F453489

General Info

Members Datasets Scaffolds Average Seq Length
487 253 487 110

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0086445|Ga0495641_0086445_487_846
Length 119
Sequence MDVEEALSLSQFEGLPSMRWSLTGLNEEGDETWLIRGIARKLYHCPGCHGDIPVGEEHTVVQYVRRLGGTDHHHWHRRCAEELLLPELGNLKRVPASESSQSRLEERGRRPSGRRDRRR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
141 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 11.09
Rhizosphere 81.52
Stem 0
Stem Tuber 0
Unclassified 6.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004506 3300001979 Bacteria 5997
2 Ga0070683_100000835 3300005329 Bacteria 22828
3 Ga0070683_100003886 3300005329 Bacteria 12223
4 Ga0070690_100438449 3300005330 Bacteria 966
5 Ga0070666_10040741 3300005335 Bacteria 3101
6 Ga0070666_10067311 3300005335 Bacteria 2432
7 Ga0070682_100000011 3300005337 Bacteria 266253
8 Ga0068868_100004956 3300005338 Bacteria 9351
9 Ga0070689_100128119 3300005340 Bacteria 2033
10 Ga0070691_10000138 3300005341 Bacteria 22836
11 Ga0070691_10756793 3300005341 Bacteria 588
12 Ga0070661_100000058 3300005344 Bacteria 87363
13 Ga0070661_100758942 3300005344 Bacteria 794
14 Ga0070692_10036350 3300005345 Bacteria 2499
15 Ga0070692_10689195 3300005345 Bacteria 686
16 Ga0070668_100089709 3300005347 Bacteria 2422
17 Ga0070668_100120668 3300005347 Bacteria 2095
18 Ga0070668_102019466 3300005347 Unclassified 532
19 Ga0070675_100000036 3300005354 Bacteria 85959
20 Ga0070671_100343162 3300005355 Bacteria 1274
21 Ga0070673_100472745 3300005364 Bacteria 1130
22 Ga0070688_100000171 3300005365 Bacteria 34942
23 Ga0070688_100000360 3300005365 Bacteria 23047
24 Ga0070667_100001076 3300005367 Bacteria 24988
25 Ga0070667_100006751 3300005367 Bacteria 9531
26 Ga0070667_100045073 3300005367 Bacteria 3707
27 Ga0070667_100102665 3300005367 Bacteria 2471
28 Ga0070667_100683926 3300005367 Unclassified 948
29 Ga0070709_11345480 3300005434 Unclassified 577
30 Ga0070714_100094095 3300005435 Bacteria 2630
31 Ga0070714_100566936 3300005435 Unclassified 1088
32 Ga0070714_102312655 3300005435 Unclassified 523
33 Ga0070713_100000047 3300005436 Bacteria 76760
34 Ga0070713_100039662 3300005436 Bacteria 3824
35 Ga0070711_100091636 3300005439 Bacteria 2192
36 Ga0070700_100074280 3300005441 Bacteria 2178
37 Ga0070694_100343819 3300005444 Bacteria 1154
38 Ga0070694_101172337 3300005444 Unclassified 643
39 Ga0070663_100003998 3300005455 Bacteria 8599
40 Ga0070663_100772304 3300005455 Bacteria 822
41 Ga0070681_10621632 3300005458 Bacteria 995
42 Ga0070685_10000019 3300005466 Bacteria 105881
43 Ga0070685_10000020 3300005466 Bacteria 104332
44 Ga0070685_10209781 3300005466 Bacteria 1271
45 Ga0070685_10637005 3300005466 Bacteria 771
46 Ga0070679_100012803 3300005530 Bacteria 8026
47 Ga0070684_100610062 3300005535 Bacteria 1015
48 Ga0070672_100000001 3300005543 Bacteria 204624
49 Ga0070672_101216475 3300005543 Bacteria 671
50 Ga0070695_100322300 3300005545 Unclassified 1149
51 Ga0070693_100926138 3300005547 Unclassified 655
52 Ga0070665_100001462 3300005548 Bacteria 27694
53 Ga0070665_100051392 3300005548 Bacteria 4133
54 Ga0070665_100183823 3300005548 Bacteria 2091
55 Ga0070665_100235741 3300005548 Unclassified 1830
56 Ga0070665_101889954 3300005548 Unclassified 603
57 Ga0070704_100231028 3300005549 Bacteria 1509
58 Ga0068855_100337954 3300005563 Bacteria 1661
59 Ga0070664_100116556 3300005564 Bacteria 2336
60 Ga0068854_100003343 3300005578 Bacteria 9998
61 Ga0068854_101110222 3300005578 Bacteria 705
62 Ga0068856_100003300 3300005614 Bacteria 16401
63 Ga0070702_100020360 3300005615 Bacteria 3474
64 Ga0068852_100000002 3300005616 Bacteria 268221
65 Ga0068852_100044940 3300005616 Bacteria 3754
66 Ga0068866_10065962 3300005718 Bacteria 1895
67 Ga0068861_102063091 3300005719 Bacteria 570
68 Ga0068851_10000730 3300005834 Bacteria 14041
69 Ga0068851_10000911 3300005834 Bacteria 12735
70 Ga0068863_100029512 3300005841 Bacteria 5235
71 Ga0068863_101512984 3300005841 Unclassified 680
72 Ga0068860_100143302 3300005843 Bacteria 2298
73 Ga0068862_100000943 3300005844 Bacteria 28026
74 Ga0068862_100510751 3300005844 Bacteria 1142
75 Ga0081455_10029831 3300005937 Bacteria 4967
76 Ga0081455_10038488 3300005937 Bacteria 4235
77 Ga0081455_10046721 3300005937 Bacteria 3754
78 Ga0081455_10931649 3300005937 Unclassified 539
79 Ga0081540_1000100 3300005983 Bacteria 91640
80 Ga0081539_10002227 3300005985 Bacteria 28283
81 Ga0070712_100007821 3300006175 Bacteria 6695
82 Ga0097621_102405544 3300006237 Bacteria 504
83 Ga0068871_100301341 3300006358 Bacteria 1407
84 Ga0075430_100125903 3300006846 Bacteria 2136
85 Ga0075433_10000421 3300006852 Bacteria 27102
86 Ga0068865_100000013 3300006881 Bacteria 141352
87 Ga0105240_11019158 3300009093 Unclassified 884
88 Ga0105245_10000125 3300009098 Bacteria 73764
89 Ga0105245_10052008 3300009098 Bacteria 3673
90 Ga0105247_10001978 3300009101 Bacteria 14224
91 Ga0105247_10134859 3300009101 Bacteria 1612
92 Ga0105243_10024723 3300009148 Bacteria 4584
93 Ga0105241_10065255 3300009174 Bacteria 2813
94 Ga0105242_10000117 3300009176 Bacteria 57885
95 Ga0105242_10000931 3300009176 Bacteria 22774
96 Ga0105242_12072945 3300009176 Bacteria 612
97 Ga0105248_10000020 3300009177 Bacteria 284637
98 Ga0105237_11807037 3300009545 Unclassified 619
99 Ga0105249_10003509 3300009553 Bacteria 13564
100 Ga0105249_10311451 3300009553 Bacteria 1583
101 Ga0105239_10515909 3300010375 Bacteria 1359
102 Ga0105239_10819182 3300010375 Bacteria 1067
103 Ga0105239_12347614 3300010375 Bacteria 621
104 Ga0105246_12261120 3300011119 Unclassified 530
105 Ga0157373_11248404 3300013100 Bacteria 561
106 Ga0157371_10043297 3300013102 Bacteria 3207
107 Ga0157370_10002971 3300013104 Bacteria 20162
108 Ga0157370_10580794 3300013104 Bacteria 1027
109 Ga0157369_10000307 3300013105 Bacteria 65486
110 Ga0157369_10796624 3300013105 Bacteria 971
111 Ga0157369_12215560 3300013105 Unclassified 557
112 Ga0157374_10671340 3300013296 Bacteria 1049
113 Ga0157374_12755937 3300013296 Unclassified 519
114 Ga0157378_10003176 3300013297 Bacteria 14588
115 Ga0157378_10031397 3300013297 Bacteria 4693
116 Ga0157378_10118701 3300013297 Bacteria 2435
117 Ga0163162_13467411 3300013306 Bacteria 502
118 Ga0157372_10000053 3300013307 Bacteria 128824
119 Ga0157372_10658337 3300013307 Bacteria 1219
120 Ga0157375_10001535 3300013308 Bacteria 19883
121 Ga0157375_10324303 3300013308 Bacteria 1705
122 Ga0157375_12133748 3300013308 Unclassified 667
123 Ga0163163_13212907 3300014325 Unclassified 510
124 Ga0163163_13236525 3300014325 Unclassified 508
125 Ga0157380_10000016 3300014326 Bacteria 126029
126 Ga0157380_10244106 3300014326 Bacteria 1621
127 Ga0157380_10444701 3300014326 Unclassified 1243
128 Ga0157377_11032762 3300014745 Bacteria 625
129 Ga0157379_10011155 3300014968 Bacteria 7832
130 Ga0157379_11384530 3300014968 Bacteria 681
131 Ga0157376_10022880 3300014969 Bacteria 4880
132 Ga0157376_10056914 3300014969 Bacteria 3269
133 Ga0206356_11093252 3300020070 Bacteria 1017
