F453559

General Info

Members Datasets Scaffolds Average Seq Length
488 311 373 266

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100114182|Ga0070694_1001141822
Length 281
Sequence MLSWFRNRGDPSTPIDTALWRSATAPWLFMRGLDDDEAARLRALSERFLARKNFSGTHGLEISDVMRVEIAAQASILVLELGLEWYDGWSDIIVYPSQFAPEREVMDETGVVHLTNDPLAGEAWLGGPVILSYEDVALAGDEEMRVAGYNVVIHEFAHKLDMRSGDPNGSPPLHPQMSAARWKQAFSQAYDDFCRKVDRADRRAGRDGGAALDALPIDPYAASSAGEFFAVTSEAFFETPELLEPAYPRVYEELRAFYKQNPLARLAKAERESRGDSPSRR

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231015 Pseudomonas sp. GM49 Isolate Nodule
4 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
5 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
6 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
7 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
8 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
9 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
10 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
11 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
12 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
13 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
14 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
15 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
16 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
17 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
18 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
19 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
20 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
21 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
22 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
23 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
24 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
25 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
26 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
27 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
28 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
29 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
30 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
31 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
32 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
33 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
34 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
35 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
36 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
37 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
38 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
39 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
40 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
41 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
42 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
43 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
44 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
45 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
46 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
47 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
48 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
49 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
50 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
51 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
52 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
53 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
54 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
55 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
56 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
57 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
58 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
59 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
60 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
61 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
62 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
63 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
64 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
65 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
66 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
67 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
68 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
69 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
70 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
71 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
72 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
73 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
74 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
75 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
76 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
77 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
78 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
79 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
80 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
81 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
82 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
83 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
84 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
85 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
86 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
87 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
88 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
89 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
90 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
91 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
92 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
93 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
94 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
95 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
96 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
97 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
98 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
99 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
100 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
101 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
102 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
103 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
104 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
105 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
106 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
109 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
110 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
116 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
117 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
121 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
122 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
123 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
124 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
125 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
126 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
