F453489
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 487 | 253 | 487 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300046461|Ga0495641_0086445|Ga0495641_0086445_487_846 |
| Length | 119 |
| Sequence | MDVEEALSLSQFEGLPSMRWSLTGLNEEGDETWLIRGIARKLYHCPGCHGDIPVGEEHTVVQYVRRLGGTDHHHWHRRCAEELLLPELGNLKRVPASESSQSRLEERGRRPSGRRDRRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 137 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 141 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 207 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 208 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 209 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 248 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 249 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 250 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.82 |
| Nodule | 0 |
| Rhizoplane | 11.09 |
| Rhizosphere | 81.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004506 | 3300001979 | Bacteria | 5997 |
| 2 | Ga0070683_100000835 | 3300005329 | Bacteria | 22828 |
| 3 | Ga0070683_100003886 | 3300005329 | Bacteria | 12223 |
| 4 | Ga0070690_100438449 | 3300005330 | Bacteria | 966 |
| 5 | Ga0070666_10040741 | 3300005335 | Bacteria | 3101 |
| 6 | Ga0070666_10067311 | 3300005335 | Bacteria | 2432 |
| 7 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 8 | Ga0068868_100004956 | 3300005338 | Bacteria | 9351 |
| 9 | Ga0070689_100128119 | 3300005340 | Bacteria | 2033 |
| 10 | Ga0070691_10000138 | 3300005341 | Bacteria | 22836 |
| 11 | Ga0070691_10756793 | 3300005341 | Bacteria | 588 |
| 12 | Ga0070661_100000058 | 3300005344 | Bacteria | 87363 |
| 13 | Ga0070661_100758942 | 3300005344 | Bacteria | 794 |
| 14 | Ga0070692_10036350 | 3300005345 | Bacteria | 2499 |
| 15 | Ga0070692_10689195 | 3300005345 | Bacteria | 686 |
| 16 | Ga0070668_100089709 | 3300005347 | Bacteria | 2422 |
| 17 | Ga0070668_100120668 | 3300005347 | Bacteria | 2095 |
| 18 | Ga0070668_102019466 | 3300005347 | Unclassified | 532 |
| 19 | Ga0070675_100000036 | 3300005354 | Bacteria | 85959 |
| 20 | Ga0070671_100343162 | 3300005355 | Bacteria | 1274 |
| 21 | Ga0070673_100472745 | 3300005364 | Bacteria | 1130 |
| 22 | Ga0070688_100000171 | 3300005365 | Bacteria | 34942 |
| 23 | Ga0070688_100000360 | 3300005365 | Bacteria | 23047 |
| 24 | Ga0070667_100001076 | 3300005367 | Bacteria | 24988 |
| 25 | Ga0070667_100006751 | 3300005367 | Bacteria | 9531 |
| 26 | Ga0070667_100045073 | 3300005367 | Bacteria | 3707 |
| 27 | Ga0070667_100102665 | 3300005367 | Bacteria | 2471 |
| 28 | Ga0070667_100683926 | 3300005367 | Unclassified | 948 |
| 29 | Ga0070709_11345480 | 3300005434 | Unclassified | 577 |
| 30 | Ga0070714_100094095 | 3300005435 | Bacteria | 2630 |
| 31 | Ga0070714_100566936 | 3300005435 | Unclassified | 1088 |
| 32 | Ga0070714_102312655 | 3300005435 | Unclassified | 523 |
| 33 | Ga0070713_100000047 | 3300005436 | Bacteria | 76760 |
| 34 | Ga0070713_100039662 | 3300005436 | Bacteria | 3824 |
| 35 | Ga0070711_100091636 | 3300005439 | Bacteria | 2192 |
| 36 | Ga0070700_100074280 | 3300005441 | Bacteria | 2178 |
| 37 | Ga0070694_100343819 | 3300005444 | Bacteria | 1154 |
| 38 | Ga0070694_101172337 | 3300005444 | Unclassified | 643 |
| 39 | Ga0070663_100003998 | 3300005455 | Bacteria | 8599 |
| 40 | Ga0070663_100772304 | 3300005455 | Bacteria | 822 |
| 41 | Ga0070681_10621632 | 3300005458 | Bacteria | 995 |
| 42 | Ga0070685_10000019 | 3300005466 | Bacteria | 105881 |
| 43 | Ga0070685_10000020 | 3300005466 | Bacteria | 104332 |
| 44 | Ga0070685_10209781 | 3300005466 | Bacteria | 1271 |
| 45 | Ga0070685_10637005 | 3300005466 | Bacteria | 771 |
| 46 | Ga0070679_100012803 | 3300005530 | Bacteria | 8026 |
| 47 | Ga0070684_100610062 | 3300005535 | Bacteria | 1015 |
| 48 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 49 | Ga0070672_101216475 | 3300005543 | Bacteria | 671 |
| 50 | Ga0070695_100322300 | 3300005545 | Unclassified | 1149 |
| 51 | Ga0070693_100926138 | 3300005547 | Unclassified | 655 |
| 52 | Ga0070665_100001462 | 3300005548 | Bacteria | 27694 |
| 53 | Ga0070665_100051392 | 3300005548 | Bacteria | 4133 |
| 54 | Ga0070665_100183823 | 3300005548 | Bacteria | 2091 |
| 55 | Ga0070665_100235741 | 3300005548 | Unclassified | 1830 |
| 56 | Ga0070665_101889954 | 3300005548 | Unclassified | 603 |
| 57 | Ga0070704_100231028 | 3300005549 | Bacteria | 1509 |
| 58 | Ga0068855_100337954 | 3300005563 | Bacteria | 1661 |
| 59 | Ga0070664_100116556 | 3300005564 | Bacteria | 2336 |
| 60 | Ga0068854_100003343 | 3300005578 | Bacteria | 9998 |
| 61 | Ga0068854_101110222 | 3300005578 | Bacteria | 705 |
| 62 | Ga0068856_100003300 | 3300005614 | Bacteria | 16401 |
| 63 | Ga0070702_100020360 | 3300005615 | Bacteria | 3474 |
| 64 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 65 | Ga0068852_100044940 | 3300005616 | Bacteria | 3754 |
| 66 | Ga0068866_10065962 | 3300005718 | Bacteria | 1895 |
| 67 | Ga0068861_102063091 | 3300005719 | Bacteria | 570 |
| 68 | Ga0068851_10000730 | 3300005834 | Bacteria | 14041 |
| 69 | Ga0068851_10000911 | 3300005834 | Bacteria | 12735 |
| 70 | Ga0068863_100029512 | 3300005841 | Bacteria | 5235 |
| 71 | Ga0068863_101512984 | 3300005841 | Unclassified | 680 |
| 72 | Ga0068860_100143302 | 3300005843 | Bacteria | 2298 |
| 73 | Ga0068862_100000943 | 3300005844 | Bacteria | 28026 |
| 74 | Ga0068862_100510751 | 3300005844 | Bacteria | 1142 |
| 75 | Ga0081455_10029831 | 3300005937 | Bacteria | 4967 |
| 76 | Ga0081455_10038488 | 3300005937 | Bacteria | 4235 |
| 77 | Ga0081455_10046721 | 3300005937 | Bacteria | 3754 |
| 78 | Ga0081455_10931649 | 3300005937 | Unclassified | 539 |
| 79 | Ga0081540_1000100 | 3300005983 | Bacteria | 91640 |
| 80 | Ga0081539_10002227 | 3300005985 | Bacteria | 28283 |
| 81 | Ga0070712_100007821 | 3300006175 | Bacteria | 6695 |
| 82 | Ga0097621_102405544 | 3300006237 | Bacteria | 504 |
| 83 | Ga0068871_100301341 | 3300006358 | Bacteria | 1407 |
| 84 | Ga0075430_100125903 | 3300006846 | Bacteria | 2136 |
| 85 | Ga0075433_10000421 | 3300006852 | Bacteria | 27102 |
| 86 | Ga0068865_100000013 | 3300006881 | Bacteria | 141352 |
| 87 | Ga0105240_11019158 | 3300009093 | Unclassified | 884 |
| 88 | Ga0105245_10000125 | 3300009098 | Bacteria | 73764 |
| 89 | Ga0105245_10052008 | 3300009098 | Bacteria | 3673 |
| 90 | Ga0105247_10001978 | 3300009101 | Bacteria | 14224 |
| 91 | Ga0105247_10134859 | 3300009101 | Bacteria | 1612 |
| 92 | Ga0105243_10024723 | 3300009148 | Bacteria | 4584 |
| 93 | Ga0105241_10065255 | 3300009174 | Bacteria | 2813 |
| 94 | Ga0105242_10000117 | 3300009176 | Bacteria | 57885 |
| 95 | Ga0105242_10000931 | 3300009176 | Bacteria | 22774 |
| 96 | Ga0105242_12072945 | 3300009176 | Bacteria | 612 |
| 97 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 98 | Ga0105237_11807037 | 3300009545 | Unclassified | 619 |
| 99 | Ga0105249_10003509 | 3300009553 | Bacteria | 13564 |
| 100 | Ga0105249_10311451 | 3300009553 | Bacteria | 1583 |
| 101 | Ga0105239_10515909 | 3300010375 | Bacteria | 1359 |
| 102 | Ga0105239_10819182 | 3300010375 | Bacteria | 1067 |
| 103 | Ga0105239_12347614 | 3300010375 | Bacteria | 621 |
| 104 | Ga0105246_12261120 | 3300011119 | Unclassified | 530 |
| 105 | Ga0157373_11248404 | 3300013100 | Bacteria | 561 |
| 106 | Ga0157371_10043297 | 3300013102 | Bacteria | 3207 |
| 107 | Ga0157370_10002971 | 3300013104 | Bacteria | 20162 |
| 108 | Ga0157370_10580794 | 3300013104 | Bacteria | 1027 |
| 109 | Ga0157369_10000307 | 3300013105 | Bacteria | 65486 |
| 110 | Ga0157369_10796624 | 3300013105 | Bacteria | 971 |
| 111 | Ga0157369_12215560 | 3300013105 | Unclassified | 557 |
| 112 | Ga0157374_10671340 | 3300013296 | Bacteria | 1049 |
| 113 | Ga0157374_12755937 | 3300013296 | Unclassified | 519 |
| 114 | Ga0157378_10003176 | 3300013297 | Bacteria | 14588 |
| 115 | Ga0157378_10031397 | 3300013297 | Bacteria | 4693 |
| 116 | Ga0157378_10118701 | 3300013297 | Bacteria | 2435 |
| 117 | Ga0163162_13467411 | 3300013306 | Bacteria | 502 |
| 118 | Ga0157372_10000053 | 3300013307 | Bacteria | 128824 |
| 119 | Ga0157372_10658337 | 3300013307 | Bacteria | 1219 |
| 120 | Ga0157375_10001535 | 3300013308 | Bacteria | 19883 |
| 121 | Ga0157375_10324303 | 3300013308 | Bacteria | 1705 |
| 122 | Ga0157375_12133748 | 3300013308 | Unclassified | 667 |
| 123 | Ga0163163_13212907 | 3300014325 | Unclassified | 510 |
| 124 | Ga0163163_13236525 | 3300014325 | Unclassified | 508 |
| 125 | Ga0157380_10000016 | 3300014326 | Bacteria | 126029 |
