F453631

General Info

Members Datasets Scaffolds Average Seq Length
488 235 976 130

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0436738|Ga0373934_0436738_31_483
Length 150
Sequence VDGRVDDAVDAGSGDSGIFLRGEDVMKRSLIATALLLSVVPVFAHHSFDAEYDAGKVTNISGFVTKVDWQNPHAFVYVDVTDKSGAVQSYRVEMGPPYALVRGGWKRDTVKVGDKVTVEGAALAKDGSNAAGSMPTTMMVLSTGQKLVMR

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.82
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 40.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0436738 3300035086 Unclassified 548
2 MBSR1b_contig_11072870 2162886012 Bacteria 991
3 MBSR1b_contig_338865 2162886012 Unclassified 827
4 JGI25406J46586_10095206 3300003203 Bacteria 893
5 Ga0058859_11760531 3300004798 Unclassified 683
6 Ga0058860_12069598 3300004801 Bacteria 1111
7 Ga0058860_12084096 3300004801 Unclassified 695
8 Ga0058862_11798068 3300004803 Unclassified 1693
9 Ga0065712_10248370 3300005290 Unclassified 966
10 Ga0065715_10182606 3300005293 Bacteria 1466
11 Ga0065715_10326822 3300005293 Bacteria 991
12 Ga0065715_10456835 3300005293 Bacteria 820
13 Ga0070683_100139228 3300005329 Bacteria 2299
14 Ga0070683_100425000 3300005329 Bacteria 1268
15 Ga0070683_100472058 3300005329 Bacteria 1198
16 Ga0070690_100093305 3300005330 Bacteria 1985
17 Ga0070690_100153381 3300005330 Bacteria 1573
18 Ga0070690_100302070 3300005330 Bacteria 1148
19 Ga0070670_100102620 3300005331 Bacteria 2463
20 Ga0070670_101472995 3300005331 Unclassified 625
21 Ga0068869_100079273 3300005334 Bacteria 2447
22 Ga0068869_101049155 3300005334 Unclassified 711
23 Ga0068869_101055924 3300005334 Unclassified 709
24 Ga0070666_10347653 3300005335 Unclassified 1060
25 Ga0070666_10355626 3300005335 Bacteria 1049
26 Ga0070666_10604031 3300005335 Unclassified 801
27 Ga0070680_100783682 3300005336 Bacteria 821
28 Ga0068868_100055741 3300005338 Unclassified 3120
29 Ga0068868_100198084 3300005338 Bacteria 1673
30 Ga0068868_100859616 3300005338 Unclassified 822
31 Ga0068868_102038790 3300005338 Bacteria 545
32 Ga0070689_100029775 3300005340 Bacteria 4137
33 Ga0070689_100832381 3300005340 Unclassified 813
34 Ga0070689_101400650 3300005340 Unclassified 632
35 Ga0070691_10400829 3300005341 Bacteria 773
36 Ga0070687_100137158 3300005343 Bacteria 1420
37 Ga0070687_100147951 3300005343 Bacteria 1375
38 Ga0070661_100093797 3300005344 Unclassified 2224
39 Ga0070692_10287608 3300005345 Bacteria 999
40 Ga0070692_10828215 3300005345 Unclassified 634
41 Ga0070669_100094230 3300005353 Bacteria 2250
42 Ga0070669_100362381 3300005353 Bacteria 1179
43 Ga0070669_101625773 3300005353 Unclassified 563
44 Ga0070675_100000061 3300005354 Bacteria 66703
45 Ga0070675_100001628 3300005354 Bacteria 16576
46 Ga0070675_100037849 3300005354 Bacteria 3931
47 Ga0070675_100073101 3300005354 Viruses 2846
48 Ga0070675_100101078 3300005354 Unclassified 2429
49 Ga0070675_100425787 3300005354 Bacteria 1187
50 Ga0070675_101092067 3300005354 Unclassified 733
51 Ga0070671_100016575 3300005355 Bacteria 5956
52 Ga0070671_100030578 3300005355 Bacteria 4444
53 Ga0070671_100243155 3300005355 Bacteria 1528
54 Ga0070671_100449278 3300005355 Bacteria 1106
55 Ga0070674_100545688 3300005356 Bacteria 972
56 Ga0070674_100651805 3300005356 Unclassified 895
57 Ga0070673_100046404 3300005364 Bacteria 3375
58 Ga0070673_100055482 3300005364 Bacteria 3122
59 Ga0070673_100056573 3300005364 Bacteria 3095
60 Ga0070673_100213298 3300005364 Bacteria 1668
61 Ga0070673_101422755 3300005364 Unclassified 653
62 Ga0070688_100053280 3300005365 Unclassified 2530
63 Ga0070688_100088883 3300005365 Bacteria 2015
64 Ga0070688_100385892 3300005365 Bacteria 1034
65 Ga0070688_101145373 3300005365 Unclassified 623
66 Ga0070667_100010383 3300005367 Bacteria 7687
67 Ga0070667_100018544 3300005367 Bacteria 5773
68 Ga0070667_100152680 3300005367 Bacteria 2029
69 Ga0070703_10095663 3300005406 Unclassified 1038
70 Ga0070709_10312983 3300005434 Bacteria 1150
71 Ga0070713_100770412 3300005436 Unclassified 921
72 Ga0070701_10355524 3300005438 Bacteria 916
73 Ga0070711_100142648 3300005439 Bacteria 1798
74 Ga0070694_100220676 3300005444 Unclassified 1422
75 Ga0070708_100360043 3300005445 Bacteria 1371
76 Ga0070708_102125718 3300005445 Unclassified 519
77 Ga0070678_100283650 3300005456 Bacteria 1401
78 Ga0070678_100646822 3300005456 Unclassified 948
79 Ga0070678_100713336 3300005456 Unclassified 904
80 Ga0070678_100923604 3300005456 Unclassified 799
81 Ga0070662_101081229 3300005457 Unclassified 688
82 Ga0070681_10199742 3300005458 Unclassified 1918
83 Ga0070681_10566564 3300005458 Unclassified 1050
84 Ga0068867_100008192 3300005459 Bacteria 7383
85 Ga0070685_10011078 3300005466 Unclassified 4708
