159J45721_1019865	JGI25159J45721_10198652	170
165	3300003187	JGI25151J46595_10024029	JGI25151J46595_100240293	170
166	3300003215	JGI25153J46596_10018236	JGI25153J46596_100182362	170
167	3300003354	JGI25160J50197_1022931	JGI25160J50197_10229312	170
168	3300003374	JGI25161J50226_1001469	JGI25161J50226_10014692	170
169	3300003771	Ga0055526_1005138	Ga0055526_10051382	170
170	3300003773	Ga0055537_1002044	Ga0055537_10020447	170
171	3300003775	Ga0055524_1003484	Ga0055524_10034842	170
172	3300003784	Ga0055534_1007758	Ga0055534_10077582	170
173	3300003790	Ga0055528_1004089	Ga0055528_10040892	170
174	3300003794	Ga0055531_10019548	Ga0055531_100195482	170
175	3300004625	Ga0055543_1000698	Ga0055543_100069815	170
176	3300005262	Ga0065165_1004952	Ga0065165_10049527	170
177	3300025208	Ga0209436_101775	Ga0209436_1017752	170
178	3300025245	Ga0207425_1000552	Ga0207425_100055220	170
179	3300025258	Ga0209129_1000147	Ga0209129_100014754	170
180	3300025263	Ga0209565_1000282	Ga0209565_100028240	170
181	3300025273	Ga0209673_1001256	Ga0209673_100125623	170
182	3300025284	Ga0209130_1001555	Ga0209130_10015559	170
183	3300025291	Ga0209675_1000745	Ga0209675_100074520	170
184	3300025294	Ga0209025_1001127	Ga0209025_100112729	170
185	3300025295	Ga0209564_1000327	Ga0209564_100032735	170
186	3300025297	Ga0209758_1000199	Ga0209758_100019937	170
187	3300025299	Ga0209256_1000206	Ga0209256_100020694	170
188	3300025302	Ga0207426_1000049	Ga0207426_1000049230	170
189	3300025303	Ga0209051_1012891	Ga0209051_10128914	170
190	3300025304	Ga0209257_1006840	Ga0209257_10068407	170
191	3300048926	Ga0496123_0266256	Ga0496123_0266256_186_764	170
192	iso_pu_bacteria	2738541307	2738886266	170
193	3300002773	JGI25152J39213_1011392	JGI25152J39213_10113923	171
194	3300002774	JGI25150J39212_1025187	JGI25150J39212_10251871	171
195	3300003323	rootH1_10067267	rootH1_100672674	171
196	3300003578	Ga0006562J51391_1022160	Ga0006562J51391_10221601	171
197	3300003578	Ga0006562J51391_1022162	Ga0006562J51391_10221622	171
198	3300003784	Ga0055534_1000212	Ga0055534_10002123	171
199	3300005262	Ga0065165_1020984	Ga0065165_10209842	171
200	3300006353	Ga0075370_10029649	Ga0075370_100296493	171
201	3300006353	Ga0075370_10187951	Ga0075370_101879512	171
202	3300025245	Ga0207425_1012510	Ga0207425_10125103	171
203	3300025263	Ga0209565_1009059	Ga0209565_10090593	171
204	3300025284	Ga0209130_1007259	Ga0209130_10072592	171
205	3300025294	Ga0209025_1015406	Ga0209025_10154062	171
206	3300025297	Ga0209758_1010766	Ga0209758_10107662	171
207	3300041486	Ga0451807_1200035	Ga0451807_1200035_17_565	171
208	3300042012	Ga0439455_0088838	Ga0439455_0088838_272_805	171
209	3300050496	nmdc:mga07m45_109529_c1	nmdc:mga07m45_109529_c1_1023_1556	171
210	iso_pu_bacteria	2643221628	2644161405	171
211	iso_pu_bacteria	2643221672	2644400685	171
212	iso_pu_bacteria	2842677519	2842682354	171
213	iso_pu_bacteria	2885192300	2885196767	171
214	iso_pu_bacteria	2919462493	2919465493	171
215	iso_pu_bacteria	2945945610	2945949715	171
216	iso_pu_bacteria	2945984333	2945990480	171
217	iso_pu_bacteria	2954767861	2954770671	171
218	3300013104	Ga0157370_10020546	Ga0157370_100205465	172
219	3300014497	Ga0182008_10001055	Ga0182008_1000105513	172
220	3300015261	Ga0182006_1190196	Ga0182006_11901962	172