129 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
130 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
131 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
132 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
162 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
200 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
201 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
205 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
211 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
212 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
224 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
225 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
226 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
227 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
228 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
229 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
296 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
300 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
301 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
302 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
303 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
304 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
305 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
306 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
307 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
308 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
309 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
310 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
311 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.41
Metatranscriptomes 1.02
Isolates 23.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 1.43
Rhizoplane 9.43
Rhizosphere 73.57
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000042 3300003751 Bacteria 164754
2 Ga0055536_1000448 3300003781 Bacteria 28991
3 Ga0055536_1004823 3300003781 Bacteria 6747
4 Ga0055536_1005167 3300003781 Bacteria 6451
5 Ga0055530_10004828 3300003791 Bacteria 6747
6 Ga0055530_10005008 3300003791 Bacteria 6533
7 Ga0055540_1004272 3300003792 Bacteria 6536
8 Ga0055540_1004947 3300003792 Bacteria 5805
9 Ga0055531_10000125 3300003794 Bacteria 86349
10 Ga0065714_10067243 3300005288 Bacteria 5738
11 Ga0065714_10098570 3300005288 Bacteria 1699
12 Ga0065714_10115431 3300005288 Bacteria 1416
13 Ga0065712_10069723 3300005290 Bacteria 6806
14 Ga0070690_100026100 3300005330 Bacteria 3601
15 Ga0070670_100040209 3300005331 Bacteria 4021
16 Ga0070689_100015651 3300005340 Bacteria 5536
17 Ga0070689_100503393 3300005340 Bacteria 1038
18 Ga0070661_100000436 3300005344 Bacteria 31918
19 Ga0070669_100000218 3300005353 Bacteria 47769
20 Ga0070669_100002174 3300005353 Bacteria 14183
21 Ga0070675_100001764 3300005354 Bacteria 15948
22 Ga0070688_100145029 3300005365 Bacteria 1617
23 Ga0070694_100114182 3300005444 Bacteria 1928
24 Ga0070662_100021586 3300005457 Bacteria 4398
25 Ga0070681_10194199 3300005458 Bacteria 1949
26 Ga0068867_100134717 3300005459 Bacteria 1924
27 Ga0070685_10231307 3300005466 Bacteria 1216
28 Ga0068853_100044480 3300005539 Bacteria 3801
29 Ga0070693_100003096 3300005547 Bacteria 7717
30 Ga0070704_100136088 3300005549 Bacteria 1911
31 Ga0068855_100065358 3300005563 Bacteria 4241
32 Ga0070664_100000412 3300005564 Bacteria 31918
33 Ga0070664_100263617 3300005564 Bacteria 1551
34 Ga0068857_100057185 3300005577 Bacteria 3462
35 Ga0068854_100003618 3300005578 Bacteria 9671
36 Ga0068859_100376254 3300005617 Bacteria 1516
37 Ga0068861_100396802 3300005719 Bacteria 1223
38 Ga0068861_100506447 3300005719 Bacteria 1092
39 Ga0068851_10000002 3300005834 Bacteria 302756
40 Ga0068858_100056248 3300005842 Bacteria 3637
41 Ga0068858_100150480 3300005842 Bacteria 2188
42 Ga0075364_10152684 3300006051 Bacteria 1557
43 Ga0075432_10051784 3300006058 Bacteria 1449
44 Ga0097621_100005842 3300006237 Bacteria 8692
45 Ga0097621_100104346 3300006237 Bacteria 2389
46 Ga0068871_100027975 3300006358 Bacteria 4415
47 Ga0097620_100376217 3300006931 Bacteria 1516
48 Ga0079104_1000387 3300006946 Bacteria 51126
49 Ga0079104_1024525 3300006946 Bacteria 1586
50 Ga0105251_10000011 3300009011 Bacteria 180176
51 Ga0105251_10001195 3300009011 Bacteria 22471
52 Ga0105251_10006189 3300009011 Bacteria 7686
53 Ga0105251_10026245 3300009011 Bacteria 2968
54 Ga0105251_10041513 3300009011 Bacteria 2238
55 Ga0105251_10085303 3300009011 Bacteria 1456
56 Ga0105251_10158295 3300009011 Bacteria 1021
57 Ga0105251_10197152 3300009011 Bacteria 907
58 Ga0105244_10000154 3300009036 Bacteria 72483
59 Ga0105244_10017761 3300009036 Bacteria 4010
60 Ga0105244_10020361 3300009036 Bacteria 3688
61 Ga0105244_10117892 3300009036 Bacteria 1287
62 Ga0105250_10046596 3300009092 Bacteria 1738
63 Ga0105245_10077918 3300009098 Bacteria 3023
64 Ga0105245_10208423 3300009098 Bacteria 1880
65 Ga0105243_10009171 3300009148 Bacteria 7554
66 Ga0105243_10034146 3300009148 Bacteria 3936
67 Ga0105243_10282894 3300009148 Bacteria 1495
68 Ga0105242_10013808 3300009176 Bacteria 6250
69 Ga0105242_10083199 3300009176 Bacteria 2679
70 Ga0105248_10004020 3300009177 Bacteria 16258
71 Ga0105248_10041309 3300009177 Bacteria 5170
72 Ga0105248_10350419 3300009177 Bacteria 1662
73 Ga0105237_10001451 3300009545 Bacteria 31307
74 Ga0105249_10140032 3300009553 Bacteria 2319
75 Ga0105239_10772100 3300010375 Bacteria 1100
76 Ga0105246_10000344 3300011119 Bacteria 24772
77 Ga0105246_10001291 3300011119 Bacteria 14686
78 Ga0105246_10040458 3300011119 Bacteria 3146
79 Ga0157373_10048337 3300013100 Bacteria 3033
80 Ga0157373_10054895 3300013100 Bacteria 2830
81 Ga0157373_10106459 3300013100 Bacteria 1972
82 Ga0157373_10146426 3300013100 Bacteria 1661
83 Ga0157371_10031968 3300013102 Bacteria 3789
84 Ga0157371_10205091 3300013102 Bacteria 1414
85 Ga0157370_10032537 3300013104 Bacteria 5093
86 Ga0157370_10318485 3300013104 Bacteria 1435
87 Ga0157369_10022826 3300013105 Bacteria 6977
88 Ga0157369_10143211 3300013105 Bacteria 2528
89 Ga0157369_10325302 3300013105 Bacteria 1598
90 Ga0157369_10339334 3300013105 Bacteria 1561
91 Ga0157374_10054819 3300013296 Bacteria 3720
92 Ga0157378_10065237 3300013297 Bacteria 3259
93 Ga0157378_10187380 3300013297 Bacteria 1949
94 Ga0157375_10059472 3300013308 Bacteria 3786
95 Ga0157375_10068269 3300013308 Bacteria 3556
96 Ga0157375_10746800 3300013308 Bacteria 1130
97 Ga0157380_10399401 3300014326 Bacteria 1304
98 Ga0182008_10014053 3300014497 Bacteria 4199
99 Ga0182008_10024537 3300014497 Bacteria 3069
100 Ga0182008_10085087 3300014497 Bacteria 1558
101 Ga0157377_10114684 3300014745 Bacteria 1625
102 Ga0182006_1013365 3300015261 Bacteria 3564
103 Ga0209759_1001413 3300025256 Bacteria 13698
104 Ga0209675_1009621 3300025291 Bacteria 3392
105 Ga0209676_1000076 3300025292 Bacteria 301393
106 Ga0209676_1000314 3300025292 Bacteria 94905
107 Ga0209676_1000337 3300025292 Bacteria 89361
108 Ga0209050_1000063 3300025298 Bacteria 314955
109 Ga0209050_1000106 3300025298 Bacteria 224396
110 Ga0209051_1000045 3300025303 Bacteria 297882