86 Ga0070685_10191429 3300005466 Bacteria 1324
87 Ga0070706_100816698 3300005467 Unclassified 863
88 Ga0070707_100015483 3300005468 Bacteria 7156
89 Ga0070707_100115431 3300005468 Bacteria 2606
90 Ga0070699_100179084 3300005518 Bacteria 1881
91 Ga0070699_100718643 3300005518 Bacteria 913
92 Ga0070684_100274384 3300005535 Bacteria 1544
93 Ga0070697_100352534 3300005536 Bacteria 1271
94 Ga0070672_100000416 3300005543 Bacteria 24708
95 Ga0070672_100095543 3300005543 Unclassified 2403
96 Ga0070672_100456997 3300005543 Bacteria 1100
97 Ga0070672_100488885 3300005543 Bacteria 1063
98 Ga0070672_100570519 3300005543 Unclassified 984
99 Ga0070672_101291532 3300005543 Bacteria 651
100 Ga0070686_100359834 3300005544 Unclassified 1096
101 Ga0070686_101325670 3300005544 Unclassified 602
102 Ga0070696_100506859 3300005546 Bacteria 961
103 Ga0070665_101561462 3300005548 Unclassified 668
104 Ga0070664_100011914 3300005564 Bacteria 7058
105 Ga0070664_100085229 3300005564 Bacteria 2728
106 Ga0070664_100463966 3300005564 Bacteria 1164
107 Ga0068857_100335834 3300005577 Bacteria 1397
108 Ga0068854_100011583 3300005578 Bacteria 5749
109 Ga0068854_100200027 3300005578 Bacteria 1570
110 Ga0070702_100080463 3300005615 Bacteria 1950
111 Ga0070702_100972365 3300005615 Bacteria 670
112 Ga0068852_100414353 3300005616 Unclassified 1328
113 Ga0068852_100508676 3300005616 Bacteria 1200
114 Ga0068859_100000802 3300005617 Bacteria 31882
115 Ga0068859_100002156 3300005617 Bacteria 20001
116 Ga0068859_100309163 3300005617 Unclassified 1674
117 Ga0068859_100392286 3300005617 Bacteria 1484
118 Ga0068859_100402121 3300005617 Bacteria 1465
119 Ga0068859_100486728 3300005617 Bacteria 1329
120 Ga0068864_100005710 3300005618 Bacteria 10203
121 Ga0068864_100019841 3300005618 Bacteria 5621
122 Ga0068864_100447319 3300005618 Bacteria 1235
123 Ga0068864_100587053 3300005618 Bacteria 1080
124 Ga0068864_101439652 3300005618 Unclassified 691
125 Ga0068866_10049645 3300005718 Unclassified 2127
126 Ga0068866_11174241 3300005718 Bacteria 553
127 Ga0068861_101696074 3300005719 Unclassified 625
128 Ga0068851_10010834 3300005834 Unclassified 4261
129 Ga0068870_10308338 3300005840 Bacteria 1002
130 Ga0068870_10635604 3300005840 Bacteria 729
131 Ga0068863_100000177 3300005841 Bacteria 67749
132 Ga0068863_100023114 3300005841 Bacteria 5941
133 Ga0068863_100992327 3300005841 Unclassified 842
134 Ga0068863_101229777 3300005841 Unclassified 755
135 Ga0068858_100061317 3300005842 Bacteria 3477
136 Ga0068858_100376673 3300005842 Unclassified 1362
137 Ga0068858_100753847 3300005842 Bacteria 949
138 Ga0068860_100010871 3300005843 Bacteria 8977
139 Ga0068860_100135292 3300005843 Bacteria 2366
140 Ga0068860_100180238 3300005843 Unclassified 2042
141 Ga0068860_100649315 3300005843 Bacteria 1063
142 Ga0068860_101101631 3300005843 Unclassified 813
143 Ga0068862_100398622 3300005844 Unclassified 1287
144 Ga0068862_100630481 3300005844 Unclassified 1032
145 Ga0068862_101246282 3300005844 Unclassified 743
146 Ga0068862_102240016 3300005844 Unclassified 558
147 Ga0081539_10031200 3300005985 Bacteria 3290
148 Ga0070712_100049835 3300006175 Unclassified 2910
149 Ga0097621_100005879 3300006237 Bacteria 8668
150 Ga0097621_100043013 3300006237 Bacteria 3640
151 Ga0097621_100131753 3300006237 Bacteria 2129
152 Ga0097621_100278453 3300006237 Unclassified 1472
153 Ga0097621_100497672 3300006237 Bacteria 1104
154 Ga0097621_101110307 3300006237 Unclassified 743
155 Ga0097621_101822510 3300006237 Bacteria 580
156 Ga0068871_100001631 3300006358 Bacteria 15107
157 Ga0068871_100006789 3300006358 Bacteria 8135
158 Ga0068871_100540305 3300006358 Bacteria 1055
159 Ga0068871_100608712 3300006358 Unclassified 994
160 Ga0068871_101227082 3300006358 Bacteria 704
161 Ga0075428_100196884 3300006844 Bacteria 2179
162 Ga0075428_100904261 3300006844 Unclassified 936
163 Ga0075428_102339897 3300006844 Unclassified 549
164 Ga0075430_100218156 3300006846 Bacteria 1583
165 Ga0075430_100367895 3300006846 Bacteria 1187
166 Ga0075431_100164226 3300006847 Unclassified 2283
167 Ga0075433_11184796 3300006852 Bacteria 663
168 Ga0075434_100060675 3300006871 Unclassified 3761
169 Ga0075434_100569762 3300006871 Unclassified 1152
170 Ga0075429_100480463 3300006880 Bacteria 1089
171 Ga0068865_100591019 3300006881 Unclassified 937
172 Ga0068865_100999347 3300006881 Unclassified 732
173 Ga0075436_101492569 3300006914 Unclassified 513
174 Ga0097620_100000802 3300006931 Bacteria 31882
175 Ga0097620_100002156 3300006931 Bacteria 20001
176 Ga0097620_100309170 3300006931 Unclassified 1674
177 Ga0097620_100392310 3300006931 Bacteria 1484
178 Ga0097620_100402116 3300006931 Bacteria 1465