221	3300041443	Ga0451789_0403566	Ga0451789_0403566_71_616	172
222	3300046453	Ga0495627_006153	Ga0495627_006153_3835_4389	172
223	3300046515	Ga0495620_0006209	Ga0495620_0006209_436_990	172
224	3300046530	Ga0495654_0050512	Ga0495654_0050512_962_1516	172
225	3300046660	Ga0495625_0059712	Ga0495625_0059712_221_775	172
226	3300046665	Ga0495661_0139518	Ga0495661_0139518_708_1262	172
227	3300046692	Ga0495671_0008992	Ga0495671_0008992_2636_3190	172
228	3300046810	Ga0495660_0087303	Ga0495660_0087303_752_1306	172
229	3300047470	Ga0495681_0141199	Ga0495681_0141199_167_721	172
230	3300053079	Ga0500610_0003655	Ga0500610_0003655_3820_4374	172
231	3300053087	Ga0500643_060439	Ga0500643_060439_110_664	172
232	3300053109	Ga0500569_011150	Ga0500569_011150_1469_2023	172
233	3300053117	Ga0500593_000418	Ga0500593_000418_7708_8262	172
234	3300053161	Ga0500634_0100346	Ga0500634_0100346_546_1100	172
235	iso_pu_bacteria	2945972063	2945973740	172
236	3300009551	Ga0105238_10500816	Ga0105238_105008161	173
237	3300015265	Ga0182005_1049787	Ga0182005_10497872	173
238	3300031251	Ga0265327_10011972	Ga0265327_100119723	173
239	3300031548	Ga0307408_100946052	Ga0307408_1009460521	173
240	3300046460	Ga0495638_0006266	Ga0495638_0006266_6877_7398	173
241	3300046512	Ga0495610_0007865	Ga0495610_0007865_3456_3977	173
242	3300046513	Ga0495616_0004664	Ga0495616_0004664_1140_1661	173
243	3300046518	Ga0495631_0000007	Ga0495631_0000007_33268_33789	173
244	3300046520	Ga0495637_0037944	Ga0495637_0037944_1241_1762	173
245	3300046530	Ga0495654_0018839	Ga0495654_0018839_322_843	173
246	3300046539	Ga0495621_0003176	Ga0495621_0003176_3161_3682	173
247	3300046557	Ga0495622_0164270	Ga0495622_0164270_424_945	173
248	3300046660	Ga0495625_0020265	Ga0495625_0020265_3953_4474	173
249	3300048910	Ga0496107_0967812	Ga0496107_0967812_19_540	173
250	3300048921	Ga0496118_0148069	Ga0496118_0148069_329_850	173
251	3300048924	Ga0496121_0096494	Ga0496121_0096494_1213_1734	173
252	3300048925	Ga0496122_0193809	Ga0496122_0193809_150_671	173
253	3300048926	Ga0496123_0110848	Ga0496123_0110848_638_1159	173
254	3300048927	Ga0496124_0134490	Ga0496124_0134490_840_1370	173
255	3300053116	Ga0500592_006961	Ga0500592_006961_1056_1577	173
256	3300053118	Ga0500594_0002466	Ga0500594_0002466_199_720	173
257	3300053129	Ga0500628_064217	Ga0500628_064217_256_777	173
258	3300053134	Ga0500658_0000294	Ga0500658_0000294_1527_2048	173
259	3300053139	Ga0500568_0000934	Ga0500568_0000934_900_1421	173
260	3300053153	Ga0500616_0024757	Ga0500616_0024757_1548_2069	173
261	iso_pu_bacteria	2643221683	2644465927	173
262	iso_pu_bacteria	2831265667	2831269747	173
263	iso_pu_bacteria	2838054893	2838055235	173
264	iso_pu_bacteria	2842733646	2842734069	173
265	iso_pu_bacteria	2842747753	2842749655	173
266	iso_pu_bacteria	2885198086	2885201678	173
267	iso_pu_bacteria	2885211737	2885215611	173
268	iso_pu_bacteria	2904449895	2904450963	173
269	iso_pu_bacteria	2904456579	2904459534	173
270	iso_pu_bacteria	2929520902	2929521648	173
271	3300005457	Ga0070662_100769609	Ga0070662_1007696092	174
272	3300006195	Ga0075366_10051080	Ga0075366_100510803	174
273	3300006195	Ga0075366_10063212	Ga0075366_100632122	174
274	3300006353	Ga0075370_10000501	Ga0075370_100005014	174