| 126 | Ga0157380_10244106 | 3300014326 | Bacteria | 1621 |
| 127 | Ga0157380_10444701 | 3300014326 | Unclassified | 1243 |
| 128 | Ga0157377_11032762 | 3300014745 | Bacteria | 625 |
| 129 | Ga0157379_10011155 | 3300014968 | Bacteria | 7832 |
| 130 | Ga0157379_11384530 | 3300014968 | Bacteria | 681 |
| 131 | Ga0157376_10022880 | 3300014969 | Bacteria | 4880 |
| 132 | Ga0157376_10056914 | 3300014969 | Bacteria | 3269 |
| 133 | Ga0206356_11093252 | 3300020070 | Bacteria | 1017 |
| 134 | Ga0224712_10555524 | 3300022467 | Unclassified | 558 |
| 135 | Ga0207656_10000211 | 3300025321 | Bacteria | 20768 |
| 136 | Ga0207656_10004794 | 3300025321 | Bacteria | 4747 |
| 137 | Ga0207642_10046848 | 3300025899 | Bacteria | 1929 |
| 138 | Ga0207710_10000821 | 3300025900 | Bacteria | 16775 |
| 139 | Ga0207710_10080177 | 3300025900 | Bacteria | 1513 |
| 140 | Ga0207680_10036448 | 3300025903 | Bacteria | 2833 |
| 141 | Ga0207680_10080560 | 3300025903 | Bacteria | 2045 |
| 142 | Ga0207699_10547634 | 3300025906 | Bacteria | 839 |
| 143 | Ga0207654_10047296 | 3300025911 | Bacteria | 2457 |
| 144 | Ga0207707_10095334 | 3300025912 | Bacteria | 2600 |
| 145 | Ga0207695_10705369 | 3300025913 | Bacteria | 889 |
| 146 | Ga0207671_10394191 | 3300025914 | Bacteria | 1101 |
| 147 | Ga0207671_10588962 | 3300025914 | Unclassified | 886 |
| 148 | Ga0207693_10049045 | 3300025915 | Bacteria | 3316 |
| 149 | Ga0207663_10062835 | 3300025916 | Bacteria | 2362 |
| 150 | Ga0207649_10000283 | 3300025920 | Bacteria | 39628 |
| 151 | Ga0207649_10690246 | 3300025920 | Bacteria | 791 |
| 152 | Ga0207652_10008840 | 3300025921 | Bacteria | 8115 |
| 153 | Ga0207694_10860681 | 3300025924 | Bacteria | 766 |
| 154 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 155 | Ga0207687_10000017 | 3300025927 | Bacteria | 237310 |
| 156 | Ga0207687_10030407 | 3300025927 | Bacteria | 3641 |
| 157 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 158 | Ga0207664_10102186 | 3300025929 | Bacteria | 2370 |
| 159 | Ga0207664_10859952 | 3300025929 | Unclassified | 815 |
| 160 | Ga0207664_11498908 | 3300025929 | Bacteria | 596 |
| 161 | Ga0207644_10923133 | 3300025931 | Bacteria | 732 |
| 162 | Ga0207686_10000254 | 3300025934 | Bacteria | 40780 |
| 163 | Ga0207686_10002477 | 3300025934 | Bacteria | 10029 |
| 164 | Ga0207686_11230270 | 3300025934 | Bacteria | 613 |
| 165 | Ga0207709_10006143 | 3300025935 | Bacteria | 6765 |
| 166 | Ga0207670_10098140 | 3300025936 | Bacteria | 2087 |
| 167 | Ga0207669_10068491 | 3300025937 | Bacteria | 2217 |
| 168 | Ga0207669_10334328 | 3300025937 | Bacteria | 1164 |
| 169 | Ga0207704_10000040 | 3300025938 | Bacteria | 90178 |
| 170 | Ga0207704_10384276 | 3300025938 | Bacteria | 1103 |
| 171 | Ga0207691_10000017 | 3300025940 | Bacteria | 134441 |
| 172 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 173 | Ga0207661_10000198 | 3300025944 | Bacteria | 39018 |
| 174 | Ga0207661_10002675 | 3300025944 | Bacteria | 12265 |
| 175 | Ga0207679_10071973 | 3300025945 | Bacteria | 2610 |
| 176 | Ga0207679_10093327 | 3300025945 | Bacteria | 2334 |
| 177 | Ga0207667_10104473 | 3300025949 | Bacteria | 2922 |
| 178 | Ga0207667_10781886 | 3300025949 | Bacteria | 952 |
| 179 | Ga0207651_10607967 | 3300025960 | Bacteria | 956 |
| 180 | Ga0207712_10011490 | 3300025961 | Bacteria | 5642 |
| 181 | Ga0207668_10031903 | 3300025972 | Bacteria | 3475 |
| 182 | Ga0207668_10099769 | 3300025972 | Bacteria | 2155 |
| 183 | Ga0207640_10000370 | 3300025981 | Bacteria | 29030 |
| 184 | Ga0207658_10003877 | 3300025986 | Bacteria | 10532 |
| 185 | Ga0207658_10087929 | 3300025986 | Bacteria | 2400 |
| 186 | Ga0207658_10104027 | 3300025986 | Bacteria | 2230 |
| 187 | Ga0207658_10182475 | 3300025986 | Bacteria | 1738 |
| 188 | Ga0207677_10002708 | 3300026023 | Bacteria | 9342 |
| 189 | Ga0207639_10118502 | 3300026041 | Bacteria | 2171 |
| 190 | Ga0207678_10047722 | 3300026067 | Bacteria | 3702 |
| 191 | Ga0207708_10201180 | 3300026075 | Bacteria | 1589 |
| 192 | Ga0207702_10002446 | 3300026078 | Bacteria | 17589 |
| 193 | Ga0207702_10706766 | 3300026078 | Bacteria | 993 |
| 194 | Ga0207702_11390603 | 3300026078 | Bacteria | 696 |
| 195 | Ga0207641_10043814 | 3300026088 | Bacteria | 3760 |
| 196 | Ga0207641_10351086 | 3300026088 | Bacteria | 1406 |
| 197 | Ga0207641_10425831 | 3300026088 | Bacteria | 1279 |
| 198 | Ga0207641_11447646 | 3300026088 | Unclassified | 688 |
| 199 | Ga0207674_11121611 | 3300026116 | Bacteria | 756 |
| 200 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 201 | Ga0207698_10038394 | 3300026142 | Bacteria | 3538 |
| 202 | Ga0268266_10000601 | 3300028379 | Bacteria | 49250 |
| 203 | Ga0268266_10001254 | 3300028379 | Bacteria | 31003 |
| 204 | Ga0268266_10026262 | 3300028379 | Bacteria | 4956 |
| 205 | Ga0268266_10161379 | 3300028379 | Bacteria | 2028 |
| 206 | Ga0268266_10314156 | 3300028379 | Unclassified | 1465 |
| 207 | Ga0268266_10737825 | 3300028379 | Unclassified | 950 |
| 208 | Ga0268266_11109158 | 3300028379 | Bacteria | 765 |
| 209 | Ga0268266_11461450 | 3300028379 | Unclassified | 659 |
| 210 | Ga0268265_10004453 | 3300028380 | Bacteria | 9721 |
| 211 | Ga0268265_11319361 | 3300028380 | Bacteria | 722 |
| 212 | Ga0268264_10464896 | 3300028381 | Bacteria | 1228 |
| 213 | Ga0268264_10511974 | 3300028381 | Bacteria | 1172 |
| 214 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 215 | Ga0265334_10047765 | 3300028573 | Bacteria | 1650 |
| 216 | Ga0265338_10000244 | 3300028800 | Bacteria | 100528 |
| 217 | Ga0265324_10045813 | 3300029957 | Bacteria | 1506 |
| 218 | Ga0265313_10239623 | 3300031595 | Bacteria | 743 |
| 219 | Ga0307416_101430708 | 3300032002 | Unclassified | 797 |
| 220 | Ga0307415_100240361 | 3300032126 | Bacteria | 1464 |
| 221 | Ga0316583_10046322 | 3300032133 | Bacteria | 1535 |
| 222 | Ga0373955_0437768 | 3300035172 | Unclassified | 796 |
| 223 | Ga0373937_0734533 | 3300036401 | Bacteria | 934 |
| 224 | Ga0316582_0605817 | 3300036647 | Bacteria | 754 |
| 225 | Ga0451800_0374107 | 3300041459 | Unclassified | 671 |
| 226 | Ga0451802_1290304 | 3300041460 | Unclassified | 548 |
| 227 | Ga0451807_1434009 | 3300041486 | Bacteria | 1428 |
| 228 | Ga0451807_1892530 | 3300041486 | Bacteria | 546 |
| 229 | Ga0451835_0389310 | 3300041492 | Bacteria | 578 |
| 230 | Ga0451849_0058156 | 3300041505 | Unclassified | 754 |
| 231 | Ga0451849_1214696 | 3300041505 | Unclassified | 1660 |
| 232 | Ga0451853_1746024 | 3300041512 | Bacteria | 935 |
| 233 | Ga0466963_0523116 | 3300044694 | Bacteria | 838 |
| 234 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 235 | Ga0466967_0175529 | 3300045976 | Bacteria | 2019 |
| 236 | Ga0466967_1714654 | 3300045976 | Unclassified | 626 |
| 237 | Ga0495592_0371965 | 3300046454 | Bacteria | 911 |
| 238 | Ga0495592_0425435 | 3300046454 | Bacteria | 837 |
| 239 | Ga0495629_0000260 | 3300046459 | Bacteria | 46062 |
| 240 | Ga0495629_0000487 | 3300046459 | Bacteria | 33176 |
| 241 | Ga0495629_0010874 | 3300046459 | Bacteria | 6617 |
| 242 | Ga0495638_0029338 | 3300046460 | Bacteria | 3547 |
| 243 | Ga0495641_0023225 | 3300046461 | Bacteria | 3086 |
| 244 | Ga0495641_0086445 | 3300046461 | Bacteria | 1403 |
| 245 | Ga0495641_0088313 | 3300046461 | Bacteria | 1387 |
| 246 | Ga0495651_0076881 | 3300046462 | Bacteria | 2528 |
| 247 | Ga0495651_0100543 | 3300046462 | Bacteria | 2154 |
| 248 | Ga0495651_0185936 | 3300046462 | Bacteria | 1466 |
| 249 | Ga0495653_0270457 | 3300046463 | Bacteria | 1119 |
| 250 | Ga0495662_0013837 | 3300046476 | Bacteria | 3926 |
| 251 | Ga0495664_0184458 | 3300046477 | Unclassified | 1265 |
| 252 | Ga0495664_0681916 | 3300046477 | Unclassified | 608 |
| 253 | Ga0495594_0000089 | 3300046499 | Bacteria | 41876 |
| 254 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 255 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 256 | Ga0495608_0549812 | 3300046511 | Bacteria | 696 |
| 257 | Ga0495618_0150995 | 3300046514 | Bacteria | 1484 |
| 258 | Ga0495618_0161212 | 3300046514 | Bacteria | 1430 |
| 259 | Ga0495628_0000859 | 3300046516 | Bacteria | 28076 |
| 260 | Ga0495628_0123737 | 3300046516 | Bacteria | 1982 |
| 261 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 262 | Ga0495630_0000256 | 3300046517 | Bacteria | 42987 |
| 263 | Ga0495630_0054889 | 3300046517 | Bacteria | 2985 |
| 264 | Ga0495630_0333418 | 3300046517 | Bacteria | 1160 |
| 265 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 266 | Ga0495652_0003765 | 3300046529 | Bacteria | 14828 |
| 267 | Ga0495640_0363851 | 3300046533 | Bacteria | 891 |