179 Ga0097620_100486705 3300006931 Bacteria 1329
180 Ga0099794_10090571 3300007265 Unclassified 1517
181 Ga0111539_10004517 3300009094 Bacteria 18197
182 Ga0111539_10086743 3300009094 Bacteria 3677
183 Ga0111539_10795873 3300009094 Bacteria 1100
184 Ga0105245_10701590 3300009098 Bacteria 1045
185 Ga0105245_12427254 3300009098 Bacteria 578
186 Ga0114129_10000075 3300009147 Bacteria 91461
187 Ga0114129_10543910 3300009147 Unclassified 1511
188 Ga0105243_10677119 3300009148 Bacteria 1003
189 Ga0105242_10709676 3300009176 Bacteria 985
190 Ga0105242_10847984 3300009176 Unclassified 909
191 Ga0105242_10978114 3300009176 Bacteria 852
192 Ga0105242_11066958 3300009176 Unclassified 820
193 Ga0105242_13124881 3300009176 Unclassified 513
194 Ga0105248_10003400 3300009177 Bacteria 17670
195 Ga0105248_10074994 3300009177 Bacteria 3802
196 Ga0105248_10345205 3300009177 Bacteria 1676
197 Ga0105238_10019275 3300009551 Bacteria 6950
198 Ga0105238_12280410 3300009551 Unclassified 576
199 Ga0105249_10212443 3300009553 Unclassified 1899
200 Ga0105249_10313431 3300009553 Bacteria 1578
201 Ga0105249_10666040 3300009553 Bacteria 1099
202 Ga0105249_10783774 3300009553 Unclassified 1017
203 Ga0105249_11738606 3300009553 Bacteria 696
204 Ga0105246_10224349 3300011119 Bacteria 1475
205 Ga0105246_10420385 3300011119 Bacteria 1115
206 Ga0157374_10071832 3300013296 Bacteria 3264
207 Ga0157374_10130083 3300013296 Bacteria 2436
208 Ga0157374_11679938 3300013296 Unclassified 660
209 Ga0157378_10006402 3300013297 Bacteria 10295
210 Ga0157378_11580563 3300013297 Unclassified 701
211 Ga0157378_11944259 3300013297 Bacteria 638
212 Ga0157378_12765727 3300013297 Unclassified 543
213 Ga0163162_10119859 3300013306 Unclassified 2734
214 Ga0163162_10365851 3300013306 Bacteria 1575
215 Ga0163162_10441827 3300013306 Bacteria 1433
216 Ga0163162_10709688 3300013306 Unclassified 1127
217 Ga0163162_11113822 3300013306 Viruses 895
218 Ga0157375_10007813 3300013308 Bacteria 9359
219 Ga0157375_10404798 3300013308 Bacteria 1531
220 Ga0157375_10551647 3300013308 Unclassified 1314
221 Ga0163163_10023940 3300014325 Bacteria 5806
222 Ga0163163_10029421 3300014325 Bacteria 5284
223 Ga0163163_10087210 3300014325 Bacteria 3131
224 Ga0163163_10108056 3300014325 Unclassified 2809
225 Ga0157380_10020176 3300014326 Bacteria 4979
226 Ga0157380_10237086 3300014326 Bacteria 1642
227 Ga0157380_10557904 3300014326 Bacteria 1125
228 Ga0157377_10260895 3300014745 Unclassified 1127
229 Ga0157377_10293284 3300014745 Unclassified 1071
230 Ga0157377_10425939 3300014745 Bacteria 910
231 Ga0157376_10162582 3300014969 Bacteria 2025
232 Ga0157376_10455401 3300014969 Bacteria 1249
233 Ga0157376_11188483 3300014969 Unclassified 790
234 Ga0157376_11247536 3300014969 Unclassified 772
235 Ga0157376_11698088 3300014969 Unclassified 667
236 Ga0163161_10197831 3300017792 Bacteria 1548
237 Ga0163161_10208493 3300017792 Unclassified 1509
238 Ga0163161_10446719 3300017792 Unclassified 1044
239 Ga0213876_10045058 3300021384 Unclassified 2333
240 Ga0213876_10092036 3300021384 Unclassified 1606
241 Ga0213875_10006968 3300021388 Bacteria 5882
242 Ga0207697_10283090 3300025315 Unclassified 735
243 Ga0207656_10040085 3300025321 Bacteria 1984
244 Ga0207682_10006087 3300025893 Unclassified 4877
245 Ga0207682_10412701 3300025893 Unclassified 638
246 Ga0207642_10101452 3300025899 Bacteria 1445
247 Ga0207688_10277428 3300025901 Bacteria 1020
248 Ga0207688_10455163 3300025901 Unclassified 798
249 Ga0207680_10005014 3300025903 Bacteria 6307
250 Ga0207680_10061856 3300025903 Bacteria 2285
251 Ga0207647_10525215 3300025904 Unclassified 658
252 Ga0207699_10699251 3300025906 Unclassified 742
253 Ga0207645_10006572 3300025907 Bacteria 8319
254 Ga0207707_10249692 3300025912 Unclassified 1541
255 Ga0207663_10176643 3300025916 Unclassified 1521
256 Ga0207660_11048980 3300025917 Unclassified 665
257 Ga0207662_10213179 3300025918 Bacteria 1254
258 Ga0207649_10313171 3300025920 Bacteria 1151
259 Ga0207649_10657183 3300025920 Unclassified 810
260 Ga0207646_10098952 3300025922 Bacteria 2614
261 Ga0207646_10130046 3300025922 Bacteria 2266
262 Ga0207681_10848130 3300025923 Unclassified 764
263 Ga0207694_10277760 3300025924 Bacteria 1375
264 Ga0207659_10002029 3300025926 Bacteria 12008
265 Ga0207659_10038987 3300025926 Viruses 3309
266 Ga0207659_10563248 3300025926 Unclassified 969
267 Ga0207659_10851836 3300025926 Unclassified 783
268 Ga0207644_10061716 3300025931 Unclassified 2716
269 Ga0207644_10187953 3300025931 Bacteria 1623
270 Ga0207644_10581345 3300025931 Unclassified 929
271 Ga0207644_10797041 3300025931 Unclassified 790
272 Ga0207690_10027609 3300025932 Bacteria 3589