275	3300015265	Ga0182005_1045924	Ga0182005_10459242	174
276	3300046459	Ga0495629_0509214	Ga0495629_0509214_228_752	174
277	3300046558	Ga0495633_0160685	Ga0495633_0160685_234_794	174
278	3300046683	Ga0495658_0133002	Ga0495658_0133002_115_639	174
279	3300046690	Ga0495624_0105886	Ga0495624_0105886_891_1415	174
280	3300047321	Ga0495676_0113153	Ga0495676_0113153_1261_1785	174
281	3300047673	Ga0495593_0121748	Ga0495593_0121748_524_1048	174
282	3300048088	Ga0495602_0137363	Ga0495602_0137363_288_812	174
283	3300048089	Ga0495614_0015292	Ga0495614_0015292_204_728	174
284	3300050493	nmdc:mga0k408_385427_c1	nmdc:mga0k408_385427_c1_143_697	174
285	3300050493	nmdc:mga0k408_63391_c1	nmdc:mga0k408_63391_c1_1004_1564	174
286	3300050496	nmdc:mga07m45_16187_c1	nmdc:mga07m45_16187_c1_1688_2248	174
287	3300053087	Ga0500643_019448	Ga0500643_019448_150_674	174
288	3300053093	Ga0500651_0003305	Ga0500651_0003305_2730_3254	174
289	3300053110	Ga0500571_000094	Ga0500571_000094_22573_23097	174
290	3300053111	Ga0500572_059810	Ga0500572_059810_532_1056	174
291	3300053128	Ga0500626_011614	Ga0500626_011614_3104_3628	174
292	3300053133	Ga0500655_002551	Ga0500655_002551_2554_3078	174
293	3300053134	Ga0500658_0006263	Ga0500658_0006263_2373_2897	174
294	3300053138	Ga0500564_021741	Ga0500564_021741_2362_2886	174
295	3300053161	Ga0500634_0005044	Ga0500634_0005044_4087_4611	174
296	3300053162	Ga0500638_025511	Ga0500638_025511_2232_2756	174
297	3300053177	Ga0500636_0100672	Ga0500636_0100672_1055_1579	174
298	iso_pu_bacteria	2599185214	2599620793	174
299	iso_pu_bacteria	2599185226	2599674092	174
300	iso_pu_bacteria	2599185227	2599678591	174
301	iso_pu_bacteria	2599185229	2599690304	174
302	iso_pu_bacteria	2738541277	2738720643	174
303	iso_pu_bacteria	2738543019	2739279842	174
304	iso_pu_bacteria	2818991446	2819601326	174
305	iso_pu_bacteria	2899924645	2899927325	174
306	iso_pu_bacteria	2928037797	2928042761	174
307	iso_pu_bacteria	2928044640	2928048812	174
308	iso_pu_bacteria	2928051484	2928055144	174
309	iso_pu_bacteria	2928064002	2928068570	174
310	iso_pu_bacteria	2928070936	2928073521	174
311	3300003781	Ga0055536_1007752	Ga0055536_10077526	175
312	3300003792	Ga0055540_1001630	Ga0055540_10016306	175
313	3300003792	Ga0055540_1002823	Ga0055540_10028232	175
314	3300003794	Ga0055531_10001733	Ga0055531_1000173316	175
315	3300005344	Ga0070661_100093447	Ga0070661_1000934472	175
316	3300005347	Ga0070668_100145027	Ga0070668_1001450272	175
317	3300005366	Ga0070659_101499318	Ga0070659_1014993181	175
318	3300005367	Ga0070667_100095104	Ga0070667_1000951043	175
319	3300005457	Ga0070662_100068200	Ga0070662_1000682003	175
320	3300005564	Ga0070664_100006820	Ga0070664_1000068206	175
321	3300005578	Ga0068854_100655687	Ga0068854_1006556872	175
322	3300005616	Ga0068852_100144373	Ga0068852_1001443731	175
323	3300005616	Ga0068852_100294452	Ga0068852_1002944523	175
324	3300006038	Ga0075365_10027126	Ga0075365_100271261	175
325	3300006048	Ga0075363_100008315	Ga0075363_1000083155	175
326	3300006048	Ga0075363_100325339	Ga0075363_1003253392	175
327	3300006051	Ga0075364_10008381	Ga0075364_100083812	175
328	3300006058	Ga0075432_10003135	Ga0075432_100031352	175
329	3300006195	Ga0075366_10023943	Ga0075366_100239433	175