111 Ga0209051_1000260 3300025303 Bacteria 88213
112 Ga0209257_1000185 3300025304 Bacteria 155047
113 Ga0207656_10000010 3300025321 Bacteria 192224
114 Ga0207696_1003771 3300025711 Bacteria 6757
115 Ga0207696_1005090 3300025711 Bacteria 5520
116 Ga0207655_1000120 3300025728 Bacteria 157018
117 Ga0207655_1001039 3300025728 Bacteria 27979
118 Ga0207655_1001579 3300025728 Bacteria 20452
119 Ga0207655_1002652 3300025728 Bacteria 14109
120 Ga0207655_1029079 3300025728 Bacteria 2595
121 Ga0207713_1000073 3300025735 Bacteria 181519
122 Ga0207713_1000261 3300025735 Bacteria 65024
123 Ga0207713_1002074 3300025735 Bacteria 14980
124 Ga0207713_1003626 3300025735 Bacteria 10395
125 Ga0207713_1016862 3300025735 Bacteria 3690
126 Ga0207713_1097782 3300025735 Bacteria 1019
127 Ga0207688_10047833 3300025901 Bacteria 2389
128 Ga0207645_10232023 3300025907 Bacteria 1218
129 Ga0207643_10036985 3300025908 Bacteria 2738
130 Ga0207695_10017342 3300025913 Bacteria 8382
131 Ga0207671_10000897 3300025914 Bacteria 37640
132 Ga0207662_10157655 3300025918 Bacteria 1448
133 Ga0207649_10000126 3300025920 Bacteria 64678
134 Ga0207681_10000148 3300025923 Bacteria 58793
135 Ga0207681_10028947 3300025923 Bacteria 3592
136 Ga0207650_10000620 3300025925 Bacteria 28400
137 Ga0207659_10121224 3300025926 Bacteria 2004
138 Ga0207706_10007161 3300025933 Bacteria 10315
139 Ga0207686_10001185 3300025934 Bacteria 15098
140 Ga0207686_10008156 3300025934 Bacteria 5649
141 Ga0207709_10000030 3300025935 Bacteria 331710
142 Ga0207709_10007259 3300025935 Bacteria 6181
143 Ga0207670_10423112 3300025936 Bacteria 1069
144 Ga0207669_10289388 3300025937 Bacteria 1240
145 Ga0207691_10041891 3300025940 Bacteria 4224
146 Ga0207711_10051323 3300025941 Bacteria 3531
147 Ga0207711_10064467 3300025941 Bacteria 3165
148 Ga0207711_10589455 3300025941 Bacteria 1037
149 Ga0207689_10016249 3300025942 Bacteria 6304
150 Ga0207679_10000017 3300025945 Bacteria 253004
151 Ga0207679_10117780 3300025945 Bacteria 2108
152 Ga0207667_10019591 3300025949 Bacteria 7547
153 Ga0207651_10549689 3300025960 Bacteria 1004
154 Ga0207640_10044759 3300025981 Bacteria 2838
155 Ga0207703_10042134 3300026035 Bacteria 3661
156 Ga0207639_10011186 3300026041 Bacteria 6226
157 Ga0207676_10373772 3300026095 Bacteria 1325
158 Ga0207674_10027682 3300026116 Bacteria 5992
159 Ga0209281_1006506 3300027111 Bacteria 3041
160 Ga0307517_10085771 3300028786 Bacteria 2635
161 Ga0314311_1081897 3300030733 Bacteria 1219
162 Ga0316179_1015510 3300030734 Bacteria 4203
163 Ga0316178_1130694 3300030735 Bacteria 47589
164 Ga0307408_100010567 3300031548 Bacteria 6088
165 Ga0307408_100306393 3300031548 Bacteria 1332
166 Ga0307408_100744900 3300031548 Bacteria 884
167 Ga0316576_10004141 3300031727 Bacteria 8655
168 Ga0316576_10043105 3300031727 Bacteria 3254
169 Ga0316578_10003687 3300031728 Bacteria 7066
170 Ga0316578_10006049 3300031728 Bacteria 5931
171 Ga0316578_10006785 3300031728 Bacteria 5680
172 Ga0316578_10061025 3300031728 Bacteria 2220
173 Ga0316577_10000360 3300031733 Bacteria 17079
174 Ga0316577_10007178 3300031733 Bacteria 5928
175 Ga0316577_10033173 3300031733 Bacteria 2884
176 Ga0307406_10068357 3300031901 Bacteria 2319
177 Ga0307412_10130008 3300031911 Bacteria 1827
178 Ga0307412_10315476 3300031911 Bacteria 1241
179 Ga0307416_100450922 3300032002 Bacteria 1339
180 Ga0307411_10066397 3300032005 Bacteria 2423
181 Ga0316585_10027733 3300032137 Bacteria 1769
182 Ga0316580_10004054 3300032139 Bacteria 4220
183 Ga0316580_10005091 3300032139 Bacteria 3825
184 Ga0316593_10000870 3300032168 Bacteria 6122
185 Ga0316593_10026671 3300032168 Bacteria 1849
186 Ga0316588_1006482 3300033528 Bacteria 2340
187 Ga0316588_1006693 3300033528 Bacteria 2314
188 Ga0316588_1009385 3300033528 Bacteria 2040
189 Ga0316574_0003620 3300035398 Bacteria 7993
190 Ga0316574_0113405 3300035398 Bacteria 1738
191 Ga0373935_0039607 3300035692 Bacteria 2955
192 Ga0316582_0009517 3300036647 Bacteria 5277
193 Ga0316582_0029777 3300036647 Bacteria 3319
194 Ga0316584_0001594 3300036712 Bacteria 13786
195 Ga0316584_0003344 3300036712 Bacteria 10395
196 Ga0316584_0005230 3300036712 Bacteria 8679
197 Ga0316584_0011239 3300036712 Bacteria 6284
198 Ga0439438_037553 3300041405 Bacteria 1266
199 Ga0439438_037554 3300041405 Bacteria 1266
200 Ga0439447_013944 3300041407 Bacteria 2267
201 Ga0439447_022772 3300041407 Bacteria 1637
202 Ga0439466_0009360 3300041411 Bacteria 3661
203 Ga0439466_0031258 3300041411 Bacteria 1822
204 Ga0439445_0042510 3300042004 Bacteria 1210
205 Ga0439432_000139 3300042006 Bacteria 24587
206 Ga0439432_022233 3300042006 Bacteria 2094
207 Ga0439452_000211 3300042010 Bacteria 41304
208 Ga0439463_004166 3300042016 Bacteria 3626
209 Ga0439463_015665 3300042016 Bacteria 1875
210 Ga0439463_016032 3300042016 Bacteria 1853
211 Ga0439463_018043 3300042016 Bacteria 1754
212 Ga0450911_000136 3300042115 Bacteria 29345
213 Ga0450902_000577 3300042137 Bacteria 4648
214 Ga0450902_004263 3300042137 Bacteria 2121
215 Ga0450904_002438 3300042139 Bacteria 2220
216 Ga0450905_006991 3300042142 Bacteria 1531
217 Ga0450906_000847 3300042145 Bacteria 6743
218 Ga0495617_063078 3300046452 Bacteria 1224
219 Ga0495627_000037 3300046453 Bacteria 198542
220 Ga0495627_005610 3300046453 Bacteria 5021
221 Ga0495627_009502 3300046453 Bacteria 3577
222 Ga0495591_000259 3300046458 Bacteria 50438
223 Ga0495591_000732 3300046458 Bacteria 23757
224 Ga0495591_002014 3300046458 Bacteria 11822
225 Ga0495591_046685 3300046458 Bacteria 1202
226 Ga0495638_0014623 3300046460 Bacteria 5296
227 Ga0495651_0116088 3300046462 Bacteria 1973
228 Ga0495650_0000311 3300046471 Bacteria 87755
229 Ga0495650_0009563 3300046471 Bacteria 5500
230 Ga0495650_0015985 3300046471 Bacteria 3822
231 Ga0495605_0000033 3300046474 Bacteria 209203
232 Ga0495605_0000453 3300046474 Bacteria 36766
233 Ga0495605_0002622 3300046474 Bacteria 11038
234 Ga0495605_0148220 3300046474 Bacteria 1048
235 Ga0495584_0004057 3300046491 Bacteria 7905
236 Ga0495585_0000684 3300046492 Bacteria 30886
237 Ga0495585_0024625 3300046492 Bacteria 3449
238 Ga0495594_0034719 3300046499 Bacteria 2744
239 Ga0495596_0000283 3300046500 Bacteria 33843
240 Ga0495607_0000385 3300046501 Bacteria 45205
241 Ga0495607_0000614 3300046501 Bacteria 34704
242 Ga0495607_0000749 3300046501 Bacteria 31120
243 Ga0495607_0001635 3300046501 Bacteria 19408
244 Ga0495607_0002046 3300046501 Bacteria 16870
245 Ga0495607_0009598 3300046501 Bacteria 6539
246 Ga0495607_0023984 3300046501 Bacteria 3810
247 Ga0495583_0000031 3300046506 Bacteria 253982
248 Ga0495583_0000855 3300046506 Bacteria 37041
249 Ga0495583_0001402 3300046506 Bacteria 24561
250 Ga0495583_0006515 3300046506 Bacteria 7619
251 Ga0495583_0008093 3300046506 Bacteria 6479
252 Ga0495583_0011462 3300046506 Bacteria 5087
253 Ga0495583_0023874 3300046506 Bacteria 3084
254 Ga0495606_0000722 3300046507 Bacteria 51115
255 Ga0495606_0008743 3300046507 Bacteria 8706
256 Ga0495606_0008912 3300046507 Bacteria 8592
257 Ga0495606_0020415 3300046507 Bacteria 4884
258 Ga0495608_0044546 3300046511 Bacteria 2961