| 268 | Ga0495587_0000618 | 3300046536 | Bacteria | 24150 |
| 269 | Ga0495587_0128483 | 3300046536 | Unclassified | 1449 |
| 270 | Ga0495587_0181367 | 3300046536 | Bacteria | 1194 |
| 271 | Ga0495587_0511353 | 3300046536 | Bacteria | 664 |
| 272 | Ga0495587_0656834 | 3300046536 | Bacteria | 576 |
| 273 | Ga0495645_0223416 | 3300046543 | Bacteria | 1265 |
| 274 | Ga0495645_0252907 | 3300046543 | Bacteria | 1170 |
| 275 | Ga0495622_0000218 | 3300046557 | Bacteria | 45469 |
| 276 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 277 | Ga0495667_0282586 | 3300046559 | Bacteria | 1053 |
| 278 | Ga0495634_0002567 | 3300046642 | Bacteria | 14991 |
| 279 | Ga0495634_0017341 | 3300046642 | Bacteria | 5141 |
| 280 | Ga0495634_0061993 | 3300046642 | Bacteria | 2484 |
| 281 | Ga0495625_0000688 | 3300046660 | Bacteria | 48233 |
| 282 | Ga0495635_0386765 | 3300046663 | Bacteria | 930 |
| 283 | Ga0495588_0000338 | 3300046674 | Bacteria | 30480 |
| 284 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 285 | Ga0495657_0176745 | 3300046675 | Bacteria | 1312 |
| 286 | Ga0495647_0001982 | 3300046681 | Bacteria | 6392 |
| 287 | Ga0495647_0200061 | 3300046681 | Bacteria | 876 |
| 288 | Ga0495658_0003808 | 3300046683 | Bacteria | 7472 |
| 289 | Ga0495658_0117560 | 3300046683 | Unclassified | 1605 |
| 290 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 291 | Ga0495624_0000671 | 3300046690 | Bacteria | 26768 |
| 292 | Ga0495604_0000239 | 3300047317 | Bacteria | 49113 |
| 293 | Ga0495604_0105915 | 3300047317 | Bacteria | 2057 |
| 294 | Ga0495674_0002248 | 3300047319 | Bacteria | 18976 |
| 295 | Ga0495672_0214273 | 3300047320 | Bacteria | 955 |
| 296 | Ga0495672_0214623 | 3300047320 | Bacteria | 953 |
| 297 | Ga0495676_0001364 | 3300047321 | Bacteria | 21008 |
| 298 | Ga0495676_0137244 | 3300047321 | Bacteria | 1757 |
| 299 | Ga0495676_0397158 | 3300047321 | Bacteria | 915 |
| 300 | Ga0495676_0852702 | 3300047321 | Unclassified | 585 |
| 301 | Ga0495680_0002541 | 3300047322 | Bacteria | 18636 |
| 302 | Ga0495680_0126650 | 3300047322 | Bacteria | 1880 |
| 303 | Ga0495675_0000300 | 3300047444 | Bacteria | 35530 |
| 304 | Ga0495675_0298925 | 3300047444 | Unclassified | 956 |
| 305 | Ga0495684_0185521 | 3300047471 | Bacteria | 1540 |
| 306 | Ga0495684_0301749 | 3300047471 | Bacteria | 1150 |
| 307 | Ga0495684_0323656 | 3300047471 | Bacteria | 1102 |
| 308 | Ga0495684_0540874 | 3300047471 | Bacteria | 795 |
| 309 | Ga0495686_0090480 | 3300047472 | Bacteria | 1858 |
| 310 | Ga0495593_0072470 | 3300047673 | Bacteria | 1788 |
| 311 | Ga0495593_0111770 | 3300047673 | Bacteria | 1395 |
| 312 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 313 | Ga0495602_0000611 | 3300048088 | Bacteria | 33553 |
| 314 | Ga0495602_0267802 | 3300048088 | Bacteria | 1264 |
| 315 | Ga0495602_0761977 | 3300048088 | Bacteria | 652 |
| 316 | Ga0495602_1149475 | 3300048088 | Unclassified | 507 |
| 317 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 318 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 319 | Ga0496101_0829407 | 3300048904 | Bacteria | 729 |
| 320 | Ga0496102_0000294 | 3300048905 | Bacteria | 64001 |
| 321 | Ga0496102_0061178 | 3300048905 | Bacteria | 3445 |
| 322 | Ga0496102_0370462 | 3300048905 | Bacteria | 1348 |
| 323 | Ga0496102_0677577 | 3300048905 | Bacteria | 954 |
| 324 | Ga0496103_0000159 | 3300048906 | Bacteria | 71148 |
| 325 | Ga0496103_0209260 | 3300048906 | Bacteria | 1254 |
| 326 | Ga0496103_0982565 | 3300048906 | Unclassified | 526 |
| 327 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 328 | Ga0496104_0000765 | 3300048907 | Bacteria | 27516 |
| 329 | Ga0496104_0033800 | 3300048907 | Bacteria | 4766 |
| 330 | Ga0496104_0039152 | 3300048907 | Bacteria | 4438 |
| 331 | Ga0496104_0491021 | 3300048907 | Bacteria | 1139 |
| 332 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 333 | Ga0496105_0007927 | 3300048908 | Bacteria | 8252 |
| 334 | Ga0496105_0063371 | 3300048908 | Bacteria | 3050 |
| 335 | Ga0496105_0618973 | 3300048908 | Unclassified | 838 |
| 336 | Ga0496105_0909849 | 3300048908 | Bacteria | 663 |
| 337 | Ga0496106_0000056 | 3300048909 | Bacteria | 90682 |
| 338 | Ga0496106_0738163 | 3300048909 | Unclassified | 783 |
| 339 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 340 | Ga0496107_0022168 | 3300048910 | Bacteria | 4488 |
| 341 | Ga0496108_0000063 | 3300048911 | Bacteria | 118950 |
| 342 | Ga0496108_0004943 | 3300048911 | Bacteria | 10771 |
| 343 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 344 | Ga0496109_0000173 | 3300048912 | Bacteria | 63867 |
| 345 | Ga0496109_0586198 | 3300048912 | Unclassified | 1051 |
| 346 | Ga0496109_0749907 | 3300048912 | Bacteria | 914 |
| 347 | Ga0496109_1182980 | 3300048912 | Unclassified | 701 |
| 348 | Ga0496110_0002711 | 3300048913 | Bacteria | 13381 |
| 349 | Ga0496110_0089639 | 3300048913 | Bacteria | 2749 |
| 350 | Ga0496110_0442927 | 3300048913 | Bacteria | 1184 |
| 351 | Ga0496110_1829347 | 3300048913 | Bacteria | 517 |
| 352 | Ga0496111_0000035 | 3300048914 | Bacteria | 54459 |
| 353 | Ga0496111_0320516 | 3300048914 | Bacteria | 1148 |
| 354 | Ga0496111_0428058 | 3300048914 | Bacteria | 977 |
| 355 | Ga0496112_1064189 | 3300048915 | Unclassified | 728 |
| 356 | Ga0496113_0000026 | 3300048916 | Bacteria | 63999 |
| 357 | Ga0496113_0101237 | 3300048916 | Bacteria | 2233 |
| 358 | Ga0496113_0452755 | 3300048916 | Bacteria | 1031 |
| 359 | Ga0496113_1089310 | 3300048916 | Bacteria | 627 |
| 360 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 361 | Ga0496114_0092100 | 3300048917 | Bacteria | 2575 |
| 362 | Ga0496114_0520470 | 3300048917 | Unclassified | 1052 |
| 363 | Ga0496114_0862453 | 3300048917 | Bacteria | 786 |
| 364 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 365 | Ga0496115_0003457 | 3300048918 | Bacteria | 11348 |
| 366 | Ga0496115_0014195 | 3300048918 | Bacteria | 6026 |
| 367 | Ga0496116_0000331 | 3300048919 | Bacteria | 76536 |
| 368 | Ga0496117_0036733 | 3300048920 | Bacteria | 3661 |
| 369 | Ga0496117_0348858 | 3300048920 | Bacteria | 765 |
| 370 | Ga0496118_0003934 | 3300048921 | Bacteria | 18170 |
| 371 | Ga0496118_0217295 | 3300048921 | Bacteria | 1116 |
| 372 | Ga0496118_0221043 | 3300048921 | Bacteria | 1102 |
| 373 | Ga0496119_0002281 | 3300048922 | Bacteria | 21246 |
| 374 | Ga0496119_0005810 | 3300048922 | Bacteria | 11668 |
| 375 | Ga0496119_0008997 | 3300048922 | Bacteria | 8667 |
| 376 | Ga0496119_0060355 | 3300048922 | Bacteria | 2271 |
| 377 | Ga0496120_0001336 | 3300048923 | Bacteria | 30395 |
| 378 | Ga0496120_0133608 | 3300048923 | Bacteria | 1268 |
| 379 | Ga0496120_0401930 | 3300048923 | Bacteria | 605 |
| 380 | Ga0496121_0036049 | 3300048924 | Bacteria | 4416 |
| 381 | Ga0496121_0052194 | 3300048924 | Bacteria | 3436 |
| 382 | Ga0496121_0142675 | 3300048924 | Bacteria | 1774 |
| 383 | Ga0496121_0247902 | 3300048924 | Bacteria | 1237 |
| 384 | Ga0496121_0758154 | 3300048924 | Unclassified | 576 |
| 385 | Ga0496124_0235077 | 3300048927 | Unclassified | 1367 |
| 386 | Ga0496124_0988472 | 3300048927 | Unclassified | 502 |
| 387 | Ga0496125_0056943 | 3300048928 | Bacteria | 3170 |
| 388 | Ga0496125_0071876 | 3300048928 | Bacteria | 2700 |
| 389 | Ga0496126_0248123 | 3300048929 | Bacteria | 1484 |
| 390 | Ga0496126_0529883 | 3300048929 | Bacteria | 937 |
| 391 | Ga0496126_0548679 | 3300048929 | Bacteria | 917 |
| 392 | Ga0496126_0702768 | 3300048929 | Bacteria | 785 |
| 393 | Ga0496126_0728322 | 3300048929 | Bacteria | 768 |
| 394 | Ga0496126_0835098 | 3300048929 | Bacteria | 704 |
| 395 | Ga0501031_0000188 | 3300049568 | Bacteria | 34790 |
| 396 | Ga0501031_0376171 | 3300049568 | Bacteria | 919 |
| 397 | Ga0501032_0001031 | 3300049569 | Bacteria | 22377 |
| 398 | Ga0501032_0256976 | 3300049569 | Unclassified | 1133 |
| 399 | Ga0501032_0457125 | 3300049569 | Bacteria | 818 |
| 400 | Ga0501033_0000554 | 3300049570 | Bacteria | 34825 |
| 401 | Ga0501034_0002861 | 3300049571 | Bacteria | 20083 |
| 402 | Ga0501034_1694566 | 3300049571 | Bacteria | 504 |
| 403 | Ga0501036_0000336 | 3300049572 | Bacteria | 32902 |
| 404 | Ga0501036_1630796 | 3300049572 | Bacteria | 520 |
| 405 | Ga0501037_0000425 | 3300049573 | Bacteria | 34779 |
| 406 | Ga0501038_0001384 | 3300049574 | Bacteria | 22160 |
| 407 | Ga0501039_0016759 | 3300049575 | Bacteria | 5615 |
| 408 | Ga0501040_0013286 | 3300049576 | Bacteria | 5415 |
| 409 | Ga0501042_0023712 | 3300049578 | Bacteria | 4297 |