273 Ga0207690_10292472 3300025932 Unclassified 1272
274 Ga0207706_10032094 3300025933 Unclassified 4677
275 Ga0207706_10254519 3300025933 Bacteria 1533
276 Ga0207686_10227544 3300025934 Unclassified 1350
277 Ga0207686_10654181 3300025934 Unclassified 832
278 Ga0207686_11417141 3300025934 Bacteria 572
279 Ga0207709_10007547 3300025935 Bacteria 6044
280 Ga0207670_10235439 3300025936 Unclassified 1408
281 Ga0207670_10474451 3300025936 Bacteria 1012
282 Ga0207670_11109819 3300025936 Unclassified 668
283 Ga0207669_10097331 3300025937 Unclassified 1935
284 Ga0207669_10116130 3300025937 Bacteria 1806
285 Ga0207704_10023524 3300025938 Unclassified 3322
286 Ga0207665_11630484 3300025939 Bacteria 511
287 Ga0207691_10003943 3300025940 Bacteria 14415
288 Ga0207691_10111527 3300025940 Bacteria 2432
289 Ga0207691_10280394 3300025940 Unclassified 1434
290 Ga0207691_10506369 3300025940 Bacteria 1025
291 Ga0207691_10966333 3300025940 Bacteria 711
292 Ga0207711_10000890 3300025941 Bacteria 28793
293 Ga0207711_10040547 3300025941 Bacteria 3961
294 Ga0207711_10138576 3300025941 Unclassified 2187
295 Ga0207711_10272415 3300025941 Bacteria 1558
296 Ga0207711_11633714 3300025941 Unclassified 588
297 Ga0207689_10009055 3300025942 Bacteria 8622
298 Ga0207689_10580197 3300025942 Bacteria 943
299 Ga0207689_10904230 3300025942 Unclassified 745
300 Ga0207689_11353418 3300025942 Unclassified 597
301 Ga0207661_10182207 3300025944 Unclassified 1836
302 Ga0207661_10315567 3300025944 Bacteria 1404
303 Ga0207661_10543497 3300025944 Bacteria 1064
304 Ga0207679_10005387 3300025945 Bacteria 8015
305 Ga0207679_10102438 3300025945 Bacteria 2242
306 Ga0207679_10202794 3300025945 Bacteria 1658
307 Ga0207679_10212964 3300025945 Unclassified 1621
308 Ga0207651_10001451 3300025960 Bacteria 10783
309 Ga0207651_10048722 3300025960 Bacteria 2866
310 Ga0207651_11668364 3300025960 Unclassified 574
311 Ga0207712_10071674 3300025961 Bacteria 2492
312 Ga0207712_10766103 3300025961 Unclassified 846
313 Ga0207712_11191682 3300025961 Bacteria 679
314 Ga0207712_11408810 3300025961 Bacteria 624
315 Ga0207668_11032099 3300025972 Unclassified 736
316 Ga0207640_10016936 3300025981 Unclassified 4252
317 Ga0207640_10177684 3300025981 Bacteria 1593
318 Ga0207658_10097878 3300025986 Bacteria 2291
319 Ga0207658_10246461 3300025986 Unclassified 1516
320 Ga0207677_10065180 3300026023 Unclassified 2540
321 Ga0207677_10435291 3300026023 Bacteria 1120
322 Ga0207677_10735779 3300026023 Unclassified 878
323 Ga0207677_10999569 3300026023 Unclassified 758
324 Ga0207703_10012598 3300026035 Bacteria 6593
325 Ga0207703_10072816 3300026035 Bacteria 2841
326 Ga0207703_10119258 3300026035 Bacteria 2263
327 Ga0207703_10551942 3300026035 Unclassified 1086
328 Ga0207708_10042912 3300026075 Unclassified 3446
329 Ga0207708_11954828 3300026075 Bacteria 514
330 Ga0207641_10000472 3300026088 Bacteria 45544
331 Ga0207641_10001664 3300026088 Bacteria 21678
332 Ga0207641_10789982 3300026088 Bacteria 939
333 Ga0207648_10018502 3300026089 Bacteria 6305
334 Ga0207648_10630809 3300026089 Bacteria 989
335 Ga0207676_10109588 3300026095 Unclassified 2307
336 Ga0207676_10433608 3300026095 Bacteria 1235
337 Ga0207676_11150434 3300026095 Bacteria 768
338 Ga0207676_12058608 3300026095 Unclassified 569
339 Ga0207674_10128452 3300026116 Bacteria 2499
340 Ga0207674_11402317 3300026116 Unclassified 668
341 Ga0207675_100080620 3300026118 Unclassified 3051
342 Ga0207675_100334284 3300026118 Bacteria 1482
343 Ga0207675_101155460 3300026118 Unclassified 794
344 Ga0207683_10027495 3300026121 Bacteria 4915
345 Ga0207683_10149511 3300026121 Unclassified 2107
346 Ga0207683_10554859 3300026121 Bacteria 1062
347 Ga0207683_10664253 3300026121 Bacteria 966
348 Ga0207698_10270292 3300026142 Unclassified 1567
349 Ga0207698_11195769 3300026142 Unclassified 774
350 Ga0207698_11375658 3300026142 Unclassified 721
351 Ga0207428_10445290 3300027907 Unclassified 945
352 Ga0268266_11345988 3300028379 Unclassified 689
353 Ga0268265_10364420 3300028380 Bacteria 1324
354 Ga0268264_10024637 3300028381 Bacteria 4914
355 Ga0268264_10242076 3300028381 Bacteria 1671
356 Ga0268264_10593262 3300028381 Unclassified 1091
357 Ga0268264_10907155 3300028381 Bacteria 885
358 Ga0265338_10807278 3300028800 Unclassified 643
359 Ga0265332_10162956 3300031238 Unclassified 931
360 Ga0265328_10215141 3300031239 Unclassified 731
361 Ga0265331_10238704 3300031250 Unclassified 816
362 Ga0265316_10433801 3300031344 Unclassified 944
363 Ga0307408_100582645 3300031548 Bacteria 991
364 Ga0307408_100706511 3300031548 Unclassified 907
365 Ga0307408_100956301 3300031548 Unclassified 787