134 Ga0224712_10555524 3300022467 Unclassified 558
135 Ga0207656_10000211 3300025321 Bacteria 20768
136 Ga0207656_10004794 3300025321 Bacteria 4747
137 Ga0207642_10046848 3300025899 Bacteria 1929
138 Ga0207710_10000821 3300025900 Bacteria 16775
139 Ga0207710_10080177 3300025900 Bacteria 1513
140 Ga0207680_10036448 3300025903 Bacteria 2833
141 Ga0207680_10080560 3300025903 Bacteria 2045
142 Ga0207699_10547634 3300025906 Bacteria 839
143 Ga0207654_10047296 3300025911 Bacteria 2457
144 Ga0207707_10095334 3300025912 Bacteria 2600
145 Ga0207695_10705369 3300025913 Bacteria 889
146 Ga0207671_10394191 3300025914 Bacteria 1101
147 Ga0207671_10588962 3300025914 Unclassified 886
148 Ga0207693_10049045 3300025915 Bacteria 3316
149 Ga0207663_10062835 3300025916 Bacteria 2362
150 Ga0207649_10000283 3300025920 Bacteria 39628
151 Ga0207649_10690246 3300025920 Bacteria 791
152 Ga0207652_10008840 3300025921 Bacteria 8115
153 Ga0207694_10860681 3300025924 Bacteria 766
154 Ga0207659_10000013 3300025926 Bacteria 172742
155 Ga0207687_10000017 3300025927 Bacteria 237310
156 Ga0207687_10030407 3300025927 Bacteria 3641
157 Ga0207700_10000033 3300025928 Bacteria 123113
158 Ga0207664_10102186 3300025929 Bacteria 2370
159 Ga0207664_10859952 3300025929 Unclassified 815
160 Ga0207664_11498908 3300025929 Bacteria 596
161 Ga0207644_10923133 3300025931 Bacteria 732
162 Ga0207686_10000254 3300025934 Bacteria 40780
163 Ga0207686_10002477 3300025934 Bacteria 10029
164 Ga0207686_11230270 3300025934 Bacteria 613
165 Ga0207709_10006143 3300025935 Bacteria 6765
166 Ga0207670_10098140 3300025936 Bacteria 2087
167 Ga0207669_10068491 3300025937 Bacteria 2217
168 Ga0207669_10334328 3300025937 Bacteria 1164
169 Ga0207704_10000040 3300025938 Bacteria 90178
170 Ga0207704_10384276 3300025938 Bacteria 1103
171 Ga0207691_10000017 3300025940 Bacteria 134441
172 Ga0207711_10000006 3300025941 Bacteria 792692
173 Ga0207661_10000198 3300025944 Bacteria 39018
174 Ga0207661_10002675 3300025944 Bacteria 12265
175 Ga0207679_10071973 3300025945 Bacteria 2610
176 Ga0207679_10093327 3300025945 Bacteria 2334
177 Ga0207667_10104473 3300025949 Bacteria 2922
178 Ga0207667_10781886 3300025949 Bacteria 952
179 Ga0207651_10607967 3300025960 Bacteria 956
180 Ga0207712_10011490 3300025961 Bacteria 5642
181 Ga0207668_10031903 3300025972 Bacteria 3475
182 Ga0207668_10099769 3300025972 Bacteria 2155
183 Ga0207640_10000370 3300025981 Bacteria 29030
184 Ga0207658_10003877 3300025986 Bacteria 10532
185 Ga0207658_10087929 3300025986 Bacteria 2400
186 Ga0207658_10104027 3300025986 Bacteria 2230
187 Ga0207658_10182475 3300025986 Bacteria 1738
188 Ga0207677_10002708 3300026023 Bacteria 9342
189 Ga0207639_10118502 3300026041 Bacteria 2171
190 Ga0207678_10047722 3300026067 Bacteria 3702
191 Ga0207708_10201180 3300026075 Bacteria 1589
192 Ga0207702_10002446 3300026078 Bacteria 17589
193 Ga0207702_10706766 3300026078 Bacteria 993
194 Ga0207702_11390603 3300026078 Bacteria 696
195 Ga0207641_10043814 3300026088 Bacteria 3760
196 Ga0207641_10351086 3300026088 Bacteria 1406
197 Ga0207641_10425831 3300026088 Bacteria 1279
198 Ga0207641_11447646 3300026088 Unclassified 688
199 Ga0207674_11121611 3300026116 Bacteria 756
200 Ga0207698_10000004 3300026142 Bacteria 313614
201 Ga0207698_10038394 3300026142 Bacteria 3538
202 Ga0268266_10000601 3300028379 Bacteria 49250
203 Ga0268266_10001254 3300028379 Bacteria 31003
204 Ga0268266_10026262 3300028379 Bacteria 4956
205 Ga0268266_10161379 3300028379 Bacteria 2028
206 Ga0268266_10314156 3300028379 Unclassified 1465
207 Ga0268266_10737825 3300028379 Unclassified 950
208 Ga0268266_11109158 3300028379 Bacteria 765
209 Ga0268266_11461450 3300028379 Unclassified 659
210 Ga0268265_10004453 3300028380 Bacteria 9721
211 Ga0268265_11319361 3300028380 Bacteria 722
212 Ga0268264_10464896 3300028381 Bacteria 1228
213 Ga0268264_10511974 3300028381 Bacteria 1172
214 Ga0265319_1000014 3300028563 Bacteria 177623
215 Ga0265334_10047765 3300028573 Bacteria 1650
216 Ga0265338_10000244 3300028800 Bacteria 100528
217 Ga0265324_10045813 3300029957 Bacteria 1506
218 Ga0265313_10239623 3300031595 Bacteria 743
219 Ga0307416_101430708 3300032002 Unclassified 797
220 Ga0307415_100240361 3300032126 Bacteria 1464
221 Ga0316583_10046322 3300032133 Bacteria 1535
222 Ga0373955_0437768 3300035172 Unclassified 796
223 Ga0373937_0734533 3300036401 Bacteria 934
224 Ga0316582_0605817 3300036647 Bacteria 754
225 Ga0451800_0374107 3300041459 Unclassified 671
226 Ga0451802_1290304 3300041460 Unclassified 548
227 Ga0451807_1434009 3300041486 Bacteria 1428
228 Ga0451807_1892530 3300041486 Bacteria 546
229 Ga0451835_0389310 3300041492 Bacteria 578
230 Ga0451849_0058156 3300041505 Unclassified 754
231 Ga0451849_1214696 3300041505 Unclassified 1660
232 Ga0451853_1746024 3300041512 Bacteria 935
233 Ga0466963_0523116 3300044694 Bacteria 838
234 Ga0466967_0000001 3300045976 Bacteria 229823
235 Ga0466967_0175529 3300045976 Bacteria 2019
236 Ga0466967_1714654 3300045976 Unclassified 626
237 Ga0495592_0371965 3300046454 Bacteria 911
238 Ga0495592_0425435 3300046454 Bacteria 837
239 Ga0495629_0000260 3300046459 Bacteria 46062
240 Ga0495629_0000487 3300046459 Bacteria 33176
241 Ga0495629_0010874 3300046459 Bacteria 6617
242 Ga0495638_0029338 3300046460 Bacteria 3547
243 Ga0495641_0023225 3300046461 Bacteria 3086
244 Ga0495641_0086445 3300046461 Bacteria 1403
245 Ga0495641_0088313 3300046461 Bacteria 1387
246 Ga0495651_0076881 3300046462 Bacteria 2528
247 Ga0495651_0100543 3300046462 Bacteria 2154
248 Ga0495651_0185936 3300046462 Bacteria 1466
249 Ga0495653_0270457 3300046463 Bacteria 1119
250 Ga0495662_0013837 3300046476 Bacteria 3926
251 Ga0495664_0184458 3300046477 Unclassified 1265
252 Ga0495664_0681916 3300046477 Unclassified 608
253 Ga0495594_0000089 3300046499 Bacteria 41876
254 Ga0495606_0000040 3300046507 Bacteria 223500
255 Ga0495608_0000007 3300046511 Bacteria 313495
256 Ga0495608_0549812 3300046511 Bacteria 696
257 Ga0495618_0150995 3300046514 Bacteria 1484
258 Ga0495618_0161212 3300046514 Bacteria 1430
259 Ga0495628_0000859 3300046516 Bacteria 28076
260 Ga0495628_0123737 3300046516 Bacteria 1982
261 Ga0495630_0000014 3300046517 Bacteria 217229
262 Ga0495630_0000256 3300046517 Bacteria 42987
263 Ga0495630_0054889 3300046517 Bacteria 2985
264 Ga0495630_0333418 3300046517 Bacteria 1160
265 Ga0495652_0000010 3300046529 Bacteria 261584
266 Ga0495652_0003765 3300046529 Bacteria 14828
267 Ga0495640_0363851 3300046533 Bacteria 891
268 Ga0495587_0000618 3300046536 Bacteria 24150
269 Ga0495587_0128483 3300046536 Unclassified 1449
270 Ga0495587_0181367 3300046536 Bacteria 1194
271 Ga0495587_0511353 3300046536 Bacteria 664
272 Ga0495587_0656834 3300046536 Bacteria 576
273 Ga0495645_0223416 3300046543 Bacteria 1265
274 Ga0495645_0252907 3300046543 Bacteria 1170
275 Ga0495622_0000218 3300046557 Bacteria 45469
276 Ga0495667_0000020 3300046559 Bacteria 180876
277 Ga0495667_0282586 3300046559 Bacteria 1053