259 Ga0495610_0018008 3300046512 Bacteria 4004
260 Ga0495610_0118464 3300046512 Bacteria 1163
261 Ga0495620_0000038 3300046515 Bacteria 114064
262 Ga0495620_0000190 3300046515 Bacteria 47173
263 Ga0495620_0001679 3300046515 Bacteria 13056
264 Ga0495628_0087249 3300046516 Bacteria 2419
265 Ga0495631_0003524 3300046518 Bacteria 8556
266 Ga0495632_0001408 3300046519 Bacteria 20097
267 Ga0495637_0000064 3300046520 Bacteria 92793
268 Ga0495637_0000610 3300046520 Bacteria 25464
269 Ga0495637_0016359 3300046520 Bacteria 3467
270 Ga0495637_0116308 3300046520 Bacteria 1032
271 Ga0495644_0006268 3300046523 Bacteria 4619
272 Ga0495648_0008410 3300046524 Bacteria 8125
273 Ga0495648_0019608 3300046524 Bacteria 4747
274 Ga0495648_0068205 3300046524 Bacteria 2076
275 Ga0495652_0258926 3300046529 Bacteria 1285
276 Ga0495654_0000483 3300046530 Bacteria 32849
277 Ga0495654_0012898 3300046530 Bacteria 4481
278 Ga0495654_0040711 3300046530 Bacteria 2314
279 Ga0495654_0103842 3300046530 Bacteria 1304
280 Ga0495587_0104598 3300046536 Bacteria 1629
281 Ga0495609_0000018 3300046538 Bacteria 302609
282 Ga0495609_0000056 3300046538 Bacteria 146060
283 Ga0495609_0000161 3300046538 Bacteria 69842
284 Ga0495609_0040798 3300046538 Bacteria 2088
285 Ga0495609_0115307 3300046538 Bacteria 1157
286 Ga0495621_0036944 3300046539 Bacteria 1697
287 Ga0495597_0015152 3300046542 Bacteria 3654
288 Ga0495645_0020725 3300046543 Bacteria 4747
289 Ga0495622_0003773 3300046557 Bacteria 7086
290 Ga0495622_0098965 3300046557 Bacteria 1337
291 Ga0495633_0000062 3300046558 Bacteria 142101
292 Ga0495668_0107014 3300046616 Bacteria 1529
293 Ga0495668_0132813 3300046616 Bacteria 1362
294 Ga0495668_0169688 3300046616 Bacteria 1195
295 Ga0495611_0001911 3300046648 Bacteria 9908
296 Ga0495611_0003334 3300046648 Bacteria 7093
297 Ga0495625_0000194 3300046660 Bacteria 96964
298 Ga0495635_0120459 3300046663 Bacteria 1790
299 Ga0495661_0000016 3300046665 Bacteria 213593
300 Ga0495661_0000093 3300046665 Bacteria 109808
301 Ga0495661_0000140 3300046665 Bacteria 85015
302 Ga0495661_0000662 3300046665 Bacteria 34527
303 Ga0495661_0007799 3300046665 Bacteria 7446
304 Ga0495661_0046621 3300046665 Bacteria 2645
305 Ga0495661_0077957 3300046665 Bacteria 1918
306 Ga0495599_0011069 3300046678 Bacteria 5535
307 Ga0495623_0055522 3300046679 Bacteria 2497
308 Ga0495670_0033389 3300046691 Bacteria 2560
309 Ga0495671_0007890 3300046692 Bacteria 6020
310 Ga0495671_0041189 3300046692 Bacteria 2326
311 Ga0495649_0264083 3300046694 Bacteria 882
312 Ga0495589_0000246 3300046794 Bacteria 44673
313 Ga0495600_0097911 3300046809 Bacteria 1912
314 Ga0495660_0001057 3300046810 Bacteria 19940
315 Ga0495660_0011381 3300046810 Bacteria 5165
316 Ga0495672_0026878 3300047320 Bacteria 3665
317 Ga0495672_0049308 3300047320 Bacteria 2492
318 Ga0495676_0000052 3300047321 Bacteria 97049
319 Ga0495683_0000092 3300047323 Bacteria 91056
320 Ga0495683_0113351 3300047323 Bacteria 1292
321 Ga0495679_000136 3300047446 Bacteria 65848
322 Ga0495679_000241 3300047446 Bacteria 45465
323 Ga0495679_038687 3300047446 Bacteria 1492
324 Ga0495673_0000667 3300047469 Bacteria 33805
325 Ga0495673_0007475 3300047469 Bacteria 6277
326 Ga0495673_0007636 3300047469 Bacteria 6185
327 Ga0495673_0032960 3300047469 Bacteria 2409
328 Ga0495673_0047963 3300047469 Bacteria 1885
329 Ga0495673_0084388 3300047469 Bacteria 1309
330 Ga0495681_0041227 3300047470 Bacteria 2242
331 Ga0495684_0071692 3300047471 Bacteria 2632
332 Ga0495686_0049385 3300047472 Bacteria 2647
333 Ga0495626_0000126 3300048091 Bacteria 99054
334 Ga0496102_0187107 3300048905 Bacteria 1952
335 Ga0496116_0036032 3300048919 Bacteria 3468
336 Ga0496116_0162732 3300048919 Bacteria 1222
337 Ga0496117_0002760 3300048920 Bacteria 21509
338 Ga0496117_0039789 3300048920 Bacteria 3465
339 Ga0496117_0061282 3300048920 Bacteria 2587
340 Ga0496117_0206158 3300048920 Bacteria 1106
341 Ga0496118_0044927 3300048921 Bacteria 3453
342 Ga0496118_0124972 3300048921 Bacteria 1667
343 Ga0496119_0183778 3300048922 Bacteria 1094
344 Ga0496120_0162831 3300048923 Bacteria 1110
345 Ga0496121_0002045 3300048924 Bacteria 31934
346 Ga0496121_0004065 3300048924 Bacteria 20095
347 Ga0496122_0000434 3300048925 Bacteria 87536
348 Ga0496122_0028772 3300048925 Bacteria 4703
349 Ga0496122_0044502 3300048925 Bacteria 3462
350 Ga0496122_0081897 3300048925 Bacteria 2244
351 Ga0496122_0106781 3300048925 Bacteria 1852
352 Ga0496123_0000318 3300048926 Bacteria 91911
353 Ga0496123_0018041 3300048926 Bacteria 5644
354 Ga0496123_0070907 3300048926 Bacteria 2177
355 Ga0496123_0164793 3300048926 Bacteria 1177
356 Ga0496124_0000689 3300048927 Bacteria 55376
357 Ga0496124_0003367 3300048927 Bacteria 19638
358 Ga0496124_0008488 3300048927 Bacteria 10732
359 Ga0496124_0103835 3300048927 Bacteria 2298
360 Ga0496124_0229930 3300048927 Bacteria 1387
361 Ga0496124_0287858 3300048927 Bacteria 1194
362 Ga0496124_0302432 3300048927 Bacteria 1154
363 Ga0496125_0002909 3300048928 Bacteria 21542
364 Ga0496125_0003066 3300048928 Bacteria 20858
365 Ga0496125_0230647 3300048928 Bacteria 1184
366 Ga0496125_0358109 3300048928 Bacteria 868
367 Ga0495678_000021 3300049459 Bacteria 239150
368 Ga0495678_000169 3300049459 Bacteria 76063
369 Ga0495678_023851 3300049459 Bacteria 2651
370 Ga0495682_0001069 3300049460 Bacteria 16115
371 Ga0495682_0034629 3300049460 Bacteria 1861
372 Ga0495601_0002762 3300053077 Bacteria 9969
373 Ga0495619_0012343 3300053085 Bacteria 5377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0162732 Ga0496116_0162732_10_684 223
2 3300025918 Ga0207662_10157655 Ga0207662_101576552 226
3 3300025923 Ga0207681_10028947 Ga0207681_100289472 245
4 3300048928 Ga0496125_0358109 Ga0496125_0358109_118_858 246
5 3300003781 Ga0055536_1004823 Ga0055536_10048236 248
6 3300003791 Ga0055530_10004828 Ga0055530_100048286 248
7 3300003792 Ga0055540_1004947 Ga0055540_10049476 248
8 3300046694 Ga0495649_0264083 Ga0495649_0264083_24_779 250
9 3300048928 Ga0496125_0003066 Ga0496125_0003066_20009_20824 250
10 3300005288 Ga0065714_10098570 Ga0065714_100985702 252
11 3300006051 Ga0075364_10152684 Ga0075364_101526841 252
12 3300009036 Ga0105244_10020361 Ga0105244_100203615 252
13 3300014497 Ga0182008_10014053 Ga0182008_100140535 252
14 3300014497 Ga0182008_10085087 Ga0182008_100850872 252
15 3300015261 Ga0182006_1013365 Ga0182006_10133651 252
16 3300028786 Ga0307517_10085771 Ga0307517_100857714 252
17 3300042006 Ga0439432_000139 Ga0439432_000139_119_934 252
18 3300047446 Ga0495679_038687 Ga0495679_038687_597_1412 252
19 3300048925 Ga0496122_0081897 Ga0496122_0081897_188_1018 252
20 3300048927 Ga0496124_0103835 Ga0496124_0103835_135_950 252
21 3300005288 Ga0065714_10115431 Ga0065714_101154312 253
22 3300005331 Ga0070670_100040209 Ga0070670_1000402091 253
23 3300005344 Ga0070661_100000436 Ga0070661_10000043621 253
24 3300005353 Ga0070669_100000218 Ga0070669_10000021832 253
25 3300005457 Ga0070662_100021586 Ga0070662_1000215862 253
26 3300005539 Ga0068853_100044480 Ga0068853_1000444802 253
27 3300005564 Ga0070664_100000412 Ga0070664_10000041221 253