330	3300006358	Ga0068871_100169454	Ga0068871_1001694542	175
331	3300009036	Ga0105244_10005868	Ga0105244_100058683	175
332	3300009098	Ga0105245_10209977	Ga0105245_102099773	175
333	3300009148	Ga0105243_10008424	Ga0105243_100084242	175
334	3300013100	Ga0157373_10605655	Ga0157373_106056551	175
335	3300013308	Ga0157375_10101939	Ga0157375_101019393	175
336	3300014497	Ga0182008_10002045	Ga0182008_100020454	175
337	3300015261	Ga0182006_1000912	Ga0182006_10009123	175
338	3300015262	Ga0182007_10000369	Ga0182007_1000036910	175
339	3300025292	Ga0209676_1000135	Ga0209676_1000135168	175
340	3300025292	Ga0209676_1000486	Ga0209676_100048630	175
341	3300025298	Ga0209050_1000100	Ga0209050_100010016	175
342	3300025298	Ga0209050_1076348	Ga0209050_10763482	175
343	3300025303	Ga0209051_1000067	Ga0209051_1000067211	175
344	3300025303	Ga0209051_1000255	Ga0209051_100025550	175
345	3300025304	Ga0209257_1000095	Ga0209257_100009530	175
346	3300025304	Ga0209257_1020393	Ga0209257_10203932	175
347	3300025728	Ga0207655_1000689	Ga0207655_100068934	175
348	3300025903	Ga0207680_10119142	Ga0207680_101191422	175
349	3300025919	Ga0207657_10196983	Ga0207657_101969832	175
350	3300025924	Ga0207694_10035770	Ga0207694_100357704	175
351	3300025933	Ga0207706_10039768	Ga0207706_100397684	175
352	3300025935	Ga0207709_10001078	Ga0207709_100010783	175
353	3300025945	Ga0207679_10013445	Ga0207679_100134454	175
354	3300025986	Ga0207658_10015383	Ga0207658_100153832	175
355	3300026023	Ga0207677_10741722	Ga0207677_107417221	175
356	3300026116	Ga0207674_10945018	Ga0207674_109450181	175
357	3300026142	Ga0207698_10579277	Ga0207698_105792772	175
358	3300027907	Ga0207428_10052866	Ga0207428_100528663	175
359	3300030731	Ga0316177_1013268	Ga0316177_10132682	175
360	3300030733	Ga0314311_1021624	Ga0314311_10216241	175
361	3300030734	Ga0316179_1047388	Ga0316179_10473882	175
362	3300030735	Ga0316178_1101787	Ga0316178_11017871	175
363	3300030742	Ga0316183_1001871	Ga0316183_10018716	175
364	3300030744	Ga0316181_1002978	Ga0316181_10029782	175
365	3300030745	Ga0316182_1278050	Ga0316182_12780504	175
366	3300031548	Ga0307408_100070783	Ga0307408_1000707833	175
367	3300031901	Ga0307406_10516157	Ga0307406_105161571	175
368	3300031903	Ga0307407_10896603	Ga0307407_108966031	175
369	3300031911	Ga0307412_10007802	Ga0307412_100078024	175
370	3300032005	Ga0307411_10163994	Ga0307411_101639942	175
371	3300032005	Ga0307411_10724277	Ga0307411_107242772	175
372	3300041410	Ga0439461_0009560	Ga0439461_0009560_237_797	175
373	3300042004	Ga0439445_0023153	Ga0439445_0023153_260_802	175
374	3300042007	Ga0439449_0031768	Ga0439449_0031768_774_1337	175
375	3300046459	Ga0495629_0360920	Ga0495629_0360920_240_803	175
376	3300046475	Ga0495639_0005608	Ga0495639_0005608_1791_2354	175
377	3300046499	Ga0495594_0252249	Ga0495594_0252249_58_621	175
378	3300046518	Ga0495631_0206010	Ga0495631_0206010_104_667	175
379	3300046557	Ga0495622_0152792	Ga0495622_0152792_366_929	175
380	3300046660	Ga0495625_0000329	Ga0495625_0000329_34567_35130	175
381	3300046674	Ga0495588_0130658	Ga0495588_0130658_175_738	175
382	3300047470	Ga0495681_0168137	Ga0495681_0168137_253_816	175
383	3300048903	Ga0496100_0004437	Ga0496100_0004437_3638_4201	175