278 Ga0495634_0002567 3300046642 Bacteria 14991
279 Ga0495634_0017341 3300046642 Bacteria 5141
280 Ga0495634_0061993 3300046642 Bacteria 2484
281 Ga0495625_0000688 3300046660 Bacteria 48233
282 Ga0495635_0386765 3300046663 Bacteria 930
283 Ga0495588_0000338 3300046674 Bacteria 30480
284 Ga0495657_0000001 3300046675 Bacteria 445641
285 Ga0495657_0176745 3300046675 Bacteria 1312
286 Ga0495647_0001982 3300046681 Bacteria 6392
287 Ga0495647_0200061 3300046681 Bacteria 876
288 Ga0495658_0003808 3300046683 Bacteria 7472
289 Ga0495658_0117560 3300046683 Unclassified 1605
290 Ga0495613_0000041 3300046689 Bacteria 130784
291 Ga0495624_0000671 3300046690 Bacteria 26768
292 Ga0495604_0000239 3300047317 Bacteria 49113
293 Ga0495604_0105915 3300047317 Bacteria 2057
294 Ga0495674_0002248 3300047319 Bacteria 18976
295 Ga0495672_0214273 3300047320 Bacteria 955
296 Ga0495672_0214623 3300047320 Bacteria 953
297 Ga0495676_0001364 3300047321 Bacteria 21008
298 Ga0495676_0137244 3300047321 Bacteria 1757
299 Ga0495676_0397158 3300047321 Bacteria 915
300 Ga0495676_0852702 3300047321 Unclassified 585
301 Ga0495680_0002541 3300047322 Bacteria 18636
302 Ga0495680_0126650 3300047322 Bacteria 1880
303 Ga0495675_0000300 3300047444 Bacteria 35530
304 Ga0495675_0298925 3300047444 Unclassified 956
305 Ga0495684_0185521 3300047471 Bacteria 1540
306 Ga0495684_0301749 3300047471 Bacteria 1150
307 Ga0495684_0323656 3300047471 Bacteria 1102
308 Ga0495684_0540874 3300047471 Bacteria 795
309 Ga0495686_0090480 3300047472 Bacteria 1858
310 Ga0495593_0072470 3300047673 Bacteria 1788
311 Ga0495593_0111770 3300047673 Bacteria 1395
312 Ga0495602_0000007 3300048088 Bacteria 273212
313 Ga0495602_0000611 3300048088 Bacteria 33553
314 Ga0495602_0267802 3300048088 Bacteria 1264
315 Ga0495602_0761977 3300048088 Bacteria 652
316 Ga0495602_1149475 3300048088 Unclassified 507
317 Ga0496100_0000001 3300048903 Bacteria 530179
318 Ga0496101_0000004 3300048904 Bacteria 331599
319 Ga0496101_0829407 3300048904 Bacteria 729
320 Ga0496102_0000294 3300048905 Bacteria 64001
321 Ga0496102_0061178 3300048905 Bacteria 3445
322 Ga0496102_0370462 3300048905 Bacteria 1348
323 Ga0496102_0677577 3300048905 Bacteria 954
324 Ga0496103_0000159 3300048906 Bacteria 71148
325 Ga0496103_0209260 3300048906 Bacteria 1254
326 Ga0496103_0982565 3300048906 Unclassified 526
327 Ga0496104_0000015 3300048907 Bacteria 374530
328 Ga0496104_0000765 3300048907 Bacteria 27516
329 Ga0496104_0033800 3300048907 Bacteria 4766
330 Ga0496104_0039152 3300048907 Bacteria 4438
331 Ga0496104_0491021 3300048907 Bacteria 1139
332 Ga0496105_0000004 3300048908 Bacteria 475798
333 Ga0496105_0007927 3300048908 Bacteria 8252
334 Ga0496105_0063371 3300048908 Bacteria 3050
335 Ga0496105_0618973 3300048908 Unclassified 838
336 Ga0496105_0909849 3300048908 Bacteria 663
337 Ga0496106_0000056 3300048909 Bacteria 90682
338 Ga0496106_0738163 3300048909 Unclassified 783
339 Ga0496107_0000005 3300048910 Bacteria 281747
340 Ga0496107_0022168 3300048910 Bacteria 4488
341 Ga0496108_0000063 3300048911 Bacteria 118950
342 Ga0496108_0004943 3300048911 Bacteria 10771
343 Ga0496109_0000012 3300048912 Bacteria 229699
344 Ga0496109_0000173 3300048912 Bacteria 63867
345 Ga0496109_0586198 3300048912 Unclassified 1051
346 Ga0496109_0749907 3300048912 Bacteria 914
347 Ga0496109_1182980 3300048912 Unclassified 701
348 Ga0496110_0002711 3300048913 Bacteria 13381
349 Ga0496110_0089639 3300048913 Bacteria 2749
350 Ga0496110_0442927 3300048913 Bacteria 1184
351 Ga0496110_1829347 3300048913 Bacteria 517
352 Ga0496111_0000035 3300048914 Bacteria 54459
353 Ga0496111_0320516 3300048914 Bacteria 1148
354 Ga0496111_0428058 3300048914 Bacteria 977
355 Ga0496112_1064189 3300048915 Unclassified 728
356 Ga0496113_0000026 3300048916 Bacteria 63999
357 Ga0496113_0101237 3300048916 Bacteria 2233
358 Ga0496113_0452755 3300048916 Bacteria 1031
359 Ga0496113_1089310 3300048916 Bacteria 627
360 Ga0496114_0000039 3300048917 Bacteria 138486
361 Ga0496114_0092100 3300048917 Bacteria 2575
362 Ga0496114_0520470 3300048917 Unclassified 1052
363 Ga0496114_0862453 3300048917 Bacteria 786
364 Ga0496115_0000011 3300048918 Bacteria 222529
365 Ga0496115_0003457 3300048918 Bacteria 11348
366 Ga0496115_0014195 3300048918 Bacteria 6026
367 Ga0496116_0000331 3300048919 Bacteria 76536
368 Ga0496117_0036733 3300048920 Bacteria 3661
369 Ga0496117_0348858 3300048920 Bacteria 765
370 Ga0496118_0003934 3300048921 Bacteria 18170
371 Ga0496118_0217295 3300048921 Bacteria 1116
372 Ga0496118_0221043 3300048921 Bacteria 1102
373 Ga0496119_0002281 3300048922 Bacteria 21246
374 Ga0496119_0005810 3300048922 Bacteria 11668
375 Ga0496119_0008997 3300048922 Bacteria 8667
376 Ga0496119_0060355 3300048922 Bacteria 2271
377 Ga0496120_0001336 3300048923 Bacteria 30395
378 Ga0496120_0133608 3300048923 Bacteria 1268
379 Ga0496120_0401930 3300048923 Bacteria 605
380 Ga0496121_0036049 3300048924 Bacteria 4416
381 Ga0496121_0052194 3300048924 Bacteria 3436
382 Ga0496121_0142675 3300048924 Bacteria 1774
383 Ga0496121_0247902 3300048924 Bacteria 1237
384 Ga0496121_0758154 3300048924 Unclassified 576
385 Ga0496124_0235077 3300048927 Unclassified 1367
386 Ga0496124_0988472 3300048927 Unclassified 502
387 Ga0496125_0056943 3300048928 Bacteria 3170
388 Ga0496125_0071876 3300048928 Bacteria 2700
389 Ga0496126_0248123 3300048929 Bacteria 1484
390 Ga0496126_0529883 3300048929 Bacteria 937
391 Ga0496126_0548679 3300048929 Bacteria 917
392 Ga0496126_0702768 3300048929 Bacteria 785
393 Ga0496126_0728322 3300048929 Bacteria 768
394 Ga0496126_0835098 3300048929 Bacteria 704
395 Ga0501031_0000188 3300049568 Bacteria 34790
396 Ga0501031_0376171 3300049568 Bacteria 919
397 Ga0501032_0001031 3300049569 Bacteria 22377
398 Ga0501032_0256976 3300049569 Unclassified 1133
399 Ga0501032_0457125 3300049569 Bacteria 818
400 Ga0501033_0000554 3300049570 Bacteria 34825
401 Ga0501034_0002861 3300049571 Bacteria 20083
402 Ga0501034_1694566 3300049571 Bacteria 504
403 Ga0501036_0000336 3300049572 Bacteria 32902
404 Ga0501036_1630796 3300049572 Bacteria 520
405 Ga0501037_0000425 3300049573 Bacteria 34779
406 Ga0501038_0001384 3300049574 Bacteria 22160
407 Ga0501039_0016759 3300049575 Bacteria 5615
408 Ga0501040_0013286 3300049576 Bacteria 5415
409 Ga0501042_0023712 3300049578 Bacteria 4297
410 Ga0501042_0058343 3300049578 Bacteria 2755
411 Ga0501043_0000516 3300049579 Bacteria 34780
412 Ga0501046_0000439 3300049580 Bacteria 41871
413 Ga0501046_0485676 3300049580 Bacteria 886
414 Ga0501047_0000706 3300049581 Bacteria 34791
415 Ga0501047_0121419 3300049581 Bacteria 2494
416 Ga0501047_0177613 3300049581 Bacteria 1996
417 Ga0501047_0196535 3300049581 Bacteria 1879
418 Ga0501047_1376910 3300049581 Bacteria 520
419 Ga0501048_0000269 3300049582 Bacteria 34831
420 Ga0501067_0070728 3300049583 Bacteria 1932
421 Ga0501068_0009015 3300049584 Bacteria 5568
422 Ga0501069_0009766 3300049585 Bacteria 5071
423 Ga0501069_0010469 3300049585 Bacteria 4909