366 Ga0307405_10002012 3300031731 Bacteria 8807
367 Ga0307413_10014485 3300031824 Bacteria 4007
368 Ga0307413_10536764 3300031824 Unclassified 946
369 Ga0307410_10027904 3300031852 Unclassified 3573
370 Ga0307410_10392107 3300031852 Bacteria 1120
371 Ga0307406_10519412 3300031901 Unclassified 969
372 Ga0307406_11065395 3300031901 Bacteria 696
373 Ga0307407_10029082 3300031903 Bacteria 2963
374 Ga0307407_10617275 3300031903 Unclassified 809
375 Ga0307412_10107233 3300031911 Bacteria 1988
376 Ga0307412_10112609 3300031911 Unclassified 1945
377 Ga0307412_10730238 3300031911 Bacteria 853
378 Ga0307409_102066336 3300031995 Unclassified 599
379 Ga0307416_100002630 3300032002 Bacteria 10386
380 Ga0307416_100213165 3300032002 Unclassified 1844
381 Ga0307416_100975740 3300032002 Unclassified 950
382 Ga0307414_10847195 3300032004 Bacteria 836
383 Ga0307414_11058704 3300032004 Unclassified 748
384 Ga0307411_10043671 3300032005 Bacteria 2869
385 Ga0373939_0021765 3300035114 Bacteria 1760
386 Ga0373945_0115663 3300035116 Bacteria 1062
387 Ga0373953_0002996 3300035117 Bacteria 5168
388 Ga0373953_0091238 3300035117 Bacteria 1275
389 Ga0373956_0163087 3300035119 Bacteria 1051
390 Ga0373957_0016796 3300035120 Unclassified 2540
391 Ga0373957_0395731 3300035120 Bacteria 594
392 Ga0373943_0004440 3300035170 Bacteria 6349
393 Ga0373946_0076924 3300035171 Unclassified 1454
394 Ga0373955_0007703 3300035172 Bacteria 4960
395 Ga0373955_0163474 3300035172 Bacteria 1315
396 Ga0373955_0217244 3300035172 Bacteria 1141
397 Ga0373955_0626058 3300035172 Unclassified 659
398 Ga0373924_0002054 3300035410 Bacteria 6716
399 Ga0373924_0356331 3300035410 Unclassified 652
400 Ga0373935_0030124 3300035692 Bacteria 3361
401 Ga0373927_0054532 3300035695 Unclassified 2586
402 Ga0373947_0011710 3300035725 Bacteria 5027
403 Ga0373937_0011393 3300036401 Bacteria 7803
404 Ga0373937_0173391 3300036401 Bacteria 2024
405 Ga0373937_0221455 3300036401 Unclassified 1781
406 Ga0373937_0825289 3300036401 Bacteria 875
407 Ga0373925_0008183 3300037068 Bacteria 7613
408 Ga0373925_0573569 3300037068 Bacteria 929
409 Ga0436364_0605144 3300037853 Unclassified 2417
410 Ga0436365_0515928 3300039437 Unclassified 2722
411 Ga0436365_1312171 3300039437 Unclassified 4233
412 Ga0436363_0408826 3300039450 Unclassified 501
413 Ga0436362_0327819 3300039453 Unclassified 953
414 Ga0451576_0947458 3300045051 Unclassified 903
415 Ga0495592_0084546 3300046454 Bacteria 2289
416 Ga0495603_0243204 3300046455 Unclassified 1036
417 Ga0495629_0931491 3300046459 Unclassified 568
418 Ga0495651_0146909 3300046462 Bacteria 1704
419 Ga0495653_0136111 3300046463 Bacteria 1733
420 Ga0495580_0087495 3300046472 Unclassified 2170
421 Ga0495580_0791127 3300046472 Unclassified 615
422 Ga0495639_0203193 3300046475 Unclassified 970
423 Ga0495594_0095689 3300046499 Unclassified 1668
424 Ga0495608_0052923 3300046511 Bacteria 2686
425 Ga0495608_0102738 3300046511 Bacteria 1842
426 Ga0495618_0182257 3300046514 Unclassified 1334
427 Ga0495618_0278015 3300046514 Bacteria 1045
428 Ga0495628_0083484 3300046516 Bacteria 2480
429 Ga0495628_0469987 3300046516 Unclassified 911
430 Ga0495630_0024992 3300046517 Bacteria 4416
431 Ga0495630_0846751 3300046517 Unclassified 697
432 Ga0495652_1040888 3300046529 Unclassified 534
433 Ga0495665_0115771 3300046531 Unclassified 1405
434 Ga0495640_0086380 3300046533 Bacteria 2077
435 Ga0495586_0388663 3300046535 Unclassified 803
436 Ga0495587_0175850 3300046536 Bacteria 1215
437 Ga0495667_0000643 3300046559 Bacteria 22236
438 Ga0495667_0041184 3300046559 Unclassified 3064
439 Ga0495634_0112569 3300046642 Bacteria 1749
440 Ga0495635_0405814 3300046663 Bacteria 905
441 Ga0495588_0242157 3300046674 Bacteria 951
442 Ga0495657_0005533 3300046675 Bacteria 9980
443 Ga0495657_0214542 3300046675 Bacteria 1169
444 Ga0495599_0107402 3300046678 Unclassified 1739
445 Ga0495599_0371840 3300046678 Bacteria 854
446 Ga0495646_0202379 3300046680 Bacteria 1081
447 Ga0495647_0022426 3300046681 Viruses 2281
448 Ga0495647_0188969 3300046681 Unclassified 899
449 Ga0495658_0117866 3300046683 Bacteria 1603
450 Ga0495613_0001424 3300046689 Bacteria 18248
451 Ga0495613_0015723 3300046689 Bacteria 5632
452 Ga0495613_0094481 3300046689 Bacteria 2163
453 Ga0495613_0245277 3300046689 Bacteria 1251
454 Ga0495613_0303806 3300046689 Bacteria 1104
455 Ga0495670_0179417 3300046691 Unclassified 1118
456 Ga0495589_0300725 3300046794 Unclassified 744
457 Ga0495604_0035875 3300047317 Bacteria 3913
458 Ga0495674_0055427 3300047319 Bacteria 3477
459 Ga0495675_0025852 3300047444 Bacteria 3742
460 Ga0495684_0000791 3300047471 Bacteria 25677
461 Ga0495684_0178545 3300047471 Bacteria 1575