| 410 | Ga0501042_0058343 | 3300049578 | Bacteria | 2755 |
| 411 | Ga0501043_0000516 | 3300049579 | Bacteria | 34780 |
| 412 | Ga0501046_0000439 | 3300049580 | Bacteria | 41871 |
| 413 | Ga0501046_0485676 | 3300049580 | Bacteria | 886 |
| 414 | Ga0501047_0000706 | 3300049581 | Bacteria | 34791 |
| 415 | Ga0501047_0121419 | 3300049581 | Bacteria | 2494 |
| 416 | Ga0501047_0177613 | 3300049581 | Bacteria | 1996 |
| 417 | Ga0501047_0196535 | 3300049581 | Bacteria | 1879 |
| 418 | Ga0501047_1376910 | 3300049581 | Bacteria | 520 |
| 419 | Ga0501048_0000269 | 3300049582 | Bacteria | 34831 |
| 420 | Ga0501067_0070728 | 3300049583 | Bacteria | 1932 |
| 421 | Ga0501068_0009015 | 3300049584 | Bacteria | 5568 |
| 422 | Ga0501069_0009766 | 3300049585 | Bacteria | 5071 |
| 423 | Ga0501069_0010469 | 3300049585 | Bacteria | 4909 |
| 424 | Ga0501070_0000649 | 3300049586 | Bacteria | 31969 |
| 425 | Ga0501070_0005184 | 3300049586 | Bacteria | 11101 |
| 426 | Ga0501070_0025917 | 3300049586 | Bacteria | 4919 |
| 427 | Ga0501070_0073221 | 3300049586 | Bacteria | 2834 |
| 428 | Ga0501070_0272674 | 3300049586 | Bacteria | 1381 |
| 429 | Ga0501071_0140445 | 3300049587 | Unclassified | 1798 |
| 430 | Ga0501071_0212161 | 3300049587 | Bacteria | 1456 |
| 431 | Ga0501072_0002921 | 3300049588 | Bacteria | 12861 |
| 432 | Ga0501073_0001545 | 3300049589 | Bacteria | 17056 |
| 433 | Ga0501074_0020000 | 3300049590 | Bacteria | 4865 |
| 434 | Ga0501074_0029244 | 3300049590 | Bacteria | 3991 |
| 435 | Ga0501074_0086676 | 3300049590 | Bacteria | 2243 |
| 436 | Ga0501076_0038909 | 3300049592 | Bacteria | 3733 |
| 437 | Ga0501076_0640433 | 3300049592 | Bacteria | 877 |
| 438 | Ga0501077_0903394 | 3300049593 | Bacteria | 568 |
| 439 | Ga0501079_0012584 | 3300049741 | Bacteria | 6462 |
| 440 | Ga0501079_0123609 | 3300049741 | Bacteria | 2013 |
| 441 | Ga0501079_0225971 | 3300049741 | Bacteria | 1462 |
| 442 | Ga0501080_0004448 | 3300049742 | Bacteria | 12472 |
| 443 | Ga0501080_0025778 | 3300049742 | Bacteria | 5461 |
| 444 | Ga0501081_0382196 | 3300049743 | Bacteria | 1041 |
| 445 | Ga0501083_0000794 | 3300049744 | Bacteria | 20751 |
| 446 | Ga0501083_0019501 | 3300049744 | Bacteria | 4724 |
| 447 | Ga0501083_0025968 | 3300049744 | Bacteria | 4052 |
| 448 | Ga0501083_0510457 | 3300049744 | Bacteria | 782 |
| 449 | Ga0501035_0000754 | 3300049822 | Bacteria | 34845 |
| 450 | Ga0501035_1150344 | 3300049822 | Bacteria | 604 |
| 451 | Ga0501044_0000947 | 3300049823 | Bacteria | 34821 |
| 452 | Ga0501044_0014304 | 3300049823 | Bacteria | 8566 |
| 453 | Ga0501044_0126652 | 3300049823 | Bacteria | 2551 |
| 454 | Ga0501044_0822281 | 3300049823 | Unclassified | 807 |
| 455 | Ga0501045_0028359 | 3300049824 | Bacteria | 4038 |
| 456 | Ga0501045_0556455 | 3300049824 | Bacteria | 851 |
| 457 | Ga0501045_0667490 | 3300049824 | Bacteria | 768 |
| 458 | nmdc:mga0qj67_68306_c1 | 3300050509 | Bacteria | 2832 |
| 459 | nmdc:mga0a205_19_c2 | 3300050515 | Bacteria | 74147 |
| 460 | Ga0495601_0001218 | 3300053077 | Bacteria | 14090 |
| 461 | Ga0495601_0058448 | 3300053077 | Bacteria | 2444 |
| 462 | Ga0495601_0116715 | 3300053077 | Bacteria | 1731 |
| 463 | Ga0495601_0140554 | 3300053077 | Bacteria | 1575 |
| 464 | Ga0495601_0151757 | 3300053077 | Unclassified | 1512 |
| 465 | Ga0495601_0229846 | 3300053077 | Bacteria | 1211 |
| 466 | Ga0495601_0248761 | 3300053077 | Bacteria | 1161 |
| 467 | Ga0495612_0001807 | 3300053078 | Bacteria | 8762 |
| 468 | Ga0495612_0003434 | 3300053078 | Bacteria | 6569 |
| 469 | Ga0495612_0525849 | 3300053078 | Bacteria | 544 |
| 470 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 471 | Ga0495655_0019360 | 3300053083 | Bacteria | 1510 |
| 472 | Ga0495655_0108754 | 3300053083 | Bacteria | 830 |
| 473 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 474 | Ga0495595_0167431 | 3300053084 | Bacteria | 1086 |
| 475 | Ga0495619_0000102 | 3300053085 | Bacteria | 64345 |
| 476 | Ga0495619_0000268 | 3300053085 | Bacteria | 37980 |
| 477 | Ga0495619_0005581 | 3300053085 | Bacteria | 7983 |
| 478 | Ga0495619_0011332 | 3300053085 | Bacteria | 5612 |
| 479 | Ga0495619_0094497 | 3300053085 | Bacteria | 2028 |
| 480 | Ga0495619_0409924 | 3300053085 | Bacteria | 935 |
| 481 | Ga0500566_0000683 | 3300053094 | Bacteria | 19070 |
| 482 | Ga0500641_0000831 | 3300053096 | Bacteria | 11108 |
| 483 | Ga0500572_255035 | 3300053111 | Bacteria | 570 |
| 484 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 485 | Ga0501084_0212730 | 3300054114 | Bacteria | 1631 |
| 486 | Ga0501082_0002303 | 3300060353 | Bacteria | 16703 |
| 487 | Ga0530510_1103456 | 3300061734 | Bacteria | 608 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_12072945 | Ga0105242_120729451 | 91 |
| 2 | 3300046536 | Ga0495587_0000618 | Ga0495587_0000618_1075_1368 | 97 |
| 3 | 3300005367 | Ga0070667_100683926 | Ga0070667_1006839262 | 98 |
| 4 | 3300009553 | Ga0105249_10311451 | Ga0105249_103114512 | 98 |
| 5 | 3300028381 | Ga0268264_10464896 | Ga0268264_104648962 | 98 |
| 6 | 3300048929 | Ga0496126_0728322 | Ga0496126_0728322_382_702 | 98 |
| 7 | 3300046477 | Ga0495664_0681916 | Ga0495664_0681916_140_469 | 99 |
| 8 | 3300047322 | Ga0495680_0002541 | Ga0495680_0002541_6592_6894 | 99 |
| 9 | 3300048916 | Ga0496113_1089310 | Ga0496113_1089310_267_602 | 99 |
| 10 | 3300005543 | Ga0070672_101216475 | Ga0070672_1012164752 | 100 |
| 11 | 3300010375 | Ga0105239_12347614 | Ga0105239_123476142 | 100 |
| 12 | 3300014326 | Ga0157380_10244106 | Ga0157380_102441063 | 100 |
| 13 | 3300025934 | Ga0207686_11230270 | Ga0207686_112302701 | 100 |
| 14 | 3300041505 | Ga0451849_0058156 | Ga0451849_0058156_382_684 | 100 |
| 15 | 3300046674 | Ga0495588_0000338 | Ga0495588_0000338_24590_24898 | 100 |
| 16 | 3300048904 | Ga0496101_0829407 | Ga0496101_0829407_372_686 | 100 |
| 17 | 3300048905 | Ga0496102_0061178 | Ga0496102_0061178_3013_3327 | 100 |
| 18 | 3300048906 | Ga0496103_0209260 | Ga0496103_0209260_620_934 | 100 |
| 19 | 3300048907 | Ga0496104_0033800 | Ga0496104_0033800_2159_2473 | 100 |
| 20 | 3300048908 | Ga0496105_0007927 | Ga0496105_0007927_6577_6891 | 100 |
| 21 | 3300048908 | Ga0496105_0909849 | Ga0496105_0909849_207_521 | 100 |
| 22 | 3300048909 | Ga0496106_0738163 | Ga0496106_0738163_16_330 | 100 |
| 23 | 3300048910 | Ga0496107_0022168 | Ga0496107_0022168_3201_3515 | 100 |
| 24 | 3300048912 | Ga0496109_0586198 | Ga0496109_0586198_566_880 | 100 |
| 25 | 3300048913 | Ga0496110_0089639 | Ga0496110_0089639_687_995 | 100 |
| 26 | 3300048914 | Ga0496111_0428058 | Ga0496111_0428058_495_803 | 100 |
| 27 | 3300048917 | Ga0496114_0092100 | Ga0496114_0092100_1872_2195 | 100 |
| 28 | 3300048917 | Ga0496114_0862453 | Ga0496114_0862453_211_519 | 100 |
| 29 | 3300048919 | Ga0496116_0000331 | Ga0496116_0000331_64053_64394 | 100 |
| 30 | 3300048920 | Ga0496117_0036733 | Ga0496117_0036733_314_628 | 100 |
| 31 | 3300048921 | Ga0496118_0003934 | Ga0496118_0003934_17604_17918 | 100 |
| 32 | 3300048921 | Ga0496118_0217295 | Ga0496118_0217295_108_422 | 100 |
| 33 | 3300048922 | Ga0496119_0002281 | Ga0496119_0002281_8750_9091 | 100 |
| 34 | 3300048922 | Ga0496119_0005810 | Ga0496119_0005810_7032_7346 | 100 |
| 35 | 3300048922 | Ga0496119_0008997 | Ga0496119_0008997_1363_1677 | 100 |
| 36 | 3300048923 | Ga0496120_0001336 | Ga0496120_0001336_16373_16687 | 100 |
| 37 | 3300048923 | Ga0496120_0401930 | Ga0496120_0401930_60_374 | 100 |
| 38 | 3300048924 | Ga0496121_0036049 | Ga0496121_0036049_196_510 | 100 |
| 39 | 3300048924 | Ga0496121_0052194 | Ga0496121_0052194_184_498 | 100 |
| 40 | 3300048924 | Ga0496121_0142675 | Ga0496121_0142675_329_643 | 100 |
| 41 | 3300048927 | Ga0496124_0235077 | Ga0496124_0235077_998_1324 | 100 |
| 42 | 3300048928 | Ga0496125_0056943 | Ga0496125_0056943_2027_2341 | 100 |
| 43 | 3300048928 | Ga0496125_0071876 | Ga0496125_0071876_1396_1710 | 100 |
| 44 | 3300048929 | Ga0496126_0529883 | Ga0496126_0529883_164_487 | 100 |
| 45 | 3300048929 | Ga0496126_0548679 | Ga0496126_0548679_451_774 | 100 |
| 46 | 3300048929 | Ga0496126_0702768 | Ga0496126_0702768_121_444 | 100 |
| 47 | 3300048929 | Ga0496126_0835098 | Ga0496126_0835098_202_516 | 100 |
| 48 | 3300049571 | Ga0501034_1694566 | Ga0501034_1694566_26_340 | 100 |
| 49 | 3300049744 | Ga0501083_0019501 | Ga0501083_0019501_1906_2220 | 100 |
| 50 | 3300053083 | Ga0495655_0108754 | Ga0495655_0108754_496_810 | 100 |
| 51 | 3300053111 | Ga0500572_255035 | Ga0500572_255035_18_332 | 100 |
| 52 | 3300035172 | Ga0373955_0437768 | Ga0373955_0437768_375_710 | 102 |