424 Ga0501070_0000649 3300049586 Bacteria 31969
425 Ga0501070_0005184 3300049586 Bacteria 11101
426 Ga0501070_0025917 3300049586 Bacteria 4919
427 Ga0501070_0073221 3300049586 Bacteria 2834
428 Ga0501070_0272674 3300049586 Bacteria 1381
429 Ga0501071_0140445 3300049587 Unclassified 1798
430 Ga0501071_0212161 3300049587 Bacteria 1456
431 Ga0501072_0002921 3300049588 Bacteria 12861
432 Ga0501073_0001545 3300049589 Bacteria 17056
433 Ga0501074_0020000 3300049590 Bacteria 4865
434 Ga0501074_0029244 3300049590 Bacteria 3991
435 Ga0501074_0086676 3300049590 Bacteria 2243
436 Ga0501076_0038909 3300049592 Bacteria 3733
437 Ga0501076_0640433 3300049592 Bacteria 877
438 Ga0501077_0903394 3300049593 Bacteria 568
439 Ga0501079_0012584 3300049741 Bacteria 6462
440 Ga0501079_0123609 3300049741 Bacteria 2013
441 Ga0501079_0225971 3300049741 Bacteria 1462
442 Ga0501080_0004448 3300049742 Bacteria 12472
443 Ga0501080_0025778 3300049742 Bacteria 5461
444 Ga0501081_0382196 3300049743 Bacteria 1041
445 Ga0501083_0000794 3300049744 Bacteria 20751
446 Ga0501083_0019501 3300049744 Bacteria 4724
447 Ga0501083_0025968 3300049744 Bacteria 4052
448 Ga0501083_0510457 3300049744 Bacteria 782
449 Ga0501035_0000754 3300049822 Bacteria 34845
450 Ga0501035_1150344 3300049822 Bacteria 604
451 Ga0501044_0000947 3300049823 Bacteria 34821
452 Ga0501044_0014304 3300049823 Bacteria 8566
453 Ga0501044_0126652 3300049823 Bacteria 2551
454 Ga0501044_0822281 3300049823 Unclassified 807
455 Ga0501045_0028359 3300049824 Bacteria 4038
456 Ga0501045_0556455 3300049824 Bacteria 851
457 Ga0501045_0667490 3300049824 Bacteria 768
458 nmdc:mga0qj67_68306_c1 3300050509 Bacteria 2832
459 nmdc:mga0a205_19_c2 3300050515 Bacteria 74147
460 Ga0495601_0001218 3300053077 Bacteria 14090
461 Ga0495601_0058448 3300053077 Bacteria 2444
462 Ga0495601_0116715 3300053077 Bacteria 1731
463 Ga0495601_0140554 3300053077 Bacteria 1575
464 Ga0495601_0151757 3300053077 Unclassified 1512
465 Ga0495601_0229846 3300053077 Bacteria 1211
466 Ga0495601_0248761 3300053077 Bacteria 1161
467 Ga0495612_0001807 3300053078 Bacteria 8762
468 Ga0495612_0003434 3300053078 Bacteria 6569
469 Ga0495612_0525849 3300053078 Bacteria 544
470 Ga0495655_0000002 3300053083 Bacteria 312752
471 Ga0495655_0019360 3300053083 Bacteria 1510
472 Ga0495655_0108754 3300053083 Bacteria 830
473 Ga0495595_0000002 3300053084 Bacteria 445641
474 Ga0495595_0167431 3300053084 Bacteria 1086
475 Ga0495619_0000102 3300053085 Bacteria 64345
476 Ga0495619_0000268 3300053085 Bacteria 37980
477 Ga0495619_0005581 3300053085 Bacteria 7983
478 Ga0495619_0011332 3300053085 Bacteria 5612
479 Ga0495619_0094497 3300053085 Bacteria 2028
480 Ga0495619_0409924 3300053085 Bacteria 935
481 Ga0500566_0000683 3300053094 Bacteria 19070
482 Ga0500641_0000831 3300053096 Bacteria 11108
483 Ga0500572_255035 3300053111 Bacteria 570
484 Ga0500628_000001 3300053129 Bacteria 564074
485 Ga0501084_0212730 3300054114 Bacteria 1631
486 Ga0501082_0002303 3300060353 Bacteria 16703
487 Ga0530510_1103456 3300061734 Bacteria 608

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_12072945 Ga0105242_120729451 91
2 3300046536 Ga0495587_0000618 Ga0495587_0000618_1075_1368 97
3 3300005367 Ga0070667_100683926 Ga0070667_1006839262 98
4 3300009553 Ga0105249_10311451 Ga0105249_103114512 98
5 3300028381 Ga0268264_10464896 Ga0268264_104648962 98
6 3300048929 Ga0496126_0728322 Ga0496126_0728322_382_702 98
7 3300046477 Ga0495664_0681916 Ga0495664_0681916_140_469 99
8 3300047322 Ga0495680_0002541 Ga0495680_0002541_6592_6894 99
9 3300048916 Ga0496113_1089310 Ga0496113_1089310_267_602 99
10 3300005543 Ga0070672_101216475 Ga0070672_1012164752 100
11 3300010375 Ga0105239_12347614 Ga0105239_123476142 100
12 3300014326 Ga0157380_10244106 Ga0157380_102441063 100
13 3300025934 Ga0207686_11230270 Ga0207686_112302701 100
14 3300041505 Ga0451849_0058156 Ga0451849_0058156_382_684 100
15 3300046674 Ga0495588_0000338 Ga0495588_0000338_24590_24898 100
16 3300048904 Ga0496101_0829407 Ga0496101_0829407_372_686 100
17 3300048905 Ga0496102_0061178 Ga0496102_0061178_3013_3327 100
18 3300048906 Ga0496103_0209260 Ga0496103_0209260_620_934 100
19 3300048907 Ga0496104_0033800 Ga0496104_0033800_2159_2473 100
20 3300048908 Ga0496105_0007927 Ga0496105_0007927_6577_6891 100
21 3300048908 Ga0496105_0909849 Ga0496105_0909849_207_521 100
22 3300048909 Ga0496106_0738163 Ga0496106_0738163_16_330 100
23 3300048910 Ga0496107_0022168 Ga0496107_0022168_3201_3515 100
24 3300048912 Ga0496109_0586198 Ga0496109_0586198_566_880 100
25 3300048913 Ga0496110_0089639 Ga0496110_0089639_687_995 100
26 3300048914 Ga0496111_0428058 Ga0496111_0428058_495_803 100
27 3300048917 Ga0496114_0092100 Ga0496114_0092100_1872_2195 100
28 3300048917 Ga0496114_0862453 Ga0496114_0862453_211_519 100
29 3300048919 Ga0496116_0000331 Ga0496116_0000331_64053_64394 100
30 3300048920 Ga0496117_0036733 Ga0496117_0036733_314_628 100
31 3300048921 Ga0496118_0003934 Ga0496118_0003934_17604_17918 100
32 3300048921 Ga0496118_0217295 Ga0496118_0217295_108_422 100
33 3300048922 Ga0496119_0002281 Ga0496119_0002281_8750_9091 100
34 3300048922 Ga0496119_0005810 Ga0496119_0005810_7032_7346 100
35 3300048922 Ga0496119_0008997 Ga0496119_0008997_1363_1677 100
36 3300048923 Ga0496120_0001336 Ga0496120_0001336_16373_16687 100
37 3300048923 Ga0496120_0401930 Ga0496120_0401930_60_374 100
38 3300048924 Ga0496121_0036049 Ga0496121_0036049_196_510 100
39 3300048924 Ga0496121_0052194 Ga0496121_0052194_184_498 100
40 3300048924 Ga0496121_0142675 Ga0496121_0142675_329_643 100
41 3300048927 Ga0496124_0235077 Ga0496124_0235077_998_1324 100
42 3300048928 Ga0496125_0056943 Ga0496125_0056943_2027_2341 100
43 3300048928 Ga0496125_0071876 Ga0496125_0071876_1396_1710 100
44 3300048929 Ga0496126_0529883 Ga0496126_0529883_164_487 100
45 3300048929 Ga0496126_0548679 Ga0496126_0548679_451_774 100
46 3300048929 Ga0496126_0702768 Ga0496126_0702768_121_444 100
47 3300048929 Ga0496126_0835098 Ga0496126_0835098_202_516 100
48 3300049571 Ga0501034_1694566 Ga0501034_1694566_26_340 100
49 3300049744 Ga0501083_0019501 Ga0501083_0019501_1906_2220 100
50 3300053083 Ga0495655_0108754 Ga0495655_0108754_496_810 100
51 3300053111 Ga0500572_255035 Ga0500572_255035_18_332 100
52 3300035172 Ga0373955_0437768 Ga0373955_0437768_375_710 102
53 3300036401 Ga0373937_0734533 Ga0373937_0734533_115_450 102
54 3300046663 Ga0495635_0386765 Ga0495635_0386765_523_858 102
55 3300047673 Ga0495593_0111770 Ga0495593_0111770_946_1275 102
56 3300053085 Ga0495619_0005581 Ga0495619_0005581_863_1198 102
57 3300013308 Ga0157375_12133748 Ga0157375_121337482 104
58 3300044694 Ga0466963_0523116 Ga0466963_0523116_15_353 104
59 3300046511 Ga0495608_0549812 Ga0495608_0549812_15_344 104
60 3300005937 Ga0081455_10038488 Ga0081455_100384885 107
61 3300046462 Ga0495651_0076881 Ga0495651_0076881_977_1303 108
62 3300046463 Ga0495653_0270457 Ga0495653_0270457_465_791 108
63 3300046536 Ga0495587_0656834 Ga0495587_0656834_224_550 108