28 3300005564 Ga0070664_100263617 Ga0070664_1002636172 253
29 3300005578 Ga0068854_100003618 Ga0068854_1000036187 253
30 3300005834 Ga0068851_10000002 Ga0068851_1000000287 253
31 3300009011 Ga0105251_10001195 Ga0105251_1000119522 253
32 3300009011 Ga0105251_10006189 Ga0105251_100061897 253
33 3300009176 Ga0105242_10083199 Ga0105242_100831993 253
34 3300009177 Ga0105248_10004020 Ga0105248_100040208 253
35 3300009545 Ga0105237_10001451 Ga0105237_100014516 253
36 3300013100 Ga0157373_10146426 Ga0157373_101464262 253
37 3300013102 Ga0157371_10205091 Ga0157371_102050912 253
38 3300013104 Ga0157370_10318485 Ga0157370_103184852 253
39 3300013105 Ga0157369_10022826 Ga0157369_100228262 253
40 3300013105 Ga0157369_10143211 Ga0157369_101432111 253
41 3300013308 Ga0157375_10059472 Ga0157375_100594725 253
42 3300025321 Ga0207656_10000010 Ga0207656_1000001098 253
43 3300025728 Ga0207655_1000120 Ga0207655_1000120111 253
44 3300025735 Ga0207713_1000261 Ga0207713_100026122 253
45 3300025735 Ga0207713_1016862 Ga0207713_10168625 253
46 3300025914 Ga0207671_10000897 Ga0207671_1000089724 253
47 3300025920 Ga0207649_10000126 Ga0207649_1000012651 253
48 3300025923 Ga0207681_10000148 Ga0207681_1000014858 253
49 3300025925 Ga0207650_10000620 Ga0207650_1000062029 253
50 3300025933 Ga0207706_10007161 Ga0207706_100071613 253
51 3300025934 Ga0207686_10001185 Ga0207686_100011855 253
52 3300025941 Ga0207711_10064467 Ga0207711_100644672 253
53 3300025945 Ga0207679_10000017 Ga0207679_10000017221 253
54 3300025945 Ga0207679_10117780 Ga0207679_101177802 253
55 3300025981 Ga0207640_10044759 Ga0207640_100447592 253
56 3300026041 Ga0207639_10011186 Ga0207639_100111865 253
57 3300031548 Ga0307408_100744900 Ga0307408_1007449001 253
58 3300035398 Ga0316574_0113405 Ga0316574_0113405_675_1445 253
59 3300036712 Ga0316584_0005230 Ga0316584_0005230_4243_5013 253
60 3300046506 Ga0495583_0006515 Ga0495583_0006515_6692_7507 253
61 3300046507 Ga0495606_0008743 Ga0495606_0008743_7788_8618 253
62 3300048920 Ga0496117_0002760 Ga0496117_0002760_20481_21311 253
63 3300048922 Ga0496119_0183778 Ga0496119_0183778_67_897 253
64 3300048923 Ga0496120_0162831 Ga0496120_0162831_191_1021 253
65 3300048927 Ga0496124_0008488 Ga0496124_0008488_9705_10535 253
66 3300048928 Ga0496125_0002909 Ga0496125_0002909_195_1025 253
67 3300048928 Ga0496125_0230647 Ga0496125_0230647_209_1024 253
68 3300011119 Ga0105246_10000344 Ga0105246_1000034423 254
69 3300005330 Ga0070690_100026100 Ga0070690_1000261006 255
70 3300005340 Ga0070689_100503393 Ga0070689_1005033932 255
71 3300005365 Ga0070688_100145029 Ga0070688_1001450292 255
72 3300005547 Ga0070693_100003096 Ga0070693_10000309610 255
73 3300005617 Ga0068859_100376254 Ga0068859_1003762542 255
74 3300005842 Ga0068858_100150480 Ga0068858_1001504803 255
75 3300006237 Ga0097621_100005842 Ga0097621_1000058423 255
76 3300006237 Ga0097621_100104346 Ga0097621_1001043463 255
77 3300006358 Ga0068871_100027975 Ga0068871_1000279756 255
78 3300006931 Ga0097620_100376217 Ga0097620_1003762172 255
79 3300009098 Ga0105245_10077918 Ga0105245_100779182 255
80 3300009098 Ga0105245_10208423 Ga0105245_102084235 255
81 3300009176 Ga0105242_10013808 Ga0105242_100138087 255
82 3300009177 Ga0105248_10041309 Ga0105248_100413095 255
83 3300009177 Ga0105248_10350419 Ga0105248_103504192 255
84 3300009553 Ga0105249_10140032 Ga0105249_101400323 255
85 3300010375 Ga0105239_10772100 Ga0105239_107721002 255
86 3300013296 Ga0157374_10054819 Ga0157374_100548196 255
87 3300013297 Ga0157378_10065237 Ga0157378_100652371 255
88 3300013297 Ga0157378_10187380 Ga0157378_101873802 255
89 3300013308 Ga0157375_10068269 Ga0157375_100682692 255
90 3300025934 Ga0207686_10008156 Ga0207686_100081562 255
91 3300025936 Ga0207670_10423112 Ga0207670_104231121 255
92 3300025941 Ga0207711_10051323 Ga0207711_100513233 255
93 3300025941 Ga0207711_10589455 Ga0207711_105894552 255
94 3300025942 Ga0207689_10016249 Ga0207689_100162492 255
95 3300025960 Ga0207651_10549689 Ga0207651_105496892 255
96 3300026095 Ga0207676_10373772 Ga0207676_103737722 255
97 3300035692 Ga0373935_0039607 Ga0373935_0039607_823_1635 255
98 3300046462 Ga0495651_0116088 Ga0495651_0116088_346_1158 255
99 3300046511 Ga0495608_0044546 Ga0495608_0044546_764_1576 255
100 3300046516 Ga0495628_0087249 Ga0495628_0087249_781_1593 255
101 3300046529 Ga0495652_0258926 Ga0495652_0258926_444_1256 255
102 3300046536 Ga0495587_0104598 Ga0495587_0104598_304_1116 255
103 3300046539 Ga0495621_0036944 Ga0495621_0036944_551_1360 255
104 3300046543 Ga0495645_0020725 Ga0495645_0020725_2604_3416 255
105 3300046663 Ga0495635_0120459 Ga0495635_0120459_887_1699 255
106 3300046678 Ga0495599_0011069 Ga0495599_0011069_333_1145 255
107 3300046679 Ga0495623_0055522 Ga0495623_0055522_153_965 255
108 3300046809 Ga0495600_0097911 Ga0495600_0097911_570_1382 255
109 3300047471 Ga0495684_0071692 Ga0495684_0071692_1387_2199 255
110 3300053077 Ga0495601_0002762 Ga0495601_0002762_1025_1837 255
111 3300053085 Ga0495619_0012343 Ga0495619_0012343_3701_4513 255
112 3300005340 Ga0070689_100015651 Ga0070689_1000156513 256
113 3300005354 Ga0070675_100001764 Ga0070675_1000017649 256
114 3300005466 Ga0070685_10231307 Ga0070685_102313072 256
115 3300005577 Ga0068857_100057185 Ga0068857_1000571854 256
116 3300014745 Ga0157377_10114684 Ga0157377_101146843 256
117 3300025901 Ga0207688_10047833 Ga0207688_100478333 256
118 3300025907 Ga0207645_10232023 Ga0207645_102320232 256
119 3300025908 Ga0207643_10036985 Ga0207643_100369855 256
120 3300025926 Ga0207659_10121224 Ga0207659_101212242 256
121 3300025940 Ga0207691_10041891 Ga0207691_100418913 256
122 3300026116 Ga0207674_10027682 Ga0207674_100276824 256
123 3300031728 Ga0316578_10003687 Ga0316578_100036876 256
124 3300031733 Ga0316577_10007178 Ga0316577_100071788 256
125 3300032137 Ga0316585_10027733 Ga0316585_100277332 256
126 3300032139 Ga0316580_10005091 Ga0316580_100050912 256
127 3300032168 Ga0316593_10000870 Ga0316593_100008706 256
128 3300033528 Ga0316588_1006693 Ga0316588_10066932 256
129 3300035398 Ga0316574_0003620 Ga0316574_0003620_2283_3062 256
130 3300036647 Ga0316582_0029777 Ga0316582_0029777_1193_1972 256
131 3300036712 Ga0316584_0001594 Ga0316584_0001594_5233_6012 256
132 3300046453 Ga0495627_009502 Ga0495627_009502_2552_3382 256
133 3300046501 Ga0495607_0009598 Ga0495607_0009598_199_1029 256
134 3300046665 Ga0495661_0007799 Ga0495661_0007799_197_1027 256
135 3300005459 Ga0068867_100134717 Ga0068867_1001347172 257
136 3300005719 Ga0068861_100396802 Ga0068861_1003968022 257
137 3300009148 Ga0105243_10009171 Ga0105243_100091717 257
138 3300025935 Ga0207709_10007259 Ga0207709_100072594 257
139 3300025937 Ga0207669_10289388 Ga0207669_102893882 257
140 3300031727 Ga0316576_10043105 Ga0316576_100431052 257
141 3300031728 Ga0316578_10006785 Ga0316578_100067857 257
142 3300031728 Ga0316578_10061025 Ga0316578_100610253 257
143 3300031733 Ga0316577_10033173 Ga0316577_100331733 257
144 3300032139 Ga0316580_10004054 Ga0316580_100040542 257
145 3300032168 Ga0316593_10026671 Ga0316593_100266712 257