| 53 | 3300036401 | Ga0373937_0734533 | Ga0373937_0734533_115_450 | 102 |
| 54 | 3300046663 | Ga0495635_0386765 | Ga0495635_0386765_523_858 | 102 |
| 55 | 3300047673 | Ga0495593_0111770 | Ga0495593_0111770_946_1275 | 102 |
| 56 | 3300053085 | Ga0495619_0005581 | Ga0495619_0005581_863_1198 | 102 |
| 57 | 3300013308 | Ga0157375_12133748 | Ga0157375_121337482 | 104 |
| 58 | 3300044694 | Ga0466963_0523116 | Ga0466963_0523116_15_353 | 104 |
| 59 | 3300046511 | Ga0495608_0549812 | Ga0495608_0549812_15_344 | 104 |
| 60 | 3300005937 | Ga0081455_10038488 | Ga0081455_100384885 | 107 |
| 61 | 3300046462 | Ga0495651_0076881 | Ga0495651_0076881_977_1303 | 108 |
| 62 | 3300046463 | Ga0495653_0270457 | Ga0495653_0270457_465_791 | 108 |
| 63 | 3300046536 | Ga0495587_0656834 | Ga0495587_0656834_224_550 | 108 |
| 64 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_198102_198428 | 108 |
| 65 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_277371_277697 | 108 |
| 66 | 3300048922 | Ga0496119_0060355 | Ga0496119_0060355_665_991 | 108 |
| 67 | 3300048923 | Ga0496120_0133608 | Ga0496120_0133608_263_589 | 108 |
| 68 | 3300005329 | Ga0070683_100000835 | Ga0070683_1000008352 | 109 |
| 69 | 3300005329 | Ga0070683_100003886 | Ga0070683_10000388613 | 109 |
| 70 | 3300005330 | Ga0070690_100438449 | Ga0070690_1004384492 | 109 |
| 71 | 3300005335 | Ga0070666_10040741 | Ga0070666_100407413 | 109 |
| 72 | 3300005335 | Ga0070666_10067311 | Ga0070666_100673112 | 109 |
| 73 | 3300005337 | Ga0070682_100000011 | Ga0070682_10000001127 | 109 |
| 74 | 3300005338 | Ga0068868_100004956 | Ga0068868_1000049567 | 109 |
| 75 | 3300005340 | Ga0070689_100128119 | Ga0070689_1001281193 | 109 |
| 76 | 3300005341 | Ga0070691_10000138 | Ga0070691_1000013813 | 109 |
| 77 | 3300005341 | Ga0070691_10756793 | Ga0070691_107567932 | 109 |
| 78 | 3300005344 | Ga0070661_100000058 | Ga0070661_10000005834 | 109 |
| 79 | 3300005344 | Ga0070661_100758942 | Ga0070661_1007589422 | 109 |
| 80 | 3300005345 | Ga0070692_10036350 | Ga0070692_100363503 | 109 |
| 81 | 3300005345 | Ga0070692_10689195 | Ga0070692_106891952 | 109 |
| 82 | 3300005347 | Ga0070668_100089709 | Ga0070668_1000897092 | 109 |
| 83 | 3300005347 | Ga0070668_100120668 | Ga0070668_1001206683 | 109 |
| 84 | 3300005347 | Ga0070668_102019466 | Ga0070668_1020194661 | 109 |
| 85 | 3300005354 | Ga0070675_100000036 | Ga0070675_10000003647 | 109 |
| 86 | 3300005355 | Ga0070671_100343162 | Ga0070671_1003431621 | 109 |
| 87 | 3300005364 | Ga0070673_100472745 | Ga0070673_1004727452 | 109 |
| 88 | 3300005365 | Ga0070688_100000171 | Ga0070688_1000001718 | 109 |
| 89 | 3300005365 | Ga0070688_100000360 | Ga0070688_10000036016 | 109 |
| 90 | 3300005367 | Ga0070667_100001076 | Ga0070667_10000107622 | 109 |
| 91 | 3300005367 | Ga0070667_100006751 | Ga0070667_10000675112 | 109 |
| 92 | 3300005367 | Ga0070667_100045073 | Ga0070667_1000450736 | 109 |
| 93 | 3300005367 | Ga0070667_100102665 | Ga0070667_1001026653 | 109 |
| 94 | 3300005434 | Ga0070709_11345480 | Ga0070709_113454802 | 109 |
| 95 | 3300005435 | Ga0070714_100094095 | Ga0070714_1000940953 | 109 |
| 96 | 3300005435 | Ga0070714_100566936 | Ga0070714_1005669362 | 109 |
| 97 | 3300005435 | Ga0070714_102312655 | Ga0070714_1023126551 | 109 |
| 98 | 3300005436 | Ga0070713_100000047 | Ga0070713_10000004754 | 109 |
| 99 | 3300005436 | Ga0070713_100039662 | Ga0070713_1000396621 | 109 |
| 100 | 3300005439 | Ga0070711_100091636 | Ga0070711_1000916362 | 109 |
| 101 | 3300005441 | Ga0070700_100074280 | Ga0070700_1000742803 | 109 |
| 102 | 3300005444 | Ga0070694_100343819 | Ga0070694_1003438193 | 109 |
| 103 | 3300005444 | Ga0070694_101172337 | Ga0070694_1011723371 | 109 |
| 104 | 3300005455 | Ga0070663_100003998 | Ga0070663_1000039981 | 109 |
| 105 | 3300005455 | Ga0070663_100772304 | Ga0070663_1007723042 | 109 |
| 106 | 3300005458 | Ga0070681_10621632 | Ga0070681_106216322 | 109 |
| 107 | 3300005466 | Ga0070685_10000019 | Ga0070685_1000001973 | 109 |
| 108 | 3300005466 | Ga0070685_10000020 | Ga0070685_1000002021 | 109 |
| 109 | 3300005466 | Ga0070685_10209781 | Ga0070685_102097811 | 109 |
| 110 | 3300005466 | Ga0070685_10637005 | Ga0070685_106370051 | 109 |
| 111 | 3300005530 | Ga0070679_100012803 | Ga0070679_1000128038 | 109 |
| 112 | 3300005535 | Ga0070684_100610062 | Ga0070684_1006100621 | 109 |
| 113 | 3300005543 | Ga0070672_100000001 | Ga0070672_100000001125 | 109 |
| 114 | 3300005545 | Ga0070695_100322300 | Ga0070695_1003223002 | 109 |
| 115 | 3300005547 | Ga0070693_100926138 | Ga0070693_1009261382 | 109 |
| 116 | 3300005548 | Ga0070665_100001462 | Ga0070665_10000146232 | 109 |
| 117 | 3300005548 | Ga0070665_100051392 | Ga0070665_1000513922 | 109 |
| 118 | 3300005548 | Ga0070665_100183823 | Ga0070665_1001838233 | 109 |
| 119 | 3300005548 | Ga0070665_100235741 | Ga0070665_1002357413 | 109 |
| 120 | 3300005548 | Ga0070665_101889954 | Ga0070665_1018899542 | 109 |
| 121 | 3300005549 | Ga0070704_100231028 | Ga0070704_1002310282 | 109 |
| 122 | 3300005563 | Ga0068855_100337954 | Ga0068855_1003379542 | 109 |
| 123 | 3300005564 | Ga0070664_100116556 | Ga0070664_1001165564 | 109 |
| 124 | 3300005578 | Ga0068854_100003343 | Ga0068854_1000033433 | 109 |
| 125 | 3300005578 | Ga0068854_101110222 | Ga0068854_1011102222 | 109 |
| 126 | 3300005614 | Ga0068856_100003300 | Ga0068856_10000330013 | 109 |
| 127 | 3300005615 | Ga0070702_100020360 | Ga0070702_1000203603 | 109 |
| 128 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002192 | 109 |
| 129 | 3300005616 | Ga0068852_100044940 | Ga0068852_1000449403 | 109 |
| 130 | 3300005718 | Ga0068866_10065962 | Ga0068866_100659622 | 109 |
| 131 | 3300005719 | Ga0068861_102063091 | Ga0068861_1020630912 | 109 |
| 132 | 3300005834 | Ga0068851_10000730 | Ga0068851_100007303 | 109 |
| 133 | 3300005834 | Ga0068851_10000911 | Ga0068851_100009117 | 109 |
| 134 | 3300005841 | Ga0068863_100029512 | Ga0068863_1000295126 | 109 |
| 135 | 3300005841 | Ga0068863_101512984 | Ga0068863_1015129842 | 109 |
| 136 | 3300005843 | Ga0068860_100143302 | Ga0068860_1001433022 | 109 |
| 137 | 3300005844 | Ga0068862_100000943 | Ga0068862_10000094328 | 109 |
| 138 | 3300005844 | Ga0068862_100510751 | Ga0068862_1005107511 | 109 |
| 139 | 3300005937 | Ga0081455_10029831 | Ga0081455_100298313 | 109 |
| 140 | 3300005937 | Ga0081455_10046721 | Ga0081455_100467214 | 109 |
| 141 | 3300005937 | Ga0081455_10931649 | Ga0081455_109316492 | 109 |
| 142 | 3300005983 | Ga0081540_1000100 | Ga0081540_100010028 | 109 |
| 143 | 3300005985 | Ga0081539_10002227 | Ga0081539_1000222712 | 109 |
| 144 | 3300006175 | Ga0070712_100007821 | Ga0070712_1000078214 | 109 |
| 145 | 3300006237 | Ga0097621_102405544 | Ga0097621_1024055441 | 109 |
| 146 | 3300006358 | Ga0068871_100301341 | Ga0068871_1003013413 | 109 |
| 147 | 3300006846 | Ga0075430_100125903 | Ga0075430_1001259033 | 109 |
| 148 | 3300006852 | Ga0075433_10000421 | Ga0075433_100004216 | 109 |
| 149 | 3300006881 | Ga0068865_100000013 | Ga0068865_10000001338 | 109 |
| 150 | 3300009093 | Ga0105240_11019158 | Ga0105240_110191582 | 109 |
| 151 | 3300009098 | Ga0105245_10000125 | Ga0105245_1000012522 | 109 |
| 152 | 3300009098 | Ga0105245_10052008 | Ga0105245_100520083 | 109 |
| 153 | 3300009101 | Ga0105247_10001978 | Ga0105247_100019788 | 109 |
| 154 | 3300009101 | Ga0105247_10134859 | Ga0105247_101348592 | 109 |
| 155 | 3300009148 | Ga0105243_10024723 | Ga0105243_100247234 | 109 |
| 156 | 3300009174 | Ga0105241_10065255 | Ga0105241_100652552 | 109 |
| 157 | 3300009176 | Ga0105242_10000117 | Ga0105242_1000011727 | 109 |
| 158 | 3300009176 | Ga0105242_10000931 | Ga0105242_100009316 | 109 |
| 159 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020147 | 109 |
| 160 | 3300009545 | Ga0105237_11807037 | Ga0105237_118070371 | 109 |
| 161 | 3300009553 | Ga0105249_10003509 | Ga0105249_1000350913 | 109 |
| 162 | 3300010375 | Ga0105239_10515909 | Ga0105239_105159092 | 109 |
| 163 | 3300010375 | Ga0105239_10819182 | Ga0105239_108191823 | 109 |
| 164 | 3300011119 | Ga0105246_12261120 | Ga0105246_122611202 | 109 |
| 165 | 3300013100 | Ga0157373_11248404 | Ga0157373_112484042 | 109 |
| 166 | 3300013102 | Ga0157371_10043297 | Ga0157371_100432973 | 109 |
| 167 | 3300013104 | Ga0157370_10002971 | Ga0157370_1000297112 | 109 |
| 168 | 3300013104 | Ga0157370_10580794 | Ga0157370_105807943 | 109 |
| 169 | 3300013105 | Ga0157369_10000307 | Ga0157369_1000030739 | 109 |
| 170 | 3300013105 | Ga0157369_10796624 | Ga0157369_107966242 | 109 |
| 171 | 3300013105 | Ga0157369_12215560 | Ga0157369_122155601 | 109 |