64 3300048907 Ga0496104_0000015 Ga0496104_0000015_198102_198428 108
65 3300048908 Ga0496105_0000004 Ga0496105_0000004_277371_277697 108
66 3300048922 Ga0496119_0060355 Ga0496119_0060355_665_991 108
67 3300048923 Ga0496120_0133608 Ga0496120_0133608_263_589 108
68 3300005329 Ga0070683_100000835 Ga0070683_1000008352 109
69 3300005329 Ga0070683_100003886 Ga0070683_10000388613 109
70 3300005330 Ga0070690_100438449 Ga0070690_1004384492 109
71 3300005335 Ga0070666_10040741 Ga0070666_100407413 109
72 3300005335 Ga0070666_10067311 Ga0070666_100673112 109
73 3300005337 Ga0070682_100000011 Ga0070682_10000001127 109
74 3300005338 Ga0068868_100004956 Ga0068868_1000049567 109
75 3300005340 Ga0070689_100128119 Ga0070689_1001281193 109
76 3300005341 Ga0070691_10000138 Ga0070691_1000013813 109
77 3300005341 Ga0070691_10756793 Ga0070691_107567932 109
78 3300005344 Ga0070661_100000058 Ga0070661_10000005834 109
79 3300005344 Ga0070661_100758942 Ga0070661_1007589422 109
80 3300005345 Ga0070692_10036350 Ga0070692_100363503 109
81 3300005345 Ga0070692_10689195 Ga0070692_106891952 109
82 3300005347 Ga0070668_100089709 Ga0070668_1000897092 109
83 3300005347 Ga0070668_100120668 Ga0070668_1001206683 109
84 3300005347 Ga0070668_102019466 Ga0070668_1020194661 109
85 3300005354 Ga0070675_100000036 Ga0070675_10000003647 109
86 3300005355 Ga0070671_100343162 Ga0070671_1003431621 109
87 3300005364 Ga0070673_100472745 Ga0070673_1004727452 109
88 3300005365 Ga0070688_100000171 Ga0070688_1000001718 109
89 3300005365 Ga0070688_100000360 Ga0070688_10000036016 109
90 3300005367 Ga0070667_100001076 Ga0070667_10000107622 109
91 3300005367 Ga0070667_100006751 Ga0070667_10000675112 109
92 3300005367 Ga0070667_100045073 Ga0070667_1000450736 109
93 3300005367 Ga0070667_100102665 Ga0070667_1001026653 109
94 3300005434 Ga0070709_11345480 Ga0070709_113454802 109
95 3300005435 Ga0070714_100094095 Ga0070714_1000940953 109
96 3300005435 Ga0070714_100566936 Ga0070714_1005669362 109
97 3300005435 Ga0070714_102312655 Ga0070714_1023126551 109
98 3300005436 Ga0070713_100000047 Ga0070713_10000004754 109
99 3300005436 Ga0070713_100039662 Ga0070713_1000396621 109
100 3300005439 Ga0070711_100091636 Ga0070711_1000916362 109
101 3300005441 Ga0070700_100074280 Ga0070700_1000742803 109
102 3300005444 Ga0070694_100343819 Ga0070694_1003438193 109
103 3300005444 Ga0070694_101172337 Ga0070694_1011723371 109
104 3300005455 Ga0070663_100003998 Ga0070663_1000039981 109
105 3300005455 Ga0070663_100772304 Ga0070663_1007723042 109
106 3300005458 Ga0070681_10621632 Ga0070681_106216322 109
107 3300005466 Ga0070685_10000019 Ga0070685_1000001973 109
108 3300005466 Ga0070685_10000020 Ga0070685_1000002021 109
109 3300005466 Ga0070685_10209781 Ga0070685_102097811 109
110 3300005466 Ga0070685_10637005 Ga0070685_106370051 109
111 3300005530 Ga0070679_100012803 Ga0070679_1000128038 109
112 3300005535 Ga0070684_100610062 Ga0070684_1006100621 109
113 3300005543 Ga0070672_100000001 Ga0070672_100000001125 109
114 3300005545 Ga0070695_100322300 Ga0070695_1003223002 109
115 3300005547 Ga0070693_100926138 Ga0070693_1009261382 109
116 3300005548 Ga0070665_100001462 Ga0070665_10000146232 109
117 3300005548 Ga0070665_100051392 Ga0070665_1000513922 109
118 3300005548 Ga0070665_100183823 Ga0070665_1001838233 109
119 3300005548 Ga0070665_100235741 Ga0070665_1002357413 109
120 3300005548 Ga0070665_101889954 Ga0070665_1018899542 109
121 3300005549 Ga0070704_100231028 Ga0070704_1002310282 109
122 3300005563 Ga0068855_100337954 Ga0068855_1003379542 109
123 3300005564 Ga0070664_100116556 Ga0070664_1001165564 109
124 3300005578 Ga0068854_100003343 Ga0068854_1000033433 109
125 3300005578 Ga0068854_101110222 Ga0068854_1011102222 109
126 3300005614 Ga0068856_100003300 Ga0068856_10000330013 109
127 3300005615 Ga0070702_100020360 Ga0070702_1000203603 109
128 3300005616 Ga0068852_100000002 Ga0068852_100000002192 109
129 3300005616 Ga0068852_100044940 Ga0068852_1000449403 109
130 3300005718 Ga0068866_10065962 Ga0068866_100659622 109
131 3300005719 Ga0068861_102063091 Ga0068861_1020630912 109
132 3300005834 Ga0068851_10000730 Ga0068851_100007303 109
133 3300005834 Ga0068851_10000911 Ga0068851_100009117 109
134 3300005841 Ga0068863_100029512 Ga0068863_1000295126 109
135 3300005841 Ga0068863_101512984 Ga0068863_1015129842 109
136 3300005843 Ga0068860_100143302 Ga0068860_1001433022 109
137 3300005844 Ga0068862_100000943 Ga0068862_10000094328 109
138 3300005844 Ga0068862_100510751 Ga0068862_1005107511 109
139 3300005937 Ga0081455_10029831 Ga0081455_100298313 109
140 3300005937 Ga0081455_10046721 Ga0081455_100467214 109
141 3300005937 Ga0081455_10931649 Ga0081455_109316492 109
142 3300005983 Ga0081540_1000100 Ga0081540_100010028 109
143 3300005985 Ga0081539_10002227 Ga0081539_1000222712 109
144 3300006175 Ga0070712_100007821 Ga0070712_1000078214 109
145 3300006237 Ga0097621_102405544 Ga0097621_1024055441 109
146 3300006358 Ga0068871_100301341 Ga0068871_1003013413 109
147 3300006846 Ga0075430_100125903 Ga0075430_1001259033 109
148 3300006852 Ga0075433_10000421 Ga0075433_100004216 109
149 3300006881 Ga0068865_100000013 Ga0068865_10000001338 109
150 3300009093 Ga0105240_11019158 Ga0105240_110191582 109
151 3300009098 Ga0105245_10000125 Ga0105245_1000012522 109
152 3300009098 Ga0105245_10052008 Ga0105245_100520083 109
153 3300009101 Ga0105247_10001978 Ga0105247_100019788 109
154 3300009101 Ga0105247_10134859 Ga0105247_101348592 109
155 3300009148 Ga0105243_10024723 Ga0105243_100247234 109
156 3300009174 Ga0105241_10065255 Ga0105241_100652552 109
157 3300009176 Ga0105242_10000117 Ga0105242_1000011727 109
158 3300009176 Ga0105242_10000931 Ga0105242_100009316 109
159 3300009177 Ga0105248_10000020 Ga0105248_10000020147 109
160 3300009545 Ga0105237_11807037 Ga0105237_118070371 109
161 3300009553 Ga0105249_10003509 Ga0105249_1000350913 109
162 3300010375 Ga0105239_10515909 Ga0105239_105159092 109
163 3300010375 Ga0105239_10819182 Ga0105239_108191823 109
164 3300011119 Ga0105246_12261120 Ga0105246_122611202 109
165 3300013100 Ga0157373_11248404 Ga0157373_112484042 109
166 3300013102 Ga0157371_10043297 Ga0157371_100432973 109
167 3300013104 Ga0157370_10002971 Ga0157370_1000297112 109
168 3300013104 Ga0157370_10580794 Ga0157370_105807943 109
169 3300013105 Ga0157369_10000307 Ga0157369_1000030739 109
170 3300013105 Ga0157369_10796624 Ga0157369_107966242 109
171 3300013105 Ga0157369_12215560 Ga0157369_122155601 109
172 3300013296 Ga0157374_10671340 Ga0157374_106713402 109
173 3300013296 Ga0157374_12755937 Ga0157374_127559372 109
174 3300013297 Ga0157378_10003176 Ga0157378_100031769 109
175 3300013297 Ga0157378_10031397 Ga0157378_100313976 109
176 3300013297 Ga0157378_10118701 Ga0157378_101187012 109
177 3300013306 Ga0163162_13467411 Ga0163162_134674111 109
178 3300013307 Ga0157372_10000053 Ga0157372_1000005388 109
179 3300013307 Ga0157372_10658337 Ga0157372_106583372 109
180 3300013308 Ga0157375_10001535 Ga0157375_100015353 109
181 3300013308 Ga0157375_10324303 Ga0157375_103243033 109