384	3300048904	Ga0496101_0001066	Ga0496101_0001066_8713_9276	175
385	3300048905	Ga0496102_0018763	Ga0496102_0018763_2020_2583	175
386	3300048906	Ga0496103_0003524	Ga0496103_0003524_4396_4959	175
387	3300048907	Ga0496104_0000492	Ga0496104_0000492_33156_33719	175
388	3300048908	Ga0496105_0018916	Ga0496105_0018916_1364_1927	175
389	3300048909	Ga0496106_0040288	Ga0496106_0040288_516_1079	175
390	3300048910	Ga0496107_0082402	Ga0496107_0082402_759_1322	175
391	3300048911	Ga0496108_0049069	Ga0496108_0049069_342_905	175
392	3300048912	Ga0496109_0571048	Ga0496109_0571048_207_770	175
393	3300048913	Ga0496110_0040648	Ga0496110_0040648_2266_2829	175
394	3300048913	Ga0496110_0070394	Ga0496110_0070394_935_1498	175
395	3300048916	Ga0496113_0219179	Ga0496113_0219179_434_997	175
396	3300048917	Ga0496114_0051259	Ga0496114_0051259_2345_2908	175
397	3300048920	Ga0496117_0284600	Ga0496117_0284600_192_719	175
398	3300048921	Ga0496118_0116765	Ga0496118_0116765_1114_1641	175
399	3300048927	Ga0496124_0081463	Ga0496124_0081463_1998_2525	175
400	3300048928	Ga0496125_0037932	Ga0496125_0037932_580_1107	175
401	3300049759	Ga0501262_002177	Ga0501262_002177_1032_1595	175
402	3300050491	nmdc:mga00v17_137766_c1	nmdc:mga00v17_137766_c1_206_763	175
403	3300050491	nmdc:mga00v17_2256_c1	nmdc:mga00v17_2256_c1_4176_4739	175
404	3300050492	nmdc:mga0yw44_2645_c1	nmdc:mga0yw44_2645_c1_3678_4241	175
405	3300050493	nmdc:mga0k408_785_c1	nmdc:mga0k408_785_c1_4675_5238	175
406	3300050494	nmdc:mga06z11_348643_c1	nmdc:mga06z11_348643_c1_58_585	175
407	iso_pu_bacteria	2904541872	2904549224	175
408	iso_pu_bacteria	2928115317	2928117182	175
409	iso_pu_bacteria	2929160207	2929161400	175
410	3300003773	Ga0055537_1000232	Ga0055537_10002322	176
411	3300003784	Ga0055534_1000240	Ga0055534_100024035	176
412	3300003790	Ga0055528_1007620	Ga0055528_10076202	176
413	3300005339	Ga0070660_100463867	Ga0070660_1004638671	176
414	3300005563	Ga0068855_100043769	Ga0068855_1000437694	176
415	3300006353	Ga0075370_10014095	Ga0075370_100140952	176
416	3300006948	Ga0099826_10000873	Ga0099826_1000087310	176
417	3300009148	Ga0105243_10102686	Ga0105243_101026863	176
418	3300009176	Ga0105242_11428300	Ga0105242_114283001	176
419	3300009545	Ga0105237_10061664	Ga0105237_100616642	176
420	3300010375	Ga0105239_10084524	Ga0105239_100845244	176
421	3300014325	Ga0163163_10402265	Ga0163163_104022653	176
422	3300017792	Ga0163161_10892754	Ga0163161_108927541	176
423	3300025263	Ga0209565_1000117	Ga0209565_100011769	176
424	3300025273	Ga0209673_1000218	Ga0209673_100021836	176
425	3300025291	Ga0209675_1000113	Ga0209675_100011369	176
426	3300025914	Ga0207671_10058924	Ga0207671_100589242	176
427	3300025935	Ga0207709_10137286	Ga0207709_101372862	176
428	3300025949	Ga0207667_10026911	Ga0207667_100269114	176
429	3300026142	Ga0207698_10875541	Ga0207698_108755412	176
430	3300027666	Ga0209282_1000188	Ga0209282_100018826	176
431	3300031649	Ga0307514_10013497	Ga0307514_100134972	176
432	3300048921	Ga0496118_0330614	Ga0496118_0330614_18_578	176
433	3300048925	Ga0496122_0189054	Ga0496122_0189054_431_991	176
434	3300048927	Ga0496124_0149861	Ga0496124_0149861_737_1297	176
435	3300050494	nmdc:mga06z11_214658_c1	nmdc:mga06z11_214658_c1_14_580	176
436	3300050496	nmdc:mga07m45_9092_c1	nmdc:mga07m45_9092_c1_693_1259	176