462 Ga0495684_0212037 3300047471 Bacteria 1424
463 Ga0495684_0614571 3300047471 Unclassified 732
464 Ga0496101_1264470 3300048904 Unclassified 578
465 Ga0496104_1734147 3300048907 Bacteria 527
466 Ga0496104_1871285 3300048907 Unclassified 502
467 Ga0496109_0897729 3300048912 Bacteria 824
468 Ga0501075_0151311 3300049591 Bacteria 1769
469 Ga0501045_1011920 3300049824 Unclassified 609
470 nmdc:mga05p37_15981_c1 3300050507 Bacteria 9031
471 nmdc:mga05p37_720847_c1 3300050507 Bacteria 1104
472 nmdc:mga0qj67_346532_c1 3300050509 Bacteria 1201
473 nmdc:mga06r32_345165_c1 3300050510 Bacteria 1473
474 nmdc:mga08y16_4654_c1 3300050511 Bacteria 14285
475 nmdc:mga0n895_99851_c1 3300050512 Unclassified 2911
476 nmdc:mga0rr50_616395_c1 3300050513 Bacteria 925
477 nmdc:mga0a205_190522_c1 3300050515 Bacteria 1943
478 Ga0495601_0013932 3300053077 Bacteria 4842
479 Ga0495601_0232719 3300053077 Bacteria 1203
480 Ga0495595_0168492 3300053084 Bacteria 1083
481 Ga0495619_0001608 3300053085 Bacteria 14863
482 Ga0495619_0056395 3300053085 Bacteria 2604
483 Ga0495619_0264014 3300053085 Unclassified 1193
484 Ga0495619_0326489 3300053085 Bacteria 1062
485 Ga0500568_0000467 3300053139 Bacteria 29990
486 Ga0587077_215463 3300059493 Bacteria 539
487 Ga0501082_2023014 3300060353 Unclassified 502
488 Ga0530510_1116574 3300061734 Bacteria 604
489 Ga0373934_0436738
490 MBSR1b_contig_11072870
491 MBSR1b_contig_338865
492 JGI25406J46586_10095206
493 Ga0058859_11760531
494 Ga0058860_12069598
495 Ga0058860_12084096
496 Ga0058862_11798068
497 Ga0065712_10248370
498 Ga0065715_10182606
499 Ga0065715_10326822
500 Ga0065715_10456835
501 Ga0070683_100139228
502 Ga0070683_100425000
503 Ga0070683_100472058
504 Ga0070690_100093305
505 Ga0070690_100153381
506 Ga0070690_100302070
507 Ga0070670_100102620
508 Ga0070670_101472995
509 Ga0068869_100079273
510 Ga0068869_101049155
511 Ga0068869_101055924
512 Ga0070666_10347653
513 Ga0070666_10355626
514 Ga0070666_10604031
515 Ga0070680_100783682
516 Ga0068868_100055741
517 Ga0068868_100198084
518 Ga0068868_100859616
519 Ga0068868_102038790
520 Ga0070689_100029775
521 Ga0070689_100832381
522 Ga0070689_101400650
523 Ga0070691_10400829
524 Ga0070687_100137158
525 Ga0070687_100147951
526 Ga0070661_100093797
527 Ga0070692_10287608
528 Ga0070692_10828215
529 Ga0070669_100094230
530 Ga0070669_100362381
531 Ga0070669_101625773
532 Ga0070675_100000061
533 Ga0070675_100001628
534 Ga0070675_100037849
535 Ga0070675_100073101
536 Ga0070675_100101078
537 Ga0070675_100425787
538 Ga0070675_101092067
539 Ga0070671_100016575
540 Ga0070671_100030578
541 Ga0070671_100243155
542 Ga0070671_100449278
543 Ga0070674_100545688
544 Ga0070674_100651805
545 Ga0070673_100046404
546 Ga0070673_100055482
547 Ga0070673_100056573
548 Ga0070673_100213298
549 Ga0070673_101422755
550 Ga0070688_100053280
551 Ga0070688_100088883
552 Ga0070688_100385892
553 Ga0070688_101145373
554 Ga0070667_100010383
555 Ga0070667_100018544
556 Ga0070667_100152680
557 Ga0070703_10095663
558 Ga0070709_10312983
559 Ga0070713_100770412
560 Ga0070701_10355524
561 Ga0070711_100142648
562 Ga0070694_100220676
563 Ga0070708_100360043
564 Ga0070708_102125718
565 Ga0070678_100283650
566 Ga0070678_100646822
567 Ga0070678_100713336
568 Ga0070678_100923604
569 Ga0070662_101081229
570 Ga0070681_10199742
571 Ga0070681_10566564
572 Ga0068867_100008192
573 Ga0070685_10011078
574 Ga0070685_10191429
575 Ga0070706_100816698
576 Ga0070707_100015483
577 Ga0070707_100115431
578 Ga0070699_100179084
579 Ga0070699_100718643
580 Ga0070684_100274384
581 Ga0070697_100352534
582 Ga0070672_100000416
583 Ga0070672_100095543
584 Ga0070672_100456997
585 Ga0070672_100488885
586 Ga0070672_100570519
587 Ga0070672_101291532
588 Ga0070686_100359834
589 Ga0070686_101325670
590 Ga0070696_100506859
591 Ga0070665_101561462
592 Ga0070664_100011914
593 Ga0070664_100085229
594 Ga0070664_100463966
595 Ga0068857_100335834
596 Ga0068854_100011583
597 Ga0068854_100200027
598 Ga0070702_100080463
599 Ga0070702_100972365
600 Ga0068852_100414353
601 Ga0068852_100508676
602 Ga0068859_100000802
603 Ga0068859_100002156
604 Ga0068859_100309163
605 Ga0068859_100392286
606 Ga0068859_100402121
607 Ga0068859_100486728
608 Ga0068864_100005710
609 Ga0068864_100019841
610 Ga0068864_100447319
611 Ga0068864_100587053
612 Ga0068864_101439652
613 Ga0068866_10049645
614 Ga0068866_11174241
615 Ga0068861_101696074
616 Ga0068851_10010834
617 Ga0068870_10308338
618 Ga0068870_10635604
619 Ga0068863_100000177
620 Ga0068863_100023114
621 Ga0068863_100992327
622 Ga0068863_101229777
623 Ga0068858_100061317
624 Ga0068858_100376673
625 Ga0068858_100753847
626 Ga0068860_100010871
627 Ga0068860_100135292