182 3300014325 Ga0163163_13212907 Ga0163163_132129071 109
183 3300014325 Ga0163163_13236525 Ga0163163_132365252 109
184 3300014326 Ga0157380_10000016 Ga0157380_1000001676 109
185 3300014326 Ga0157380_10444701 Ga0157380_104447012 109
186 3300014745 Ga0157377_11032762 Ga0157377_110327621 109
187 3300014968 Ga0157379_10011155 Ga0157379_1001115511 109
188 3300014968 Ga0157379_11384530 Ga0157379_113845302 109
189 3300014969 Ga0157376_10022880 Ga0157376_100228803 109
190 3300014969 Ga0157376_10056914 Ga0157376_100569142 109
191 3300020070 Ga0206356_11093252 Ga0206356_110932522 109
192 3300022467 Ga0224712_10555524 Ga0224712_105555241 109
193 3300025321 Ga0207656_10000211 Ga0207656_1000021116 109
194 3300025321 Ga0207656_10004794 Ga0207656_100047942 109
195 3300025899 Ga0207642_10046848 Ga0207642_100468482 109
196 3300025900 Ga0207710_10000821 Ga0207710_1000082115 109
197 3300025900 Ga0207710_10080177 Ga0207710_100801772 109
198 3300025903 Ga0207680_10036448 Ga0207680_100364483 109
199 3300025903 Ga0207680_10080560 Ga0207680_100805602 109
200 3300025906 Ga0207699_10547634 Ga0207699_105476341 109
201 3300025911 Ga0207654_10047296 Ga0207654_100472964 109
202 3300025912 Ga0207707_10095334 Ga0207707_100953342 109
203 3300025913 Ga0207695_10705369 Ga0207695_107053692 109
204 3300025914 Ga0207671_10394191 Ga0207671_103941912 109
205 3300025914 Ga0207671_10588962 Ga0207671_105889622 109
206 3300025915 Ga0207693_10049045 Ga0207693_100490454 109
207 3300025916 Ga0207663_10062835 Ga0207663_100628353 109
208 3300025920 Ga0207649_10000283 Ga0207649_1000028316 109
209 3300025920 Ga0207649_10690246 Ga0207649_106902462 109
210 3300025921 Ga0207652_10008840 Ga0207652_100088408 109
211 3300025924 Ga0207694_10860681 Ga0207694_108606811 109
212 3300025926 Ga0207659_10000013 Ga0207659_10000013113 109
213 3300025927 Ga0207687_10000017 Ga0207687_10000017202 109
214 3300025927 Ga0207687_10030407 Ga0207687_100304074 109
215 3300025928 Ga0207700_10000033 Ga0207700_1000003353 109
216 3300025929 Ga0207664_10102186 Ga0207664_101021862 109
217 3300025929 Ga0207664_10859952 Ga0207664_108599522 109
218 3300025929 Ga0207664_11498908 Ga0207664_114989082 109
219 3300025931 Ga0207644_10923133 Ga0207644_109231332 109
220 3300025934 Ga0207686_10000254 Ga0207686_1000025436 109
221 3300025934 Ga0207686_10002477 Ga0207686_100024776 109
222 3300025935 Ga0207709_10006143 Ga0207709_100061437 109
223 3300025936 Ga0207670_10098140 Ga0207670_100981402 109
224 3300025937 Ga0207669_10334328 Ga0207669_103343282 109
225 3300025938 Ga0207704_10000040 Ga0207704_1000004034 109
226 3300025938 Ga0207704_10384276 Ga0207704_103842762 109
227 3300025940 Ga0207691_10000017 Ga0207691_1000001752 109
228 3300025941 Ga0207711_10000006 Ga0207711_10000006229 109
229 3300025944 Ga0207661_10000198 Ga0207661_1000019826 109
230 3300025944 Ga0207661_10002675 Ga0207661_100026756 109
231 3300025945 Ga0207679_10093327 Ga0207679_100933274 109
232 3300025949 Ga0207667_10104473 Ga0207667_101044734 109
233 3300025949 Ga0207667_10781886 Ga0207667_107818862 109
234 3300025960 Ga0207651_10607967 Ga0207651_106079672 109
235 3300025961 Ga0207712_10011490 Ga0207712_100114909 109
236 3300025972 Ga0207668_10031903 Ga0207668_100319032 109
237 3300025972 Ga0207668_10099769 Ga0207668_100997693 109
238 3300025981 Ga0207640_10000370 Ga0207640_1000037021 109
239 3300025986 Ga0207658_10003877 Ga0207658_100038777 109
240 3300025986 Ga0207658_10087929 Ga0207658_100879293 109
241 3300025986 Ga0207658_10104027 Ga0207658_101040273 109
242 3300025986 Ga0207658_10182475 Ga0207658_101824753 109
243 3300026023 Ga0207677_10002708 Ga0207677_100027087 109
244 3300026041 Ga0207639_10118502 Ga0207639_101185022 109
245 3300026067 Ga0207678_10047722 Ga0207678_100477223 109
246 3300026075 Ga0207708_10201180 Ga0207708_102011803 109
247 3300026078 Ga0207702_10002446 Ga0207702_1000244619 109
248 3300026078 Ga0207702_10706766 Ga0207702_107067662 109
249 3300026078 Ga0207702_11390603 Ga0207702_113906031 109
250 3300026088 Ga0207641_10043814 Ga0207641_100438142 109
251 3300026088 Ga0207641_10351086 Ga0207641_103510863 109
252 3300026088 Ga0207641_10425831 Ga0207641_104258313 109
253 3300026088 Ga0207641_11447646 Ga0207641_114476462 109
254 3300026116 Ga0207674_11121611 Ga0207674_111216112 109
255 3300026142 Ga0207698_10000004 Ga0207698_1000000493 109
256 3300026142 Ga0207698_10038394 Ga0207698_100383943 109
257 3300028379 Ga0268266_10000601 Ga0268266_1000060123 109
258 3300028379 Ga0268266_10001254 Ga0268266_100012546 109
259 3300028379 Ga0268266_10026262 Ga0268266_100262626 109
260 3300028379 Ga0268266_10161379 Ga0268266_101613793 109
261 3300028379 Ga0268266_10314156 Ga0268266_103141562 109
262 3300028379 Ga0268266_10737825 Ga0268266_107378252 109
263 3300028379 Ga0268266_11109158 Ga0268266_111091582 109
264 3300028379 Ga0268266_11461450 Ga0268266_114614502 109
265 3300028380 Ga0268265_10004453 Ga0268265_1000445312 109
266 3300028380 Ga0268265_11319361 Ga0268265_113193611 109
267 3300028381 Ga0268264_10511974 Ga0268264_105119742 109
268 3300028563 Ga0265319_1000014 Ga0265319_1000014190 109
269 3300028573 Ga0265334_10047765 Ga0265334_100477651 109
270 3300028800 Ga0265338_10000244 Ga0265338_1000024466 109
271 3300029957 Ga0265324_10045813 Ga0265324_100458133 109
272 3300031595 Ga0265313_10239623 Ga0265313_102396232 109
273 3300032002 Ga0307416_101430708 Ga0307416_1014307082 109
274 3300032126 Ga0307415_100240361 Ga0307415_1002403613 109
275 3300032133 Ga0316583_10046322 Ga0316583_100463223 109
276 3300036647 Ga0316582_0605817 Ga0316582_0605817_314_643 109
277 3300041459 Ga0451800_0374107 Ga0451800_0374107_123_452 109
278 3300041460 Ga0451802_1290304 Ga0451802_1290304_117_458 109
279 3300041486 Ga0451807_1434009 Ga0451807_1434009_95_424 109
280 3300041486 Ga0451807_1892530 Ga0451807_1892530_159_491 109
281 3300041492 Ga0451835_0389310 Ga0451835_0389310_126_455 109
282 3300041505 Ga0451849_1214696 Ga0451849_1214696_449_778 109
283 3300041512 Ga0451853_1746024 Ga0451853_1746024_386_715 109
284 3300045976 Ga0466967_0000001 Ga0466967_0000001_140047_140379 109
285 3300045976 Ga0466967_0175529 Ga0466967_0175529_998_1333 109
286 3300045976 Ga0466967_1714654 Ga0466967_1714654_139_492 109
287 3300046454 Ga0495592_0371965 Ga0495592_0371965_35_364 109
288 3300046454 Ga0495592_0425435 Ga0495592_0425435_362_697 109
289 3300046459 Ga0495629_0000260 Ga0495629_0000260_40178_40507 109
290 3300046459 Ga0495629_0000487 Ga0495629_0000487_16861_17196 109
291 3300046459 Ga0495629_0010874 Ga0495629_0010874_3335_3664 109
292 3300046460 Ga0495638_0029338 Ga0495638_0029338_2515_2844 109
293 3300046461 Ga0495641_0023225 Ga0495641_0023225_1403_1735 109
294 3300046461 Ga0495641_0088313 Ga0495641_0088313_545_880 109
295 3300046462 Ga0495651_0100543 Ga0495651_0100543_1533_1868 109
296 3300046462 Ga0495651_0185936 Ga0495651_0185936_407_736 109
297 3300046476 Ga0495662_0013837 Ga0495662_0013837_2675_3010 109
298 3300046477 Ga0495664_0184458 Ga0495664_0184458_731_1060 109