146 3300033528 Ga0316588_1006482 Ga0316588_10064822 257
147 3300033528 Ga0316588_1009385 Ga0316588_10093852 257
148 3300036712 Ga0316584_0003344 Ga0316584_0003344_4247_5056 257
149 3300005458 Ga0070681_10194199 Ga0070681_101941994 258
150 3300005563 Ga0068855_100065358 Ga0068855_1000653583 258
151 3300013104 Ga0157370_10032537 Ga0157370_100325376 258
152 3300025913 Ga0207695_10017342 Ga0207695_100173426 259
153 3300025949 Ga0207667_10019591 Ga0207667_100195917 259
154 3300032002 Ga0307416_100450922 Ga0307416_1004509222 259
155 3300013308 Ga0157375_10746800 Ga0157375_107468002 260
156 3300046501 Ga0495607_0001635 Ga0495607_0001635_2054_2839 261
157 iso_pu_bacteria 2599185307 2599974701 261
158 3300046501 Ga0495607_0023984 Ga0495607_0023984_365_1153 262
159 3300009011 Ga0105251_10000011 Ga0105251_10000011102 263
160 3300025728 Ga0207655_1001579 Ga0207655_100157916 263
161 3300025735 Ga0207713_1000073 Ga0207713_1000073102 263
162 3300046458 Ga0495591_046685 Ga0495591_046685_288_1082 263
163 3300046507 Ga0495606_0020415 Ga0495606_0020415_3387_4178 263
164 3300046665 Ga0495661_0077957 Ga0495661_0077957_855_1649 263
165 3300047320 Ga0495672_0049308 Ga0495672_0049308_270_1064 263
166 3300047469 Ga0495673_0007636 Ga0495673_0007636_2118_2912 263
167 3300048905 Ga0496102_0187107 Ga0496102_0187107_305_1096 263
168 3300048920 Ga0496117_0061282 Ga0496117_0061282_1171_1962 263
169 3300048921 Ga0496118_0124972 Ga0496118_0124972_671_1462 263
170 3300048924 Ga0496121_0004065 Ga0496121_0004065_11505_12296 263
171 3300048925 Ga0496122_0000434 Ga0496122_0000434_26965_27756 263
172 3300048926 Ga0496123_0000318 Ga0496123_0000318_59781_60572 263
173 iso_pu_bacteria 2511231006 2511264601 264
174 3300042016 Ga0439463_016032 Ga0439463_016032_191_988 265
175 3300046506 Ga0495583_0008093 Ga0495583_0008093_5487_6287 265
176 3300046520 Ga0495637_0000610 Ga0495637_0000610_24416_25216 265
177 3300046524 Ga0495648_0068205 Ga0495648_0068205_823_1623 265
178 3300046530 Ga0495654_0012898 Ga0495654_0012898_3224_4024 265
179 3300046530 Ga0495654_0040711 Ga0495654_0040711_1401_2201 265
180 3300046616 Ga0495668_0107014 Ga0495668_0107014_481_1281 265
181 3300046692 Ga0495671_0041189 Ga0495671_0041189_283_1083 265
182 3300047469 Ga0495673_0032960 Ga0495673_0032960_420_1220 265
183 3300049459 Ga0495678_000169 Ga0495678_000169_15343_16143 265
184 iso_pu_bacteria 2512047018 2512328003 265
185 iso_pu_bacteria 2582580891 2583794913 265
186 iso_pu_bacteria 2597489887 2597860460 265
187 iso_pu_bacteria 2599185155 2599327227 265
188 iso_pu_bacteria 2599185185 2599486699 265
189 iso_pu_bacteria 2599185257 2599807177 265
190 iso_pu_bacteria 2600254931 2600367842 265
191 iso_pu_bacteria 2671180172 2671773263 265
192 iso_pu_bacteria 2740892503 2743740007 265
193 iso_pu_bacteria 2923153595 2923159098 265
194 iso_pu_bacteria 2984286254 2984287072 265
195 iso_pu_bacteria 3007395558 3007398723 265
196 iso_pu_bacteria 8015687852 8015693175 265
197 iso_pu_bacteria 8055770955 8055776424 265
198 3300031727 Ga0316576_10004141 Ga0316576_100041413 266
199 3300031728 Ga0316578_10006049 Ga0316578_100060497 266
200 3300031733 Ga0316577_10000360 Ga0316577_100003603 266
201 3300036647 Ga0316582_0009517 Ga0316582_0009517_522_1328 266
202 3300036712 Ga0316584_0011239 Ga0316584_0011239_5000_5806 266
203 iso_pu_bacteria 2511231010 2511292216 266
204 iso_pu_bacteria 2511231015 2511317878 266
205 iso_pu_bacteria 2599185188 2599504919 266
206 iso_pu_bacteria 2599185212 2599616601 266
207 iso_pu_bacteria 2599185248 2599772965 266
208 iso_pu_bacteria 2599185289 2599888278 266
209 iso_pu_bacteria 2599185291 2599900940 266
210 iso_pu_bacteria 2599185305 2599962670 266
211 iso_pu_bacteria 2599185306 2599967128 266
212 iso_pu_bacteria 2599185308 2599981215 266
213 iso_pu_bacteria 2599185311 2599997736 266
214 iso_pu_bacteria 2599185313 2600009380 266
215 iso_pu_bacteria 2599185314 2600013855 266
216 iso_pu_bacteria 2599185315 2600021229 266
217 iso_pu_bacteria 2599185316 2600026869 266
218 iso_pu_bacteria 2599185317 2600032799 266
219 iso_pu_bacteria 2599185318 2600039099 266
220 iso_pu_bacteria 2599185319 2600044693 266
221 iso_pu_bacteria 2599185321 2600056225 266
222 iso_pu_bacteria 2599185322 2600062320 266
223 iso_pu_bacteria 2599185323 2600068490 266
224 iso_pu_bacteria 2599185324 2600074649 266
225 iso_pu_bacteria 2599185325 2600079612 266
226 iso_pu_bacteria 2600254930 2600360417 266
227 iso_pu_bacteria 2600255318 2601800560 266
228 iso_pu_bacteria 2603880185 2606078632 266
229 iso_pu_bacteria 2603880199 2606125708 266
230 iso_pu_bacteria 2623620443 2624482977 266
231 iso_pu_bacteria 2667528170 2671093834 266
232 iso_pu_bacteria 2667528176 2671129912 266
233 iso_pu_bacteria 2713897148 2715752402 266
234 iso_pu_bacteria 2713897149 2715759150 266
235 iso_pu_bacteria 2718217725 2718636187 266
236 iso_pu_bacteria 2808606361 2808857322 266
237 iso_pu_bacteria 2808606376 2808926371 266
238 iso_pu_bacteria 2808606378 2808937374 266
239 iso_pu_bacteria 2808606380 2808948532 266
240 iso_pu_bacteria 2808606383 2808965704 266
241 iso_pu_bacteria 2808606389 2809000697 266
242 iso_pu_bacteria 2826581358 2826582841 266
243 iso_pu_bacteria 2842815866 2842819891 266
244 iso_pu_bacteria 2842832357 2842836903 266
245 iso_pu_bacteria 2842843487 2842847637 266
246 iso_pu_bacteria 2842849001 2842852865 266
247 iso_pu_bacteria 2844665904 2844666559 266
248 iso_pu_bacteria 2878029506 2878034910 266
249 iso_pu_bacteria 2919063839 2919067709 266
250 iso_pu_bacteria 2919385768 2919390572 266
251 iso_pu_bacteria 2919481497 2919485935 266
252 iso_pu_bacteria 2919487758 2919490884 266
253 iso_pu_bacteria 2974289157 2974294541 266
254 iso_pu_bacteria 2988728565 2988731017 266
255 iso_pu_bacteria 2998139840 2998144969 266
256 iso_pu_bacteria 3007419365 3007425289 266
257 iso_pu_bacteria 3007511990 3007516755 266
258 iso_pu_bacteria 3007718800 3007721330 266
259 iso_pu_bacteria 3007855910 3007860172 266
260 iso_pu_bacteria 3007861166 3007866425 266
261 iso_pu_bacteria 3007866637 3007867204 266
262 iso_pu_bacteria 8019769354 8019771260 266
263 iso_pu_bacteria 8029995093 8029995928 266
264 iso_pu_bacteria 8056166840 8056171599 266
265 iso_pu_bacteria 8056172158 8056172278 266
266 iso_pu_bacteria 8057798959 8057805270 266
267 3300005444 Ga0070694_100114182 Ga0070694_1001141822 267
268 3300005549 Ga0070704_100136088 Ga0070704_1001360882 267
269 3300005719 Ga0068861_100506447 Ga0068861_1005064472 267
270 3300005842 Ga0068858_100056248 Ga0068858_1000562483 267
271 3300009011 Ga0105251_10026245 Ga0105251_100262454 267
272 3300009148 Ga0105243_10282894 Ga0105243_102828942 267
273 3300014326 Ga0157380_10399401 Ga0157380_103994013 267
274 3300026035 Ga0207703_10042134 Ga0207703_100421345 267
275 3300046453 Ga0495627_005610 Ga0495627_005610_1699_2505 267
276 3300046458 Ga0495591_002014 Ga0495591_002014_8942_9748 267
277 3300046474 Ga0495605_0000033 Ga0495605_0000033_128432_129238 267
278 3300046499 Ga0495594_0034719 Ga0495594_0034719_1671_2477 267
279 3300046506 Ga0495583_0000031 Ga0495583_0000031_125206_126012 267