628 Ga0068860_100180238
629 Ga0068860_100649315
630 Ga0068860_101101631
631 Ga0068862_100398622
632 Ga0068862_100630481
633 Ga0068862_101246282
634 Ga0068862_102240016
635 Ga0081539_10031200
636 Ga0070712_100049835
637 Ga0097621_100005879
638 Ga0097621_100043013
639 Ga0097621_100131753
640 Ga0097621_100278453
641 Ga0097621_100497672
642 Ga0097621_101110307
643 Ga0097621_101822510
644 Ga0068871_100001631
645 Ga0068871_100006789
646 Ga0068871_100540305
647 Ga0068871_100608712
648 Ga0068871_101227082
649 Ga0075428_100196884
650 Ga0075428_100904261
651 Ga0075428_102339897
652 Ga0075430_100218156
653 Ga0075430_100367895
654 Ga0075431_100164226
655 Ga0075433_11184796
656 Ga0075434_100060675
657 Ga0075434_100569762
658 Ga0075429_100480463
659 Ga0068865_100591019
660 Ga0068865_100999347
661 Ga0075436_101492569
662 Ga0097620_100000802
663 Ga0097620_100002156
664 Ga0097620_100309170
665 Ga0097620_100392310
666 Ga0097620_100402116
667 Ga0097620_100486705
668 Ga0099794_10090571
669 Ga0111539_10004517
670 Ga0111539_10086743
671 Ga0111539_10795873
672 Ga0105245_10701590
673 Ga0105245_12427254
674 Ga0114129_10000075
675 Ga0114129_10543910
676 Ga0105243_10677119
677 Ga0105242_10709676
678 Ga0105242_10847984
679 Ga0105242_10978114
680 Ga0105242_11066958
681 Ga0105242_13124881
682 Ga0105248_10003400
683 Ga0105248_10074994
684 Ga0105248_10345205
685 Ga0105238_10019275
686 Ga0105238_12280410
687 Ga0105249_10212443
688 Ga0105249_10313431
689 Ga0105249_10666040
690 Ga0105249_10783774
691 Ga0105249_11738606
692 Ga0105246_10224349
693 Ga0105246_10420385
694 Ga0157374_10071832
695 Ga0157374_10130083
696 Ga0157374_11679938
697 Ga0157378_10006402
698 Ga0157378_11580563
699 Ga0157378_11944259
700 Ga0157378_12765727
701 Ga0163162_10119859
702 Ga0163162_10365851
703 Ga0163162_10441827
704 Ga0163162_10709688
705 Ga0163162_11113822
706 Ga0157375_10007813
707 Ga0157375_10404798
708 Ga0157375_10551647
709 Ga0163163_10023940
710 Ga0163163_10029421
711 Ga0163163_10087210
712 Ga0163163_10108056
713 Ga0157380_10020176
714 Ga0157380_10237086
715 Ga0157380_10557904
716 Ga0157377_10260895
717 Ga0157377_10293284
718 Ga0157377_10425939
719 Ga0157376_10162582
720 Ga0157376_10455401
721 Ga0157376_11188483
722 Ga0157376_11247536
723 Ga0157376_11698088
724 Ga0163161_10197831
725 Ga0163161_10208493
726 Ga0163161_10446719
727 Ga0213876_10045058
728 Ga0213876_10092036
729 Ga0213875_10006968
730 Ga0207697_10283090
731 Ga0207656_10040085
732 Ga0207682_10006087
733 Ga0207682_10412701
734 Ga0207642_10101452
735 Ga0207688_10277428
736 Ga0207688_10455163
737 Ga0207680_10005014
738 Ga0207680_10061856
739 Ga0207647_10525215
740 Ga0207699_10699251
741 Ga0207645_10006572
742 Ga0207707_10249692
743 Ga0207663_10176643
744 Ga0207660_11048980
745 Ga0207662_10213179
746 Ga0207649_10313171
747 Ga0207649_10657183
748 Ga0207646_10098952
749 Ga0207646_10130046
750 Ga0207681_10848130
751 Ga0207694_10277760
752 Ga0207659_10002029
753 Ga0207659_10038987
754 Ga0207659_10563248
755 Ga0207659_10851836
756 Ga0207644_10061716
757 Ga0207644_10187953
758 Ga0207644_10581345
759 Ga0207644_10797041
760 Ga0207690_10027609
761 Ga0207690_10292472
762 Ga0207706_10032094
763 Ga0207706_10254519
764 Ga0207686_10227544
765 Ga0207686_10654181
766 Ga0207686_11417141
767 Ga0207709_10007547
768 Ga0207670_10235439
769 Ga0207670_10474451
770 Ga0207670_11109819
771 Ga0207669_10097331
772 Ga0207669_10116130
773 Ga0207704_10023524
774 Ga0207665_11630484
775 Ga0207691_10003943
776 Ga0207691_10111527
777 Ga0207691_10280394
778 Ga0207691_10506369
779 Ga0207691_10966333
780 Ga0207711_10000890
781 Ga0207711_10040547
782 Ga0207711_10138576
783 Ga0207711_10272415
784 Ga0207711_11633714
785 Ga0207689_10009055
786 Ga0207689_10580197
787 Ga0207689_10904230
788 Ga0207689_11353418
789 Ga0207661_10182207
790 Ga0207661_10315567
791 Ga0207661_10543497
792 Ga0207679_10005387
793 Ga0207679_10102438
794 Ga0207679_10202794
795 Ga0207679_10212964
796 Ga0207651_10001451
797 Ga0207651_10048722
798 Ga0207651_11668364
799 Ga0207712_10071674
800 Ga0207712_10766103
801 Ga0207712_11191682
802 Ga0207712_11408810
803 Ga0207668_11032099
804 Ga0207640_10016936
805 Ga0207640_10177684
806 Ga0207658_10097878
807 Ga0207658_10246461
808 Ga0207677_10065180
809 Ga0207677_10435291
810 Ga0207677_10735779
811 Ga0207677_10999569
812 Ga0207703_10012598
813 Ga0207703_10072816
814 Ga0207703_10119258
815 Ga0207703_10551942
816 Ga0207708_10042912
817 Ga0207708_11954828
818 Ga0207641_10000472
819 Ga0207641_10001664
820 Ga0207641_10789982
821 Ga0207648_10018502
822 Ga0207648_10630809
823 Ga0207676_10109588
824 Ga0207676_10433608
825 Ga0207676_11150434
826 Ga0207676_12058608
827 Ga0207674_10128452
828 Ga0207674_11402317