299 3300046499 Ga0495594_0000089 Ga0495594_0000089_10591_10920 109
300 3300046507 Ga0495606_0000040 Ga0495606_0000040_110826_111161 109
301 3300046511 Ga0495608_0000007 Ga0495608_0000007_146930_147259 109
302 3300046514 Ga0495618_0150995 Ga0495618_0150995_403_732 109
303 3300046514 Ga0495618_0161212 Ga0495618_0161212_1019_1348 109
304 3300046516 Ga0495628_0000859 Ga0495628_0000859_11934_12269 109
305 3300046516 Ga0495628_0123737 Ga0495628_0123737_979_1308 109
306 3300046517 Ga0495630_0000014 Ga0495630_0000014_120662_120997 109
307 3300046517 Ga0495630_0000256 Ga0495630_0000256_3591_3923 109
308 3300046517 Ga0495630_0054889 Ga0495630_0054889_1450_1782 109
309 3300046517 Ga0495630_0333418 Ga0495630_0333418_532_861 109
310 3300046529 Ga0495652_0000010 Ga0495652_0000010_249023_249358 109
311 3300046529 Ga0495652_0003765 Ga0495652_0003765_2362_2691 109
312 3300046533 Ga0495640_0363851 Ga0495640_0363851_395_724 109
313 3300046536 Ga0495587_0128483 Ga0495587_0128483_151_486 109
314 3300046536 Ga0495587_0181367 Ga0495587_0181367_600_935 109
315 3300046536 Ga0495587_0511353 Ga0495587_0511353_46_375 109
316 3300046543 Ga0495645_0223416 Ga0495645_0223416_153_482 109
317 3300046543 Ga0495645_0252907 Ga0495645_0252907_606_935 109
318 3300046557 Ga0495622_0000218 Ga0495622_0000218_26028_26357 109
319 3300046559 Ga0495667_0000020 Ga0495667_0000020_41914_42246 109
320 3300046559 Ga0495667_0282586 Ga0495667_0282586_429_758 109
321 3300046642 Ga0495634_0002567 Ga0495634_0002567_3080_3409 109
322 3300046642 Ga0495634_0061993 Ga0495634_0061993_1753_2085 109
323 3300046660 Ga0495625_0000688 Ga0495625_0000688_12256_12585 109
324 3300046675 Ga0495657_0000001 Ga0495657_0000001_279076_279405 109
325 3300046675 Ga0495657_0176745 Ga0495657_0176745_416_748 109
326 3300046681 Ga0495647_0200061 Ga0495647_0200061_415_744 109
327 3300046683 Ga0495658_0003808 Ga0495658_0003808_1259_1594 109
328 3300046683 Ga0495658_0117560 Ga0495658_0117560_282_614 109
329 3300046689 Ga0495613_0000041 Ga0495613_0000041_25854_26186 109
330 3300046690 Ga0495624_0000671 Ga0495624_0000671_2284_2619 109
331 3300047317 Ga0495604_0000239 Ga0495604_0000239_31674_32006 109
332 3300047317 Ga0495604_0105915 Ga0495604_0105915_1181_1513 109
333 3300047319 Ga0495674_0002248 Ga0495674_0002248_11817_12149 109
334 3300047320 Ga0495672_0214273 Ga0495672_0214273_439_768 109
335 3300047320 Ga0495672_0214623 Ga0495672_0214623_30_359 109
336 3300047321 Ga0495676_0001364 Ga0495676_0001364_2906_3235 109
337 3300047321 Ga0495676_0137244 Ga0495676_0137244_802_1131 109
338 3300047321 Ga0495676_0852702 Ga0495676_0852702_28_357 109
339 3300047322 Ga0495680_0126650 Ga0495680_0126650_1437_1766 109
340 3300047444 Ga0495675_0000300 Ga0495675_0000300_11984_12313 109
341 3300047444 Ga0495675_0298925 Ga0495675_0298925_501_830 109
342 3300047471 Ga0495684_0185521 Ga0495684_0185521_952_1284 109
343 3300047471 Ga0495684_0301749 Ga0495684_0301749_724_1056 109
344 3300047471 Ga0495684_0323656 Ga0495684_0323656_203_532 109
345 3300047471 Ga0495684_0540874 Ga0495684_0540874_30_365 109
346 3300047472 Ga0495686_0090480 Ga0495686_0090480_1111_1440 109
347 3300047673 Ga0495593_0072470 Ga0495593_0072470_86_418 109
348 3300048088 Ga0495602_0000007 Ga0495602_0000007_123477_123809 109
349 3300048088 Ga0495602_0000611 Ga0495602_0000611_11924_12259 109
350 3300048088 Ga0495602_0267802 Ga0495602_0267802_278_607 109
351 3300048088 Ga0495602_0761977 Ga0495602_0761977_210_542 109
352 3300048088 Ga0495602_1149475 Ga0495602_1149475_33_362 109
353 3300048903 Ga0496100_0000001 Ga0496100_0000001_353809_354138 109
354 3300048904 Ga0496101_0000004 Ga0496101_0000004_155161_155490 109
355 3300048905 Ga0496102_0000294 Ga0496102_0000294_5639_5968 109
356 3300048905 Ga0496102_0370462 Ga0496102_0370462_1000_1329 109
357 3300048905 Ga0496102_0677577 Ga0496102_0677577_332_670 109
358 3300048906 Ga0496103_0000159 Ga0496103_0000159_58221_58550 109
359 3300048906 Ga0496103_0982565 Ga0496103_0982565_125_466 109
360 3300048907 Ga0496104_0000765 Ga0496104_0000765_4503_4832 109
361 3300048907 Ga0496104_0039152 Ga0496104_0039152_1461_1790 109
362 3300048907 Ga0496104_0491021 Ga0496104_0491021_197_526 109
363 3300048908 Ga0496105_0063371 Ga0496105_0063371_2085_2414 109
364 3300048908 Ga0496105_0618973 Ga0496105_0618973_13_342 109
365 3300048909 Ga0496106_0000056 Ga0496106_0000056_76134_76463 109
366 3300048910 Ga0496107_0000005 Ga0496107_0000005_176110_176439 109
367 3300048911 Ga0496108_0000063 Ga0496108_0000063_64526_64858 109
368 3300048911 Ga0496108_0004943 Ga0496108_0004943_552_887 109
369 3300048912 Ga0496109_0000012 Ga0496109_0000012_47889_48221 109
370 3300048912 Ga0496109_0000173 Ga0496109_0000173_6898_7233 109
371 3300048912 Ga0496109_0749907 Ga0496109_0749907_438_767 109
372 3300048912 Ga0496109_1182980 Ga0496109_1182980_251_580 109
373 3300048913 Ga0496110_0002711 Ga0496110_0002711_635_967 109
374 3300048913 Ga0496110_0442927 Ga0496110_0442927_696_1031 109
375 3300048913 Ga0496110_1829347 Ga0496110_1829347_96_431 109
376 3300048914 Ga0496111_0000035 Ga0496111_0000035_13090_13422 109
377 3300048914 Ga0496111_0320516 Ga0496111_0320516_289_618 109
378 3300048915 Ga0496112_1064189 Ga0496112_1064189_352_687 109
379 3300048916 Ga0496113_0000026 Ga0496113_0000026_40210_40545 109
380 3300048916 Ga0496113_0101237 Ga0496113_0101237_672_1004 109
381 3300048916 Ga0496113_0452755 Ga0496113_0452755_541_870 109
382 3300048917 Ga0496114_0000039 Ga0496114_0000039_5474_5803 109
383 3300048917 Ga0496114_0520470 Ga0496114_0520470_177_506 109
384 3300048918 Ga0496115_0000011 Ga0496115_0000011_128746_129075 109
385 3300048918 Ga0496115_0003457 Ga0496115_0003457_5574_5903 109
386 3300048918 Ga0496115_0014195 Ga0496115_0014195_1220_1552 109
387 3300048920 Ga0496117_0348858 Ga0496117_0348858_365_706 109
388 3300048921 Ga0496118_0221043 Ga0496118_0221043_335_664 109
389 3300048924 Ga0496121_0247902 Ga0496121_0247902_621_962 109
390 3300048924 Ga0496121_0758154 Ga0496121_0758154_41_394 109
391 3300048927 Ga0496124_0988472 Ga0496124_0988472_21_362 109
392 3300048929 Ga0496126_0248123 Ga0496126_0248123_319_660 109
393 3300049568 Ga0501031_0000188 Ga0501031_0000188_18135_18476 109
394 3300049568 Ga0501031_0376171 Ga0501031_0376171_196_537 109
395 3300049569 Ga0501032_0001031 Ga0501032_0001031_5695_6036 109
396 3300049569 Ga0501032_0256976 Ga0501032_0256976_525_866 109
397 3300049569 Ga0501032_0457125 Ga0501032_0457125_460_789 109
398 3300049570 Ga0501033_0000554 Ga0501033_0000554_16342_16683 109
399 3300049571 Ga0501034_0002861 Ga0501034_0002861_16342_16683 109
400 3300049572 Ga0501036_0000336 Ga0501036_0000336_16342_16683 109
401 3300049572 Ga0501036_1630796 Ga0501036_1630796_146_478 109
402 3300049573 Ga0501037_0000425 Ga0501037_0000425_18097_18438 109
403 3300049574 Ga0501038_0001384 Ga0501038_0001384_5478_5819 109
404 3300049575 Ga0501039_0016759 Ga0501039_0016759_3996_4337 109
405 3300049576 Ga0501040_0013286 Ga0501040_0013286_4027_4368 109