280 3300046512 Ga0495610_0018008 Ga0495610_0018008_1224_2030 267
281 3300046515 Ga0495620_0000038 Ga0495620_0000038_58973_59779 267
282 3300046518 Ga0495631_0003524 Ga0495631_0003524_7097_7903 267
283 3300046524 Ga0495648_0008410 Ga0495648_0008410_5722_6528 267
284 3300046530 Ga0495654_0000483 Ga0495654_0000483_369_1175 267
285 3300046538 Ga0495609_0000018 Ga0495609_0000018_228164_228970 267
286 3300046542 Ga0495597_0015152 Ga0495597_0015152_2408_3214 267
287 3300046558 Ga0495633_0000062 Ga0495633_0000062_107105_107911 267
288 3300046648 Ga0495611_0001911 Ga0495611_0001911_1883_2689 267
289 3300046665 Ga0495661_0000016 Ga0495661_0000016_113148_113954 267
290 3300046691 Ga0495670_0033389 Ga0495670_0033389_1121_1927 267
291 3300046692 Ga0495671_0007890 Ga0495671_0007890_2194_3000 267
292 3300046794 Ga0495589_0000246 Ga0495589_0000246_41385_42191 267
293 3300046810 Ga0495660_0001057 Ga0495660_0001057_4658_5464 267
294 3300047323 Ga0495683_0000092 Ga0495683_0000092_33717_34523 267
295 3300047446 Ga0495679_000241 Ga0495679_000241_3086_3892 267
296 3300047469 Ga0495673_0007475 Ga0495673_0007475_5237_6043 267
297 3300047470 Ga0495681_0041227 Ga0495681_0041227_1080_1886 267
298 3300048925 Ga0496122_0028772 Ga0496122_0028772_3030_3836 267
299 3300048926 Ga0496123_0018041 Ga0496123_0018041_1512_2318 267
300 3300049459 Ga0495678_000021 Ga0495678_000021_128068_128874 267
301 iso_pu_bacteria 2597489889 2597872045 267
302 iso_pu_bacteria 2599185167 2599401303 267
303 iso_pu_bacteria 2599185179 2599453028 267
304 iso_pu_bacteria 2599185190 2599515033 267
305 iso_pu_bacteria 2599185191 2599520194 267
306 iso_pu_bacteria 2599185290 2599894413 267
307 iso_pu_bacteria 2599185302 2599945004 267
308 iso_pu_bacteria 2599185304 2599955267 267
309 iso_pu_bacteria 2599185309 2599984000 267
310 iso_pu_bacteria 2599185310 2599990282 267
311 iso_pu_bacteria 2599185312 2600001776 267
312 iso_pu_bacteria 2599185320 2600048816 267
313 iso_pu_bacteria 2600255283 2601628672 267
314 iso_pu_bacteria 2643221571 2643870856 267
315 iso_pu_bacteria 2675903420 2677898471 267
316 iso_pu_bacteria 2738541271 2738691029 267
317 iso_pu_bacteria 2738543016 2739266834 267
318 iso_pu_bacteria 2808606385 2808977515 267
319 iso_pu_bacteria 2808606388 2808992827 267
320 iso_pu_bacteria 2834028612 2834033173 267
321 iso_pu_bacteria 2842805378 2842808418 267
322 iso_pu_bacteria 2852612431 2852618077 267
323 iso_pu_bacteria 2852667396 2852673135 267
324 iso_pu_bacteria 2929189879 2929194726 267
325 iso_pu_bacteria 2931390751 2931396000 267
326 iso_pu_bacteria 2945928738 2945931332 267
327 iso_pu_bacteria 2945961074 2945966352 267
328 iso_pu_bacteria 2946006987 2946007380 267
329 iso_pu_bacteria 2946027586 2946033216 267
330 iso_pu_bacteria 8054285046 8054289434 267
331 iso_pu_bacteria 8054503363 8054508503 267
332 iso_pu_bacteria 8055817908 8055823462 267
333 iso_pu_bacteria 8056131705 8056136904 267
334 iso_pu_bacteria 8056148874 8056150157 267
335 iso_pu_bacteria 8056161164 8056163175 267
336 3300009036 Ga0105244_10000154 Ga0105244_1000015421 269
337 3300011119 Ga0105246_10040458 Ga0105246_100404584 269
338 3300025292 Ga0209676_1000337 Ga0209676_10003377 269
339 3300025298 Ga0209050_1000106 Ga0209050_100010679 269
340 3300025303 Ga0209051_1000260 Ga0209051_10002606 269
341 3300025728 Ga0207655_1002652 Ga0207655_100265213 269
342 3300041411 Ga0439466_0009360 Ga0439466_0009360_305_1114 269
343 3300042016 Ga0439463_004166 Ga0439463_004166_311_1120 269
344 3300003781 Ga0055536_1000448 Ga0055536_10004481 270
345 3300003781 Ga0055536_1005167 Ga0055536_10051676 270
346 3300003791 Ga0055530_10005008 Ga0055530_100050082 270
347 3300003792 Ga0055540_1004272 Ga0055540_10042726 270
348 3300003794 Ga0055531_10000125 Ga0055531_1000012564 270
349 3300005288 Ga0065714_10067243 Ga0065714_100672435 270
350 3300005290 Ga0065712_10069723 Ga0065712_100697233 270
351 3300005353 Ga0070669_100002174 Ga0070669_1000021745 270
352 3300006058 Ga0075432_10051784 Ga0075432_100517842 270
353 3300006946 Ga0079104_1000387 Ga0079104_100038723 270
354 3300006946 Ga0079104_1024525 Ga0079104_10245252 270
355 3300009011 Ga0105251_10041513 Ga0105251_100415133 270
356 3300009011 Ga0105251_10158295 Ga0105251_101582951 270
357 3300009011 Ga0105251_10197152 Ga0105251_101971521 270
358 3300009036 Ga0105244_10017761 Ga0105244_100177615 270
359 3300009148 Ga0105243_10034146 Ga0105243_100341465 270
360 3300011119 Ga0105246_10001291 Ga0105246_1000129110 270
361 3300013100 Ga0157373_10054895 Ga0157373_100548954 270
362 3300013100 Ga0157373_10106459 Ga0157373_101064592 270
363 3300013102 Ga0157371_10031968 Ga0157371_100319685 270
364 3300013105 Ga0157369_10325302 Ga0157369_103253022 270
365 3300013105 Ga0157369_10339334 Ga0157369_103393341 270
366 3300014497 Ga0182008_10024537 Ga0182008_100245372 270
367 3300025291 Ga0209675_1009621 Ga0209675_10096213 270
368 3300025292 Ga0209676_1000076 Ga0209676_1000076228 270
369 3300025292 Ga0209676_1000314 Ga0209676_100031462 270
370 3300025298 Ga0209050_1000063 Ga0209050_100006390 270
371 3300025303 Ga0209051_1000045 Ga0209051_100004563 270
372 3300025304 Ga0209257_1000185 Ga0209257_100018563 270
373 3300025711 Ga0207696_1003771 Ga0207696_10037711 270
374 3300025728 Ga0207655_1001039 Ga0207655_100103915 270
375 3300025728 Ga0207655_1029079 Ga0207655_10290791 270
376 3300025735 Ga0207713_1002074 Ga0207713_100207413 270
377 3300025735 Ga0207713_1097782 Ga0207713_10977822 270
378 3300025935 Ga0207709_10000030 Ga0207709_1000003098 270
379 3300027111 Ga0209281_1006506 Ga0209281_10065063 270
380 3300030734 Ga0316179_1015510 Ga0316179_10155107 270
381 3300030735 Ga0316178_1130694 Ga0316178_113069415 270
382 3300031548 Ga0307408_100010567 Ga0307408_1000105676 270
383 3300031548 Ga0307408_100306393 Ga0307408_1003063931 270
384 3300031901 Ga0307406_10068357 Ga0307406_100683573 270
385 3300031911 Ga0307412_10130008 Ga0307412_101300081 270
386 3300031911 Ga0307412_10315476 Ga0307412_103154762 270
387 3300032005 Ga0307411_10066397 Ga0307411_100663972 270
388 3300041405 Ga0439438_037553 Ga0439438_037553_85_897 270
389 3300041405 Ga0439438_037554 Ga0439438_037554_85_897 270
390 3300041407 Ga0439447_013944 Ga0439447_013944_1231_2043 270
391 3300041407 Ga0439447_022772 Ga0439447_022772_614_1426 270
392 3300042004 Ga0439445_0042510 Ga0439445_0042510_190_1002 270
393 3300042006 Ga0439432_022233 Ga0439432_022233_840_1652 270
394 3300042010 Ga0439452_000211 Ga0439452_000211_26240_27052 270
395 3300042016 Ga0439463_018043 Ga0439463_018043_44_856 270
396 3300042115 Ga0450911_000136 Ga0450911_000136_15521_16333 270
397 3300042137 Ga0450902_000577 Ga0450902_000577_979_1791 270
398 3300042137 Ga0450902_004263 Ga0450902_004263_175_987 270
399 3300042139 Ga0450904_002438 Ga0450904_002438_488_1300 270
400 3300042145 Ga0450906_000847 Ga0450906_000847_2933_3745 270
401 3300046453 Ga0495627_000037 Ga0495627_000037_92129_92941 270
402 3300046474 Ga0495605_0148220 Ga0495605_0148220_182_994 270
403 3300046501 Ga0495607_0000749 Ga0495607_0000749_370_1182 270
404 3300046520 Ga0495637_0016359 Ga0495637_0016359_152_964 270