437	3300003578	Ga0006562J51391_1080333	Ga0006562J51391_10803337	177
438	3300003578	Ga0006562J51391_1080335	Ga0006562J51391_10803353	177
439	3300003781	Ga0055536_1021169	Ga0055536_10211693	177
440	3300003791	Ga0055530_10001195	Ga0055530_1000119520	177
441	3300003792	Ga0055540_1017682	Ga0055540_10176822	177
442	3300003794	Ga0055531_10027677	Ga0055531_100276772	177
443	3300005353	Ga0070669_100016550	Ga0070669_1000165502	177
444	3300006353	Ga0075370_10001916	Ga0075370_100019166	177
445	3300006358	Ga0068871_100723415	Ga0068871_1007234152	177
446	3300009148	Ga0105243_10004578	Ga0105243_100045783	177
447	3300013100	Ga0157373_10013592	Ga0157373_100135923	177
448	3300014497	Ga0182008_10003530	Ga0182008_1000353010	177
449	3300015261	Ga0182006_1037433	Ga0182006_10374332	177
450	3300025292	Ga0209676_1000028	Ga0209676_1000028473	177
451	3300025292	Ga0209676_1000216	Ga0209676_100021646	177
452	3300025298	Ga0209050_1000072	Ga0209050_1000072230	177
453	3300025298	Ga0209050_1000133	Ga0209050_100013337	177
454	3300025303	Ga0209051_1000015	Ga0209051_1000015402	177
455	3300025303	Ga0209051_1000440	Ga0209051_10004404	177
456	3300025304	Ga0209257_1000037	Ga0209257_1000037343	177
457	3300025923	Ga0207681_10123126	Ga0207681_101231262	177
458	3300025935	Ga0207709_10000320	Ga0207709_100003209	177
459	3300031548	Ga0307408_100031931	Ga0307408_1000319314	177
460	3300031731	Ga0307405_10081138	Ga0307405_100811382	177
461	3300031731	Ga0307405_10881905	Ga0307405_108819051	177
462	3300031901	Ga0307406_10003412	Ga0307406_100034124	177
463	3300031911	Ga0307412_10109485	Ga0307412_101094852	177
464	3300032005	Ga0307411_10236825	Ga0307411_102368252	177
465	3300048904	Ga0496101_0051980	Ga0496101_0051980_134_712	177
466	3300049459	Ga0495678_174114	Ga0495678_174114_71_613	177
467	3300049671	Ga0501238_009950	Ga0501238_009950_259_801	177
468	3300050496	nmdc:mga07m45_1301_c1	nmdc:mga07m45_1301_c1_4720_5289	177
469	3300053122	Ga0500608_086187	Ga0500608_086187_871_1440	177
470	3300053136	Ga0500559_0019648	Ga0500559_0019648_28_597	177
471	3300053136	Ga0500559_0049493	Ga0500559_0049493_391_960	177
472	3300003323	rootH1_10061875	rootH1_100618752	178
473	3300003761	Ga0055535_1000069	Ga0055535_10000699	178
474	3300003762	Ga0055542_1000084	Ga0055542_100008420	178
475	3300003792	Ga0055540_1009083	Ga0055540_10090832	178
476	3300005834	Ga0068851_10006495	Ga0068851_100064955	178
477	3300025228	Ga0209672_100822	Ga0209672_1008228	178
478	3300025229	Ga0209147_100554	Ga0209147_10055413	178
479	3300025242	Ga0209258_100093	Ga0209258_100093199	178
480	3300025254	Ga0209148_1000007	Ga0209148_10000071167	178
481	3300025292	Ga0209676_1005087	Ga0209676_10050877	178
482	3300025321	Ga0207656_10003746	Ga0207656_100037463	178
483	3300001989	JGI24739J22299_10034404	JGI24739J22299_100344042	184
484	3300005539	Ga0068853_100239204	Ga0068853_1002392042	184
485	3300009093	Ga0105240_10077823	Ga0105240_100778232	184
486	3300013104	Ga0157370_10762022	Ga0157370_107620222	184
487	3300026041	Ga0207639_10002635	Ga0207639_1000263510	184
488	3300048920	Ga0496117_0112833	Ga0496117_0112833_203_757	184
489	3300048921	Ga0496118_0033749	Ga0496118_0033749_346_900	184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02308