| 172 | 3300013296 | Ga0157374_10671340 | Ga0157374_106713402 | 109 |
| 173 | 3300013296 | Ga0157374_12755937 | Ga0157374_127559372 | 109 |
| 174 | 3300013297 | Ga0157378_10003176 | Ga0157378_100031769 | 109 |
| 175 | 3300013297 | Ga0157378_10031397 | Ga0157378_100313976 | 109 |
| 176 | 3300013297 | Ga0157378_10118701 | Ga0157378_101187012 | 109 |
| 177 | 3300013306 | Ga0163162_13467411 | Ga0163162_134674111 | 109 |
| 178 | 3300013307 | Ga0157372_10000053 | Ga0157372_1000005388 | 109 |
| 179 | 3300013307 | Ga0157372_10658337 | Ga0157372_106583372 | 109 |
| 180 | 3300013308 | Ga0157375_10001535 | Ga0157375_100015353 | 109 |
| 181 | 3300013308 | Ga0157375_10324303 | Ga0157375_103243033 | 109 |
| 182 | 3300014325 | Ga0163163_13212907 | Ga0163163_132129071 | 109 |
| 183 | 3300014325 | Ga0163163_13236525 | Ga0163163_132365252 | 109 |
| 184 | 3300014326 | Ga0157380_10000016 | Ga0157380_1000001676 | 109 |
| 185 | 3300014326 | Ga0157380_10444701 | Ga0157380_104447012 | 109 |
| 186 | 3300014745 | Ga0157377_11032762 | Ga0157377_110327621 | 109 |
| 187 | 3300014968 | Ga0157379_10011155 | Ga0157379_1001115511 | 109 |
| 188 | 3300014968 | Ga0157379_11384530 | Ga0157379_113845302 | 109 |
| 189 | 3300014969 | Ga0157376_10022880 | Ga0157376_100228803 | 109 |
| 190 | 3300014969 | Ga0157376_10056914 | Ga0157376_100569142 | 109 |
| 191 | 3300020070 | Ga0206356_11093252 | Ga0206356_110932522 | 109 |
| 192 | 3300022467 | Ga0224712_10555524 | Ga0224712_105555241 | 109 |
| 193 | 3300025321 | Ga0207656_10000211 | Ga0207656_1000021116 | 109 |
| 194 | 3300025321 | Ga0207656_10004794 | Ga0207656_100047942 | 109 |
| 195 | 3300025899 | Ga0207642_10046848 | Ga0207642_100468482 | 109 |
| 196 | 3300025900 | Ga0207710_10000821 | Ga0207710_1000082115 | 109 |
| 197 | 3300025900 | Ga0207710_10080177 | Ga0207710_100801772 | 109 |
| 198 | 3300025903 | Ga0207680_10036448 | Ga0207680_100364483 | 109 |
| 199 | 3300025903 | Ga0207680_10080560 | Ga0207680_100805602 | 109 |
| 200 | 3300025906 | Ga0207699_10547634 | Ga0207699_105476341 | 109 |
| 201 | 3300025911 | Ga0207654_10047296 | Ga0207654_100472964 | 109 |
| 202 | 3300025912 | Ga0207707_10095334 | Ga0207707_100953342 | 109 |
| 203 | 3300025913 | Ga0207695_10705369 | Ga0207695_107053692 | 109 |
| 204 | 3300025914 | Ga0207671_10394191 | Ga0207671_103941912 | 109 |
| 205 | 3300025914 | Ga0207671_10588962 | Ga0207671_105889622 | 109 |
| 206 | 3300025915 | Ga0207693_10049045 | Ga0207693_100490454 | 109 |
| 207 | 3300025916 | Ga0207663_10062835 | Ga0207663_100628353 | 109 |
| 208 | 3300025920 | Ga0207649_10000283 | Ga0207649_1000028316 | 109 |
| 209 | 3300025920 | Ga0207649_10690246 | Ga0207649_106902462 | 109 |
| 210 | 3300025921 | Ga0207652_10008840 | Ga0207652_100088408 | 109 |
| 211 | 3300025924 | Ga0207694_10860681 | Ga0207694_108606811 | 109 |
| 212 | 3300025926 | Ga0207659_10000013 | Ga0207659_10000013113 | 109 |
| 213 | 3300025927 | Ga0207687_10000017 | Ga0207687_10000017202 | 109 |
| 214 | 3300025927 | Ga0207687_10030407 | Ga0207687_100304074 | 109 |
| 215 | 3300025928 | Ga0207700_10000033 | Ga0207700_1000003353 | 109 |
| 216 | 3300025929 | Ga0207664_10102186 | Ga0207664_101021862 | 109 |
| 217 | 3300025929 | Ga0207664_10859952 | Ga0207664_108599522 | 109 |
| 218 | 3300025929 | Ga0207664_11498908 | Ga0207664_114989082 | 109 |
| 219 | 3300025931 | Ga0207644_10923133 | Ga0207644_109231332 | 109 |
| 220 | 3300025934 | Ga0207686_10000254 | Ga0207686_1000025436 | 109 |
| 221 | 3300025934 | Ga0207686_10002477 | Ga0207686_100024776 | 109 |
| 222 | 3300025935 | Ga0207709_10006143 | Ga0207709_100061437 | 109 |
| 223 | 3300025936 | Ga0207670_10098140 | Ga0207670_100981402 | 109 |
| 224 | 3300025937 | Ga0207669_10334328 | Ga0207669_103343282 | 109 |
| 225 | 3300025938 | Ga0207704_10000040 | Ga0207704_1000004034 | 109 |
| 226 | 3300025938 | Ga0207704_10384276 | Ga0207704_103842762 | 109 |
| 227 | 3300025940 | Ga0207691_10000017 | Ga0207691_1000001752 | 109 |
| 228 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006229 | 109 |
| 229 | 3300025944 | Ga0207661_10000198 | Ga0207661_1000019826 | 109 |
| 230 | 3300025944 | Ga0207661_10002675 | Ga0207661_100026756 | 109 |
| 231 | 3300025945 | Ga0207679_10093327 | Ga0207679_100933274 | 109 |
| 232 | 3300025949 | Ga0207667_10104473 | Ga0207667_101044734 | 109 |
| 233 | 3300025949 | Ga0207667_10781886 | Ga0207667_107818862 | 109 |
| 234 | 3300025960 | Ga0207651_10607967 | Ga0207651_106079672 | 109 |
| 235 | 3300025961 | Ga0207712_10011490 | Ga0207712_100114909 | 109 |
| 236 | 3300025972 | Ga0207668_10031903 | Ga0207668_100319032 | 109 |
| 237 | 3300025972 | Ga0207668_10099769 | Ga0207668_100997693 | 109 |
| 238 | 3300025981 | Ga0207640_10000370 | Ga0207640_1000037021 | 109 |
| 239 | 3300025986 | Ga0207658_10003877 | Ga0207658_100038777 | 109 |
| 240 | 3300025986 | Ga0207658_10087929 | Ga0207658_100879293 | 109 |
| 241 | 3300025986 | Ga0207658_10104027 | Ga0207658_101040273 | 109 |
| 242 | 3300025986 | Ga0207658_10182475 | Ga0207658_101824753 | 109 |
| 243 | 3300026023 | Ga0207677_10002708 | Ga0207677_100027087 | 109 |
| 244 | 3300026041 | Ga0207639_10118502 | Ga0207639_101185022 | 109 |
| 245 | 3300026067 | Ga0207678_10047722 | Ga0207678_100477223 | 109 |
| 246 | 3300026075 | Ga0207708_10201180 | Ga0207708_102011803 | 109 |
| 247 | 3300026078 | Ga0207702_10002446 | Ga0207702_1000244619 | 109 |
| 248 | 3300026078 | Ga0207702_10706766 | Ga0207702_107067662 | 109 |
| 249 | 3300026078 | Ga0207702_11390603 | Ga0207702_113906031 | 109 |
| 250 | 3300026088 | Ga0207641_10043814 | Ga0207641_100438142 | 109 |
| 251 | 3300026088 | Ga0207641_10351086 | Ga0207641_103510863 | 109 |
| 252 | 3300026088 | Ga0207641_10425831 | Ga0207641_104258313 | 109 |
| 253 | 3300026088 | Ga0207641_11447646 | Ga0207641_114476462 | 109 |
| 254 | 3300026116 | Ga0207674_11121611 | Ga0207674_111216112 | 109 |
| 255 | 3300026142 | Ga0207698_10000004 | Ga0207698_1000000493 | 109 |
| 256 | 3300026142 | Ga0207698_10038394 | Ga0207698_100383943 | 109 |
| 257 | 3300028379 | Ga0268266_10000601 | Ga0268266_1000060123 | 109 |
| 258 | 3300028379 | Ga0268266_10001254 | Ga0268266_100012546 | 109 |
| 259 | 3300028379 | Ga0268266_10026262 | Ga0268266_100262626 | 109 |
| 260 | 3300028379 | Ga0268266_10161379 | Ga0268266_101613793 | 109 |
| 261 | 3300028379 | Ga0268266_10314156 | Ga0268266_103141562 | 109 |
| 262 | 3300028379 | Ga0268266_10737825 | Ga0268266_107378252 | 109 |
| 263 | 3300028379 | Ga0268266_11109158 | Ga0268266_111091582 | 109 |
| 264 | 3300028379 | Ga0268266_11461450 | Ga0268266_114614502 | 109 |
| 265 | 3300028380 | Ga0268265_10004453 | Ga0268265_1000445312 | 109 |
| 266 | 3300028380 | Ga0268265_11319361 | Ga0268265_113193611 | 109 |
| 267 | 3300028381 | Ga0268264_10511974 | Ga0268264_105119742 | 109 |
| 268 | 3300028563 | Ga0265319_1000014 | Ga0265319_1000014190 | 109 |
| 269 | 3300028573 | Ga0265334_10047765 | Ga0265334_100477651 | 109 |
| 270 | 3300028800 | Ga0265338_10000244 | Ga0265338_1000024466 | 109 |
| 271 | 3300029957 | Ga0265324_10045813 | Ga0265324_100458133 | 109 |
| 272 | 3300031595 | Ga0265313_10239623 | Ga0265313_102396232 | 109 |
| 273 | 3300032002 | Ga0307416_101430708 | Ga0307416_1014307082 | 109 |
| 274 | 3300032126 | Ga0307415_100240361 | Ga0307415_1002403613 | 109 |
| 275 | 3300032133 | Ga0316583_10046322 | Ga0316583_100463223 | 109 |
| 276 | 3300036647 | Ga0316582_0605817 | Ga0316582_0605817_314_643 | 109 |
| 277 | 3300041459 | Ga0451800_0374107 | Ga0451800_0374107_123_452 | 109 |
| 278 | 3300041460 | Ga0451802_1290304 | Ga0451802_1290304_117_458 | 109 |
| 279 | 3300041486 | Ga0451807_1434009 | Ga0451807_1434009_95_424 | 109 |
| 280 | 3300041486 | Ga0451807_1892530 | Ga0451807_1892530_159_491 | 109 |
| 281 | 3300041492 | Ga0451835_0389310 | Ga0451835_0389310_126_455 | 109 |
| 282 | 3300041505 | Ga0451849_1214696 | Ga0451849_1214696_449_778 | 109 |
| 283 | 3300041512 | Ga0451853_1746024 | Ga0451853_1746024_386_715 | 109 |
| 284 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_140047_140379 | 109 |
| 285 | 3300045976 | Ga0466967_0175529 | Ga0466967_0175529_998_1333 | 109 |
| 286 | 3300045976 | Ga0466967_1714654 | Ga0466967_1714654_139_492 | 109 |
| 287 | 3300046454 | Ga0495592_0371965 | Ga0495592_0371965_35_364 | 109 |
| 288 | 3300046454 | Ga0495592_0425435 | Ga0495592_0425435_362_697 | 109 |
| 289 | 3300046459 | Ga0495629_0000260 | Ga0495629_0000260_40178_40507 | 109 |
| 290 | 3300046459 | Ga0495629_0000487 | Ga0495629_0000487_16861_17196 | 109 |