405 3300046557 Ga0495622_0098965 Ga0495622_0098965_203_1015 270
406 3300048919 Ga0496116_0036032 Ga0496116_0036032_170_982 270
407 3300048920 Ga0496117_0039789 Ga0496117_0039789_159_971 270
408 3300048921 Ga0496118_0044927 Ga0496118_0044927_2495_3307 270
409 3300048925 Ga0496122_0044502 Ga0496122_0044502_168_980 270
410 3300048926 Ga0496123_0070907 Ga0496123_0070907_163_975 270
411 3300003751 Ga0055538_1000042 Ga0055538_100004272 271
412 3300009011 Ga0105251_10085303 Ga0105251_100853031 271
413 3300009036 Ga0105244_10117892 Ga0105244_101178922 271
414 3300009092 Ga0105250_10046596 Ga0105250_100465961 271
415 3300013100 Ga0157373_10048337 Ga0157373_100483374 271
416 3300025256 Ga0209759_1001413 Ga0209759_10014134 271
417 3300025711 Ga0207696_1005090 Ga0207696_10050903 271
418 3300025735 Ga0207713_1003626 Ga0207713_10036268 271
419 3300030733 Ga0314311_1081897 Ga0314311_10818972 271
420 3300041411 Ga0439466_0031258 Ga0439466_0031258_341_1177 271
421 3300042016 Ga0439463_015665 Ga0439463_015665_176_994 271
422 3300042142 Ga0450905_006991 Ga0450905_006991_364_1188 271
423 3300046452 Ga0495617_063078 Ga0495617_063078_207_1028 271
424 3300046458 Ga0495591_000259 Ga0495591_000259_20261_21082 271
425 3300046458 Ga0495591_000732 Ga0495591_000732_22748_23566 271
426 3300046460 Ga0495638_0014623 Ga0495638_0014623_1625_2449 271
427 3300046471 Ga0495650_0000311 Ga0495650_0000311_23482_24303 271
428 3300046471 Ga0495650_0009563 Ga0495650_0009563_2067_2885 271
429 3300046471 Ga0495650_0015985 Ga0495650_0015985_148_966 271
430 3300046474 Ga0495605_0000453 Ga0495605_0000453_559_1377 271
431 3300046474 Ga0495605_0002622 Ga0495605_0002622_8126_8944 271
432 3300046491 Ga0495584_0004057 Ga0495584_0004057_6724_7545 271
433 3300046492 Ga0495585_0000684 Ga0495585_0000684_29891_30712 271
434 3300046492 Ga0495585_0024625 Ga0495585_0024625_183_1001 271
435 3300046500 Ga0495596_0000283 Ga0495596_0000283_16689_17510 271
436 3300046501 Ga0495607_0000385 Ga0495607_0000385_1594_2418 271
437 3300046501 Ga0495607_0000614 Ga0495607_0000614_33267_34085 271
438 3300046501 Ga0495607_0002046 Ga0495607_0002046_13850_14668 271
439 3300046506 Ga0495583_0000855 Ga0495583_0000855_9203_10021 271
440 3300046506 Ga0495583_0001402 Ga0495583_0001402_2284_3105 271
441 3300046506 Ga0495583_0011462 Ga0495583_0011462_4096_4914 271
442 3300046506 Ga0495583_0023874 Ga0495583_0023874_171_989 271
443 3300046507 Ga0495606_0000722 Ga0495606_0000722_24193_25011 271
444 3300046507 Ga0495606_0008912 Ga0495606_0008912_2739_3560 271
445 3300046512 Ga0495610_0118464 Ga0495610_0118464_304_1125 271
446 3300046515 Ga0495620_0000190 Ga0495620_0000190_18175_18993 271
447 3300046515 Ga0495620_0001679 Ga0495620_0001679_177_995 271
448 3300046519 Ga0495632_0001408 Ga0495632_0001408_4029_4847 271
449 3300046520 Ga0495637_0000064 Ga0495637_0000064_33102_33923 271
450 3300046520 Ga0495637_0116308 Ga0495637_0116308_174_992 271
451 3300046523 Ga0495644_0006268 Ga0495644_0006268_1337_2158 271
452 3300046524 Ga0495648_0019608 Ga0495648_0019608_3407_4228 271
453 3300046530 Ga0495654_0103842 Ga0495654_0103842_412_1233 271
454 3300046538 Ga0495609_0000056 Ga0495609_0000056_51881_52699 271
455 3300046538 Ga0495609_0000161 Ga0495609_0000161_62917_63738 271
456 3300046538 Ga0495609_0040798 Ga0495609_0040798_1230_2048 271
457 3300046538 Ga0495609_0115307 Ga0495609_0115307_113_931 271
458 3300046557 Ga0495622_0003773 Ga0495622_0003773_5905_6726 271
459 3300046616 Ga0495668_0132813 Ga0495668_0132813_367_1188 271
460 3300046616 Ga0495668_0169688 Ga0495668_0169688_266_1087 271
461 3300046648 Ga0495611_0003334 Ga0495611_0003334_5743_6564 271
462 3300046660 Ga0495625_0000194 Ga0495625_0000194_33223_34044 271
463 3300046665 Ga0495661_0000093 Ga0495661_0000093_71463_72281 271
464 3300046665 Ga0495661_0000140 Ga0495661_0000140_79717_80535 271
465 3300046665 Ga0495661_0000662 Ga0495661_0000662_33116_33937 271
466 3300046665 Ga0495661_0046621 Ga0495661_0046621_1657_2475 271
467 3300046810 Ga0495660_0011381 Ga0495660_0011381_1924_2745 271
468 3300047320 Ga0495672_0026878 Ga0495672_0026878_273_1094 271
469 3300047321 Ga0495676_0000052 Ga0495676_0000052_62991_63812 271
470 3300047323 Ga0495683_0113351 Ga0495683_0113351_348_1169 271
471 3300047446 Ga0495679_000136 Ga0495679_000136_13604_14425 271
472 3300047469 Ga0495673_0000667 Ga0495673_0000667_487_1305 271
473 3300047469 Ga0495673_0047963 Ga0495673_0047963_543_1361 271
474 3300047469 Ga0495673_0084388 Ga0495673_0084388_157_975 271
475 3300047472 Ga0495686_0049385 Ga0495686_0049385_1387_2208 271
476 3300048091 Ga0495626_0000126 Ga0495626_0000126_65060_65881 271
477 3300048920 Ga0496117_0206158 Ga0496117_0206158_134_949 271
478 3300048924 Ga0496121_0002045 Ga0496121_0002045_7310_8128 271
479 3300048925 Ga0496122_0106781 Ga0496122_0106781_214_1032 271
480 3300048926 Ga0496123_0164793 Ga0496123_0164793_246_1064 271
481 3300048927 Ga0496124_0000689 Ga0496124_0000689_54362_55180 271
482 3300048927 Ga0496124_0003367 Ga0496124_0003367_18624_19442 271
483 3300048927 Ga0496124_0229930 Ga0496124_0229930_300_1115 271
484 3300048927 Ga0496124_0287858 Ga0496124_0287858_179_994 271
485 3300048927 Ga0496124_0302432 Ga0496124_0302432_235_1053 271
486 3300049459 Ga0495678_023851 Ga0495678_023851_607_1428 271
487 3300049460 Ga0495682_0001069 Ga0495682_0001069_235_1053 271
488 3300049460 Ga0495682_0034629 Ga0495682_0034629_201_1019 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06167

Peptidase_M90

Glucose-regulated metallo-peptidase M90

1

259

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dl1-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution 0.9334 23 255
3dl1-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution 0.9038 23 255
3khi-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution 0.8871 19 255
3khi-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution 0.8719 19 255
6r5c-assembly2.cif.gz_B crystal structure of ppep-1(w103f/e143a/y178f) in complex with substrate peptide ac-evnppvp-conh2 0.5645 44 248
ID Description Score Start End Superfamily
af_P76346_16_139_1.10.472.150 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.938 23 145 1.10.472.150
3dl1A01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.9293 23 145 1.10.472.150
af_P76346_16_139_1.10.472.150 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.9093 23 145 1.10.472.150
3dl1A01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.9021 23 145 1.10.472.150
af_P76346_140_265_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8622 148 271 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A3M3RD88-F1-model_v4 Uncharacterized protein 0.9967 177 268 GO:0004177
GO:0005829
GO:0008237
AF-A0A7X2RY16-F1-model_v4 Zinc-dependent peptidase 0.987 1 271 GO:0004177
GO:0005829
GO:0006508
GO:0008237
AF-A0A7Z8JR23-F1-model_v4 deleted 0.9863 1 271
AF-A0A1B3CZ29-F1-model_v4 Zinc-dependent peptidase 0.9846 1 271 GO:0004177
GO:0005829
GO:0006508
GO:0008237
AF-A0A7D5QQ81-F1-model_v4 deleted 0.9842 1 270

Feature Viewer

pLDDT pTM Quality
92.49 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map