829 Ga0207675_100080620
830 Ga0207675_100334284
831 Ga0207675_101155460
832 Ga0207683_10027495
833 Ga0207683_10149511
834 Ga0207683_10554859
835 Ga0207683_10664253
836 Ga0207698_10270292
837 Ga0207698_11195769
838 Ga0207698_11375658
839 Ga0207428_10445290
840 Ga0268266_11345988
841 Ga0268265_10364420
842 Ga0268264_10024637
843 Ga0268264_10242076
844 Ga0268264_10593262
845 Ga0268264_10907155
846 Ga0265338_10807278
847 Ga0265332_10162956
848 Ga0265328_10215141
849 Ga0265331_10238704
850 Ga0265316_10433801
851 Ga0307408_100582645
852 Ga0307408_100706511
853 Ga0307408_100956301
854 Ga0307405_10002012
855 Ga0307413_10014485
856 Ga0307413_10536764
857 Ga0307410_10027904
858 Ga0307410_10392107
859 Ga0307406_10519412
860 Ga0307406_11065395
861 Ga0307407_10029082
862 Ga0307407_10617275
863 Ga0307412_10107233
864 Ga0307412_10112609
865 Ga0307412_10730238
866 Ga0307409_102066336
867 Ga0307416_100002630
868 Ga0307416_100213165
869 Ga0307416_100975740
870 Ga0307414_10847195
871 Ga0307414_11058704
872 Ga0307411_10043671
873 Ga0373939_0021765
874 Ga0373945_0115663
875 Ga0373953_0002996
876 Ga0373953_0091238
877 Ga0373956_0163087
878 Ga0373957_0016796
879 Ga0373957_0395731
880 Ga0373943_0004440
881 Ga0373946_0076924
882 Ga0373955_0007703
883 Ga0373955_0163474
884 Ga0373955_0217244
885 Ga0373955_0626058
886 Ga0373924_0002054
887 Ga0373924_0356331
888 Ga0373935_0030124
889 Ga0373927_0054532
890 Ga0373947_0011710
891 Ga0373937_0011393
892 Ga0373937_0173391
893 Ga0373937_0221455
894 Ga0373937_0825289
895 Ga0373925_0008183
896 Ga0373925_0573569
897 Ga0436364_0605144
898 Ga0436365_0515928
899 Ga0436365_1312171
900 Ga0436363_0408826
901 Ga0436362_0327819
902 Ga0451576_0947458
903 Ga0495592_0084546
904 Ga0495603_0243204
905 Ga0495629_0931491
906 Ga0495651_0146909
907 Ga0495653_0136111
908 Ga0495580_0087495
909 Ga0495580_0791127
910 Ga0495639_0203193
911 Ga0495594_0095689
912 Ga0495608_0052923
913 Ga0495608_0102738
914 Ga0495618_0182257
915 Ga0495618_0278015
916 Ga0495628_0083484
917 Ga0495628_0469987
918 Ga0495630_0024992
919 Ga0495630_0846751
920 Ga0495652_1040888
921 Ga0495665_0115771
922 Ga0495640_0086380
923 Ga0495586_0388663
924 Ga0495587_0175850
925 Ga0495667_0000643
926 Ga0495667_0041184
927 Ga0495634_0112569
928 Ga0495635_0405814
929 Ga0495588_0242157
930 Ga0495657_0005533
931 Ga0495657_0214542
932 Ga0495599_0107402
933 Ga0495599_0371840
934 Ga0495646_0202379
935 Ga0495647_0022426
936 Ga0495647_0188969
937 Ga0495658_0117866
938 Ga0495613_0001424
939 Ga0495613_0015723
940 Ga0495613_0094481
941 Ga0495613_0245277
942 Ga0495613_0303806
943 Ga0495670_0179417
944 Ga0495589_0300725
945 Ga0495604_0035875
946 Ga0495674_0055427
947 Ga0495675_0025852
948 Ga0495684_0000791
949 Ga0495684_0178545
950 Ga0495684_0212037
951 Ga0495684_0614571
952 Ga0496101_1264470
953 Ga0496104_1734147
954 Ga0496104_1871285
955 Ga0496109_0897729
956 Ga0501075_0151311
957 Ga0501045_1011920
958 nmdc:mga05p37_15981_c1
959 nmdc:mga05p37_720847_c1
960 nmdc:mga0qj67_346532_c1
961 nmdc:mga06r32_345165_c1
962 nmdc:mga08y16_4654_c1
963 nmdc:mga0n895_99851_c1
964 nmdc:mga0rr50_616395_c1
965 nmdc:mga0a205_190522_c1
966 Ga0495601_0013932
967 Ga0495601_0232719
968 Ga0495595_0168492
969 Ga0495619_0001608
970 Ga0495619_0056395
971 Ga0495619_0264014
972 Ga0495619_0326489
973 Ga0500568_0000467
974 Ga0587077_215463
975 Ga0501082_2023014
976 Ga0530510_1116574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

34

133

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c4k-assembly1.cif.gz_A ancestral l-amino acid oxidase (anclaao-n5) ligand free form 0.851 45 74
7c4l-assembly1.cif.gz_A anncestral l-amino acid oxidase (anclaao-n5) l-gln binding form 0.837 45 74
4ywk-assembly3.cif.gz_A pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.7844 37 99
5g3q-assembly2.cif.gz_B crystal structure of a hypothetical domain in wnk1 0.7823 37 75
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.7815 40 74
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8297 44 72 2.30.29.30
4ywkA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7844 37 99 2.40.50.140
3u58D02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7734 37 120 2.40.50.140
3u4zB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7633 36 120 2.40.50.140
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7494 44 74 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9668 33 129
AF-A0A2V8DL04-F1-model_v4 DUF5666 domain-containing protein 0.9652 39 131
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9569 33 128
AF-A0A2T5GGJ4-F1-model_v4 Uncharacterized protein 0.9524 37 130
AF-A0A2V9D702-F1-model_v4 DUF5666 domain-containing protein 0.9498 37 131

Map