| 291 | 3300046459 | Ga0495629_0010874 | Ga0495629_0010874_3335_3664 | 109 |
| 292 | 3300046460 | Ga0495638_0029338 | Ga0495638_0029338_2515_2844 | 109 |
| 293 | 3300046461 | Ga0495641_0023225 | Ga0495641_0023225_1403_1735 | 109 |
| 294 | 3300046461 | Ga0495641_0088313 | Ga0495641_0088313_545_880 | 109 |
| 295 | 3300046462 | Ga0495651_0100543 | Ga0495651_0100543_1533_1868 | 109 |
| 296 | 3300046462 | Ga0495651_0185936 | Ga0495651_0185936_407_736 | 109 |
| 297 | 3300046476 | Ga0495662_0013837 | Ga0495662_0013837_2675_3010 | 109 |
| 298 | 3300046477 | Ga0495664_0184458 | Ga0495664_0184458_731_1060 | 109 |
| 299 | 3300046499 | Ga0495594_0000089 | Ga0495594_0000089_10591_10920 | 109 |
| 300 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_110826_111161 | 109 |
| 301 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_146930_147259 | 109 |
| 302 | 3300046514 | Ga0495618_0150995 | Ga0495618_0150995_403_732 | 109 |
| 303 | 3300046514 | Ga0495618_0161212 | Ga0495618_0161212_1019_1348 | 109 |
| 304 | 3300046516 | Ga0495628_0000859 | Ga0495628_0000859_11934_12269 | 109 |
| 305 | 3300046516 | Ga0495628_0123737 | Ga0495628_0123737_979_1308 | 109 |
| 306 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_120662_120997 | 109 |
| 307 | 3300046517 | Ga0495630_0000256 | Ga0495630_0000256_3591_3923 | 109 |
| 308 | 3300046517 | Ga0495630_0054889 | Ga0495630_0054889_1450_1782 | 109 |
| 309 | 3300046517 | Ga0495630_0333418 | Ga0495630_0333418_532_861 | 109 |
| 310 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_249023_249358 | 109 |
| 311 | 3300046529 | Ga0495652_0003765 | Ga0495652_0003765_2362_2691 | 109 |
| 312 | 3300046533 | Ga0495640_0363851 | Ga0495640_0363851_395_724 | 109 |
| 313 | 3300046536 | Ga0495587_0128483 | Ga0495587_0128483_151_486 | 109 |
| 314 | 3300046536 | Ga0495587_0181367 | Ga0495587_0181367_600_935 | 109 |
| 315 | 3300046536 | Ga0495587_0511353 | Ga0495587_0511353_46_375 | 109 |
| 316 | 3300046543 | Ga0495645_0223416 | Ga0495645_0223416_153_482 | 109 |
| 317 | 3300046543 | Ga0495645_0252907 | Ga0495645_0252907_606_935 | 109 |
| 318 | 3300046557 | Ga0495622_0000218 | Ga0495622_0000218_26028_26357 | 109 |
| 319 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_41914_42246 | 109 |
| 320 | 3300046559 | Ga0495667_0282586 | Ga0495667_0282586_429_758 | 109 |
| 321 | 3300046642 | Ga0495634_0002567 | Ga0495634_0002567_3080_3409 | 109 |
| 322 | 3300046642 | Ga0495634_0061993 | Ga0495634_0061993_1753_2085 | 109 |
| 323 | 3300046660 | Ga0495625_0000688 | Ga0495625_0000688_12256_12585 | 109 |
| 324 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_279076_279405 | 109 |
| 325 | 3300046675 | Ga0495657_0176745 | Ga0495657_0176745_416_748 | 109 |
| 326 | 3300046681 | Ga0495647_0200061 | Ga0495647_0200061_415_744 | 109 |
| 327 | 3300046683 | Ga0495658_0003808 | Ga0495658_0003808_1259_1594 | 109 |
| 328 | 3300046683 | Ga0495658_0117560 | Ga0495658_0117560_282_614 | 109 |
| 329 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_25854_26186 | 109 |
| 330 | 3300046690 | Ga0495624_0000671 | Ga0495624_0000671_2284_2619 | 109 |
| 331 | 3300047317 | Ga0495604_0000239 | Ga0495604_0000239_31674_32006 | 109 |
| 332 | 3300047317 | Ga0495604_0105915 | Ga0495604_0105915_1181_1513 | 109 |
| 333 | 3300047319 | Ga0495674_0002248 | Ga0495674_0002248_11817_12149 | 109 |
| 334 | 3300047320 | Ga0495672_0214273 | Ga0495672_0214273_439_768 | 109 |
| 335 | 3300047320 | Ga0495672_0214623 | Ga0495672_0214623_30_359 | 109 |
| 336 | 3300047321 | Ga0495676_0001364 | Ga0495676_0001364_2906_3235 | 109 |
| 337 | 3300047321 | Ga0495676_0137244 | Ga0495676_0137244_802_1131 | 109 |
| 338 | 3300047321 | Ga0495676_0852702 | Ga0495676_0852702_28_357 | 109 |
| 339 | 3300047322 | Ga0495680_0126650 | Ga0495680_0126650_1437_1766 | 109 |
| 340 | 3300047444 | Ga0495675_0000300 | Ga0495675_0000300_11984_12313 | 109 |
| 341 | 3300047444 | Ga0495675_0298925 | Ga0495675_0298925_501_830 | 109 |
| 342 | 3300047471 | Ga0495684_0185521 | Ga0495684_0185521_952_1284 | 109 |
| 343 | 3300047471 | Ga0495684_0301749 | Ga0495684_0301749_724_1056 | 109 |
| 344 | 3300047471 | Ga0495684_0323656 | Ga0495684_0323656_203_532 | 109 |
| 345 | 3300047471 | Ga0495684_0540874 | Ga0495684_0540874_30_365 | 109 |
| 346 | 3300047472 | Ga0495686_0090480 | Ga0495686_0090480_1111_1440 | 109 |
| 347 | 3300047673 | Ga0495593_0072470 | Ga0495593_0072470_86_418 | 109 |
| 348 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_123477_123809 | 109 |
| 349 | 3300048088 | Ga0495602_0000611 | Ga0495602_0000611_11924_12259 | 109 |
| 350 | 3300048088 | Ga0495602_0267802 | Ga0495602_0267802_278_607 | 109 |
| 351 | 3300048088 | Ga0495602_0761977 | Ga0495602_0761977_210_542 | 109 |
| 352 | 3300048088 | Ga0495602_1149475 | Ga0495602_1149475_33_362 | 109 |
| 353 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_353809_354138 | 109 |
| 354 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_155161_155490 | 109 |
| 355 | 3300048905 | Ga0496102_0000294 | Ga0496102_0000294_5639_5968 | 109 |
| 356 | 3300048905 | Ga0496102_0370462 | Ga0496102_0370462_1000_1329 | 109 |
| 357 | 3300048905 | Ga0496102_0677577 | Ga0496102_0677577_332_670 | 109 |
| 358 | 3300048906 | Ga0496103_0000159 | Ga0496103_0000159_58221_58550 | 109 |
| 359 | 3300048906 | Ga0496103_0982565 | Ga0496103_0982565_125_466 | 109 |
| 360 | 3300048907 | Ga0496104_0000765 | Ga0496104_0000765_4503_4832 | 109 |
| 361 | 3300048907 | Ga0496104_0039152 | Ga0496104_0039152_1461_1790 | 109 |
| 362 | 3300048907 | Ga0496104_0491021 | Ga0496104_0491021_197_526 | 109 |
| 363 | 3300048908 | Ga0496105_0063371 | Ga0496105_0063371_2085_2414 | 109 |
| 364 | 3300048908 | Ga0496105_0618973 | Ga0496105_0618973_13_342 | 109 |
| 365 | 3300048909 | Ga0496106_0000056 | Ga0496106_0000056_76134_76463 | 109 |
| 366 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_176110_176439 | 109 |
| 367 | 3300048911 | Ga0496108_0000063 | Ga0496108_0000063_64526_64858 | 109 |
| 368 | 3300048911 | Ga0496108_0004943 | Ga0496108_0004943_552_887 | 109 |
| 369 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_47889_48221 | 109 |
| 370 | 3300048912 | Ga0496109_0000173 | Ga0496109_0000173_6898_7233 | 109 |
| 371 | 3300048912 | Ga0496109_0749907 | Ga0496109_0749907_438_767 | 109 |
| 372 | 3300048912 | Ga0496109_1182980 | Ga0496109_1182980_251_580 | 109 |
| 373 | 3300048913 | Ga0496110_0002711 | Ga0496110_0002711_635_967 | 109 |
| 374 | 3300048913 | Ga0496110_0442927 | Ga0496110_0442927_696_1031 | 109 |
| 375 | 3300048913 | Ga0496110_1829347 | Ga0496110_1829347_96_431 | 109 |
| 376 | 3300048914 | Ga0496111_0000035 | Ga0496111_0000035_13090_13422 | 109 |
| 377 | 3300048914 | Ga0496111_0320516 | Ga0496111_0320516_289_618 | 109 |
| 378 | 3300048915 | Ga0496112_1064189 | Ga0496112_1064189_352_687 | 109 |
| 379 | 3300048916 | Ga0496113_0000026 | Ga0496113_0000026_40210_40545 | 109 |
| 380 | 3300048916 | Ga0496113_0101237 | Ga0496113_0101237_672_1004 | 109 |
| 381 | 3300048916 | Ga0496113_0452755 | Ga0496113_0452755_541_870 | 109 |
| 382 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_5474_5803 | 109 |
| 383 | 3300048917 | Ga0496114_0520470 | Ga0496114_0520470_177_506 | 109 |
| 384 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_128746_129075 | 109 |
| 385 | 3300048918 | Ga0496115_0003457 | Ga0496115_0003457_5574_5903 | 109 |
| 386 | 3300048918 | Ga0496115_0014195 | Ga0496115_0014195_1220_1552 | 109 |
| 387 | 3300048920 | Ga0496117_0348858 | Ga0496117_0348858_365_706 | 109 |
| 388 | 3300048921 | Ga0496118_0221043 | Ga0496118_0221043_335_664 | 109 |
| 389 | 3300048924 | Ga0496121_0247902 | Ga0496121_0247902_621_962 | 109 |
| 390 | 3300048924 | Ga0496121_0758154 | Ga0496121_0758154_41_394 | 109 |
| 391 | 3300048927 | Ga0496124_0988472 | Ga0496124_0988472_21_362 | 109 |
| 392 | 3300048929 | Ga0496126_0248123 | Ga0496126_0248123_319_660 | 109 |
| 393 | 3300049568 | Ga0501031_0000188 | Ga0501031_0000188_18135_18476 | 109 |
| 394 | 3300049568 | Ga0501031_0376171 | Ga0501031_0376171_196_537 | 109 |
| 395 | 3300049569 | Ga0501032_0001031 | Ga0501032_0001031_5695_6036 | 109 |
| 396 | 3300049569 | Ga0501032_0256976 | Ga0501032_0256976_525_866 | 109 |
| 397 | 3300049569 | Ga0501032_0457125 | Ga0501032_0457125_460_789 | 109 |
| 398 | 3300049570 | Ga0501033_0000554 | Ga0501033_0000554_16342_16683 | 109 |
| 399 | 3300049571 | Ga0501034_0002861 | Ga0501034_0002861_16342_16683 | 109 |
| 400 | 3300049572 | Ga0501036_0000336 | Ga0501036_0000336_16342_16683 | 109 |
| 401 | 3300049572 | Ga0501036_1630796 | Ga0501036_1630796_146_478 | 109 |