406 3300049578 Ga0501042_0023712 Ga0501042_0023712_1090_1431 109
407 3300049578 Ga0501042_0058343 Ga0501042_0058343_1112_1441 109
408 3300049579 Ga0501043_0000516 Ga0501043_0000516_16342_16683 109
409 3300049580 Ga0501046_0000439 Ga0501046_0000439_16342_16683 109
410 3300049580 Ga0501046_0485676 Ga0501046_0485676_471_803 109
411 3300049581 Ga0501047_0000706 Ga0501047_0000706_18109_18450 109
412 3300049581 Ga0501047_0121419 Ga0501047_0121419_1167_1508 109
413 3300049581 Ga0501047_0177613 Ga0501047_0177613_21_362 109
414 3300049581 Ga0501047_0196535 Ga0501047_0196535_379_720 109
415 3300049581 Ga0501047_1376910 Ga0501047_1376910_25_366 109
416 3300049582 Ga0501048_0000269 Ga0501048_0000269_18156_18497 109
417 3300049583 Ga0501067_0070728 Ga0501067_0070728_548_889 109
418 3300049584 Ga0501068_0009015 Ga0501068_0009015_4132_4473 109
419 3300049585 Ga0501069_0009766 Ga0501069_0009766_755_1096 109
420 3300049585 Ga0501069_0010469 Ga0501069_0010469_3562_3903 109
421 3300049586 Ga0501070_0000649 Ga0501070_0000649_16342_16683 109
422 3300049586 Ga0501070_0005184 Ga0501070_0005184_2820_3161 109
423 3300049586 Ga0501070_0025917 Ga0501070_0025917_3414_3746 109
424 3300049586 Ga0501070_0073221 Ga0501070_0073221_859_1200 109
425 3300049586 Ga0501070_0272674 Ga0501070_0272674_901_1242 109
426 3300049587 Ga0501071_0140445 Ga0501071_0140445_1166_1507 109
427 3300049587 Ga0501071_0212161 Ga0501071_0212161_422_763 109
428 3300049588 Ga0501072_0002921 Ga0501072_0002921_8905_9246 109
429 3300049589 Ga0501073_0001545 Ga0501073_0001545_11473_11814 109
430 3300049590 Ga0501074_0020000 Ga0501074_0020000_606_947 109
431 3300049590 Ga0501074_0029244 Ga0501074_0029244_1655_1996 109
432 3300049590 Ga0501074_0086676 Ga0501074_0086676_1228_1569 109
433 3300049592 Ga0501076_0038909 Ga0501076_0038909_512_844 109
434 3300049592 Ga0501076_0640433 Ga0501076_0640433_526_867 109
435 3300049593 Ga0501077_0903394 Ga0501077_0903394_35_367 109
436 3300049741 Ga0501079_0012584 Ga0501079_0012584_613_954 109
437 3300049741 Ga0501079_0123609 Ga0501079_0123609_1566_1898 109
438 3300049741 Ga0501079_0225971 Ga0501079_0225971_859_1200 109
439 3300049742 Ga0501080_0004448 Ga0501080_0004448_6830_7171 109
440 3300049742 Ga0501080_0025778 Ga0501080_0025778_1141_1482 109
441 3300049743 Ga0501081_0382196 Ga0501081_0382196_659_991 109
442 3300049744 Ga0501083_0000794 Ga0501083_0000794_16342_16683 109
443 3300049744 Ga0501083_0025968 Ga0501083_0025968_960_1301 109
444 3300049744 Ga0501083_0510457 Ga0501083_0510457_61_414 109
445 3300049822 Ga0501035_0000754 Ga0501035_0000754_18163_18504 109
446 3300049822 Ga0501035_1150344 Ga0501035_1150344_137_478 109
447 3300049823 Ga0501044_0000947 Ga0501044_0000947_18162_18503 109
448 3300049823 Ga0501044_0014304 Ga0501044_0014304_2982_3323 109
449 3300049823 Ga0501044_0126652 Ga0501044_0126652_2079_2432 109
450 3300049823 Ga0501044_0822281 Ga0501044_0822281_333_674 109
451 3300049824 Ga0501045_0028359 Ga0501045_0028359_2930_3271 109
452 3300049824 Ga0501045_0556455 Ga0501045_0556455_349_681 109
453 3300049824 Ga0501045_0667490 Ga0501045_0667490_312_653 109
454 3300050509 nmdc:mga0qj67_68306_c1 nmdc:mga0qj67_68306_c1_1774_2103 109
455 3300050515 nmdc:mga0a205_19_c2 nmdc:mga0a205_19_c2_23482_23814 109
456 3300053077 Ga0495601_0001218 Ga0495601_0001218_11948_12280 109
457 3300053077 Ga0495601_0058448 Ga0495601_0058448_685_1014 109
458 3300053077 Ga0495601_0116715 Ga0495601_0116715_17_346 109
459 3300053077 Ga0495601_0140554 Ga0495601_0140554_145_474 109
460 3300053077 Ga0495601_0151757 Ga0495601_0151757_615_944 109
461 3300053077 Ga0495601_0229846 Ga0495601_0229846_485_817 109
462 3300053077 Ga0495601_0248761 Ga0495601_0248761_643_972 109
463 3300053078 Ga0495612_0001807 Ga0495612_0001807_8117_8446 109
464 3300053078 Ga0495612_0003434 Ga0495612_0003434_5265_5600 109
465 3300053078 Ga0495612_0525849 Ga0495612_0525849_59_388 109
466 3300053083 Ga0495655_0000002 Ga0495655_0000002_130163_130492 109
467 3300053083 Ga0495655_0019360 Ga0495655_0019360_639_968 109
468 3300053084 Ga0495595_0000002 Ga0495595_0000002_166237_166566 109
469 3300053084 Ga0495595_0167431 Ga0495595_0167431_137_469 109
470 3300053085 Ga0495619_0000102 Ga0495619_0000102_22917_23249 109
471 3300053085 Ga0495619_0000268 Ga0495619_0000268_21391_21720 109
472 3300053085 Ga0495619_0011332 Ga0495619_0011332_53_385 109
473 3300053085 Ga0495619_0094497 Ga0495619_0094497_219_551 109
474 3300053085 Ga0495619_0409924 Ga0495619_0409924_458_790 109
475 3300053094 Ga0500566_0000683 Ga0500566_0000683_12758_13087 109
476 3300053096 Ga0500641_0000831 Ga0500641_0000831_5206_5535 109
477 3300053129 Ga0500628_000001 Ga0500628_000001_218832_219161 109
478 3300054114 Ga0501084_0212730 Ga0501084_0212730_94_435 109
479 3300060353 Ga0501082_0002303 Ga0501082_0002303_140_481 109
480 3300061734 Ga0530510_1103456 Ga0530510_1103456_69_422 109
481 3300025937 Ga0207669_10068491 Ga0207669_100684913 110
482 3300025945 Ga0207679_10071973 Ga0207679_100719735 110
483 3300046642 Ga0495634_0017341 Ga0495634_0017341_3432_3764 110
484 3300001979 JGI24740J21852_10004506 JGI24740J21852_100045066 112
485 3300046461 Ga0495641_0086445 Ga0495641_0086445_487_846 112
486 3300046681 Ga0495647_0001982 Ga0495647_0001982_3710_4069 112
487 3300047321 Ga0495676_0397158 Ga0495676_0397158_215_574 112

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uw0-assembly1.cif.gz_A solution structure of the zinc-finger domain from dna ligase iiia 0.8134 29 79
4opx-assembly1.cif.gz_A structure of human parp-1 bound to a dna double strand break in complex with (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7-carboxamide 0.7982 31 79
3oda-assembly4.cif.gz_G human parp-1 zinc finger 1 (zn1) bound to dna 0.7965 31 78
7s6h-assembly2.cif.gz_C human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. 0.7958 31 78
7s6h-assembly1.cif.gz_A human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. 0.7958 31 78
ID Description Score Start End Superfamily
af_Q21275_7_107_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8595 29 79 3.30.1740.10
af_Q54XI2_1_101_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8342 31 74 3.30.1740.10
af_Q54E19_1_108_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8333 31 77 3.30.1740.10
af_P35875_106_207_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8312 31 78 3.30.1740.10
af_P35875_2_105_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8279 29 78 3.30.1740.10
ID Description Score Start End GO Terms
AF-A0A7J9X108-F1-model_v4 Uncharacterized protein 0.9611 11 90
AF-A0A0F8YC83-F1-model_v4 PARP-type domain-containing protein 0.9329 29 77 GO:0003677
GO:0008270
AF-A0A0F9VL24-F1-model_v4 PARP-type domain-containing protein 0.9276 29 77 GO:0003677
GO:0008270
AF-A0A7K0A0J8-F1-model_v4 ATP/GTP-binding protein 0.9258 11 83
AF-A0A537YMM2-F1-model_v4 Uncharacterized protein 0.9215 4 111

Feature Viewer

pLDDT pTM Quality
84.45 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map