MgtC

MgtC family

33

159

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8byi-assembly1.cif.gz_A	alvinella pompejana nicotinic acetylcholine receptor alpo4 in complex with chaps(alpo4_chaps)	0.4522	55	160
1yo7-assembly2.cif.gz_B	re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle	0.4326	26	134
1yo7-assembly2.cif.gz_B	re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle	0.4072	26	134
6pls-assembly1.cif.gz_A	cryoem structure of zebra fish alpha-1 glycine receptor bound with taurine in nanodisc, desensitized state	0.3864	57	162
4dbl-assembly2.cif.gz_F	crystal structure of e159q mutant of btucdf	0.382	25	146

ID	Description	Score	Start	End	Superfamily
af_I6YBN6_13_134_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.9239	32	154	1.10.10.1740
af_I6YBN6_13_134_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.8877	32	154	1.10.10.1740
af_P0AFV2_9_138_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.8848	32	155	1.10.10.1740
af_P0AFV2_9_138_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.8397	32	155	1.10.10.1740
af_Q9VYW6_178_371_1.20.1540.10	Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like	0.6049	29	130	1.20.1540.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1G7Z609-F1-model_v4	Protein MgtC	0.953	25	154	GO:0005886
AF-A0A1M4YUW1-F1-model_v4	Protein MgtC	0.9404	20	156	GO:0005886
AF-A0A4Q5PCM1-F1-model_v4	Protein MgtC	0.9392	5	163	GO:0005886
AF-A0A7T9FJY9-F1-model_v4	deleted	0.9378	20	159
AF-O51796-F1-model_v4	Protein MgtC	0.9364	32	153	GO:0005886

Feature Viewer

pLDDT	pTM	Quality
80.5	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F453754

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02308

MgtC

MgtC family

33

159

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map