| 402 | 3300049573 | Ga0501037_0000425 | Ga0501037_0000425_18097_18438 | 109 |
| 403 | 3300049574 | Ga0501038_0001384 | Ga0501038_0001384_5478_5819 | 109 |
| 404 | 3300049575 | Ga0501039_0016759 | Ga0501039_0016759_3996_4337 | 109 |
| 405 | 3300049576 | Ga0501040_0013286 | Ga0501040_0013286_4027_4368 | 109 |
| 406 | 3300049578 | Ga0501042_0023712 | Ga0501042_0023712_1090_1431 | 109 |
| 407 | 3300049578 | Ga0501042_0058343 | Ga0501042_0058343_1112_1441 | 109 |
| 408 | 3300049579 | Ga0501043_0000516 | Ga0501043_0000516_16342_16683 | 109 |
| 409 | 3300049580 | Ga0501046_0000439 | Ga0501046_0000439_16342_16683 | 109 |
| 410 | 3300049580 | Ga0501046_0485676 | Ga0501046_0485676_471_803 | 109 |
| 411 | 3300049581 | Ga0501047_0000706 | Ga0501047_0000706_18109_18450 | 109 |
| 412 | 3300049581 | Ga0501047_0121419 | Ga0501047_0121419_1167_1508 | 109 |
| 413 | 3300049581 | Ga0501047_0177613 | Ga0501047_0177613_21_362 | 109 |
| 414 | 3300049581 | Ga0501047_0196535 | Ga0501047_0196535_379_720 | 109 |
| 415 | 3300049581 | Ga0501047_1376910 | Ga0501047_1376910_25_366 | 109 |
| 416 | 3300049582 | Ga0501048_0000269 | Ga0501048_0000269_18156_18497 | 109 |
| 417 | 3300049583 | Ga0501067_0070728 | Ga0501067_0070728_548_889 | 109 |
| 418 | 3300049584 | Ga0501068_0009015 | Ga0501068_0009015_4132_4473 | 109 |
| 419 | 3300049585 | Ga0501069_0009766 | Ga0501069_0009766_755_1096 | 109 |
| 420 | 3300049585 | Ga0501069_0010469 | Ga0501069_0010469_3562_3903 | 109 |
| 421 | 3300049586 | Ga0501070_0000649 | Ga0501070_0000649_16342_16683 | 109 |
| 422 | 3300049586 | Ga0501070_0005184 | Ga0501070_0005184_2820_3161 | 109 |
| 423 | 3300049586 | Ga0501070_0025917 | Ga0501070_0025917_3414_3746 | 109 |
| 424 | 3300049586 | Ga0501070_0073221 | Ga0501070_0073221_859_1200 | 109 |
| 425 | 3300049586 | Ga0501070_0272674 | Ga0501070_0272674_901_1242 | 109 |
| 426 | 3300049587 | Ga0501071_0140445 | Ga0501071_0140445_1166_1507 | 109 |
| 427 | 3300049587 | Ga0501071_0212161 | Ga0501071_0212161_422_763 | 109 |
| 428 | 3300049588 | Ga0501072_0002921 | Ga0501072_0002921_8905_9246 | 109 |
| 429 | 3300049589 | Ga0501073_0001545 | Ga0501073_0001545_11473_11814 | 109 |
| 430 | 3300049590 | Ga0501074_0020000 | Ga0501074_0020000_606_947 | 109 |
| 431 | 3300049590 | Ga0501074_0029244 | Ga0501074_0029244_1655_1996 | 109 |
| 432 | 3300049590 | Ga0501074_0086676 | Ga0501074_0086676_1228_1569 | 109 |
| 433 | 3300049592 | Ga0501076_0038909 | Ga0501076_0038909_512_844 | 109 |
| 434 | 3300049592 | Ga0501076_0640433 | Ga0501076_0640433_526_867 | 109 |
| 435 | 3300049593 | Ga0501077_0903394 | Ga0501077_0903394_35_367 | 109 |
| 436 | 3300049741 | Ga0501079_0012584 | Ga0501079_0012584_613_954 | 109 |
| 437 | 3300049741 | Ga0501079_0123609 | Ga0501079_0123609_1566_1898 | 109 |
| 438 | 3300049741 | Ga0501079_0225971 | Ga0501079_0225971_859_1200 | 109 |
| 439 | 3300049742 | Ga0501080_0004448 | Ga0501080_0004448_6830_7171 | 109 |
| 440 | 3300049742 | Ga0501080_0025778 | Ga0501080_0025778_1141_1482 | 109 |
| 441 | 3300049743 | Ga0501081_0382196 | Ga0501081_0382196_659_991 | 109 |
| 442 | 3300049744 | Ga0501083_0000794 | Ga0501083_0000794_16342_16683 | 109 |
| 443 | 3300049744 | Ga0501083_0025968 | Ga0501083_0025968_960_1301 | 109 |
| 444 | 3300049744 | Ga0501083_0510457 | Ga0501083_0510457_61_414 | 109 |
| 445 | 3300049822 | Ga0501035_0000754 | Ga0501035_0000754_18163_18504 | 109 |
| 446 | 3300049822 | Ga0501035_1150344 | Ga0501035_1150344_137_478 | 109 |
| 447 | 3300049823 | Ga0501044_0000947 | Ga0501044_0000947_18162_18503 | 109 |
| 448 | 3300049823 | Ga0501044_0014304 | Ga0501044_0014304_2982_3323 | 109 |
| 449 | 3300049823 | Ga0501044_0126652 | Ga0501044_0126652_2079_2432 | 109 |
| 450 | 3300049823 | Ga0501044_0822281 | Ga0501044_0822281_333_674 | 109 |
| 451 | 3300049824 | Ga0501045_0028359 | Ga0501045_0028359_2930_3271 | 109 |
| 452 | 3300049824 | Ga0501045_0556455 | Ga0501045_0556455_349_681 | 109 |
| 453 | 3300049824 | Ga0501045_0667490 | Ga0501045_0667490_312_653 | 109 |
| 454 | 3300050509 | nmdc:mga0qj67_68306_c1 | nmdc:mga0qj67_68306_c1_1774_2103 | 109 |
| 455 | 3300050515 | nmdc:mga0a205_19_c2 | nmdc:mga0a205_19_c2_23482_23814 | 109 |
| 456 | 3300053077 | Ga0495601_0001218 | Ga0495601_0001218_11948_12280 | 109 |
| 457 | 3300053077 | Ga0495601_0058448 | Ga0495601_0058448_685_1014 | 109 |
| 458 | 3300053077 | Ga0495601_0116715 | Ga0495601_0116715_17_346 | 109 |
| 459 | 3300053077 | Ga0495601_0140554 | Ga0495601_0140554_145_474 | 109 |
| 460 | 3300053077 | Ga0495601_0151757 | Ga0495601_0151757_615_944 | 109 |
| 461 | 3300053077 | Ga0495601_0229846 | Ga0495601_0229846_485_817 | 109 |
| 462 | 3300053077 | Ga0495601_0248761 | Ga0495601_0248761_643_972 | 109 |
| 463 | 3300053078 | Ga0495612_0001807 | Ga0495612_0001807_8117_8446 | 109 |
| 464 | 3300053078 | Ga0495612_0003434 | Ga0495612_0003434_5265_5600 | 109 |
| 465 | 3300053078 | Ga0495612_0525849 | Ga0495612_0525849_59_388 | 109 |
| 466 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_130163_130492 | 109 |
| 467 | 3300053083 | Ga0495655_0019360 | Ga0495655_0019360_639_968 | 109 |
| 468 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_166237_166566 | 109 |
| 469 | 3300053084 | Ga0495595_0167431 | Ga0495595_0167431_137_469 | 109 |
| 470 | 3300053085 | Ga0495619_0000102 | Ga0495619_0000102_22917_23249 | 109 |
| 471 | 3300053085 | Ga0495619_0000268 | Ga0495619_0000268_21391_21720 | 109 |
| 472 | 3300053085 | Ga0495619_0011332 | Ga0495619_0011332_53_385 | 109 |
| 473 | 3300053085 | Ga0495619_0094497 | Ga0495619_0094497_219_551 | 109 |
| 474 | 3300053085 | Ga0495619_0409924 | Ga0495619_0409924_458_790 | 109 |
| 475 | 3300053094 | Ga0500566_0000683 | Ga0500566_0000683_12758_13087 | 109 |
| 476 | 3300053096 | Ga0500641_0000831 | Ga0500641_0000831_5206_5535 | 109 |
| 477 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_218832_219161 | 109 |
| 478 | 3300054114 | Ga0501084_0212730 | Ga0501084_0212730_94_435 | 109 |
| 479 | 3300060353 | Ga0501082_0002303 | Ga0501082_0002303_140_481 | 109 |
| 480 | 3300061734 | Ga0530510_1103456 | Ga0530510_1103456_69_422 | 109 |
| 481 | 3300025937 | Ga0207669_10068491 | Ga0207669_100684913 | 110 |
| 482 | 3300025945 | Ga0207679_10071973 | Ga0207679_100719735 | 110 |
| 483 | 3300046642 | Ga0495634_0017341 | Ga0495634_0017341_3432_3764 | 110 |
| 484 | 3300001979 | JGI24740J21852_10004506 | JGI24740J21852_100045066 | 112 |
| 485 | 3300046461 | Ga0495641_0086445 | Ga0495641_0086445_487_846 | 112 |
| 486 | 3300046681 | Ga0495647_0001982 | Ga0495647_0001982_3710_4069 | 112 |
| 487 | 3300047321 | Ga0495676_0397158 | Ga0495676_0397158_215_574 | 112 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uw0-assembly1.cif.gz_A | solution structure of the zinc-finger domain from dna ligase iiia | 0.8134 | 29 | 79 |
| 4opx-assembly1.cif.gz_A | structure of human parp-1 bound to a dna double strand break in complex with (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7-carboxamide | 0.7982 | 31 | 79 |
| 3oda-assembly4.cif.gz_G | human parp-1 zinc finger 1 (zn1) bound to dna | 0.7965 | 31 | 78 |
| 7s6h-assembly2.cif.gz_C | human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. | 0.7958 | 31 | 78 |
| 7s6h-assembly1.cif.gz_A | human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. | 0.7958 | 31 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q21275_7_107_3.30.1740.10 | Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type | 0.8595 | 29 | 79 | 3.30.1740.10 |
| af_Q54XI2_1_101_3.30.1740.10 | Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type | 0.8342 | 31 | 74 | 3.30.1740.10 |
| af_Q54E19_1_108_3.30.1740.10 | Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type | 0.8333 | 31 | 77 | 3.30.1740.10 |
| af_P35875_106_207_3.30.1740.10 | Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type | 0.8312 | 31 | 78 | 3.30.1740.10 |
| af_P35875_2_105_3.30.1740.10 | Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type | 0.8279 | 29 | 78 | 3.30.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9X108-F1-model_v4 | Uncharacterized protein | 0.9611 | 11 | 90 |
|
| AF-A0A0F8YC83-F1-model_v4 | PARP-type domain-containing protein | 0.9329 | 29 | 77 |
GO:0003677
GO:0008270 |
| AF-A0A0F9VL24-F1-model_v4 | PARP-type domain-containing protein | 0.9276 | 29 | 77 |
GO:0003677
GO:0008270 |
| AF-A0A7K0A0J8-F1-model_v4 | ATP/GTP-binding protein | 0.9258 | 11 | 83 |
|
| AF-A0A537YMM2-F1-model_v4 | Uncharacterized protein | 0.9215 | 4 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar