F453486

General Info

Members Datasets Scaffolds Average Seq Length
487 236 974 186

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0159910|Ga0453683_0159910_159_719
Length 186
Sequence VPVPNDFTLFSGGAQGAEAEFGKLAEKVGVQEVNFSFEGHKIERSRGLRMLTTEELMRKDVSLTYVSKLLDRNFSNAPHIRMVLRTIMYQVDAGLEVFVIGNILENGTVNGGTGWGAEFAKICNKPLFVFDQVKNGWFTYAHGKWGSVDAPVITKTHFTGTGTRFLEDNGRQAIADLYARSFRAEA

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.29
Rhizosphere 96.51
Stem 0
Stem Tuber 0
Unclassified 19.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0159910 3300044673 Bacteria 1425
2 JGI24751J29686_10021722 3300002459 Unclassified 1331
3 Ga0065714_10098862 3300005288 Unclassified 1700
4 Ga0065714_10259675 3300005288 Unclassified 759
5 Ga0065712_10122628 3300005290 Bacteria 1649
6 Ga0065712_10143744 3300005290 Unclassified 1427
7 Ga0065712_10278247 3300005290 Unclassified 901
8 Ga0065715_10034551 3300005293 Unclassified 1203
9 Ga0065715_10198017 3300005293 Bacteria 1377
10 Ga0065715_10282601 3300005293 Bacteria 1082
11 Ga0065715_10506275 3300005293 Bacteria 775
12 Ga0070676_10118697 3300005328 Bacteria 1657
13 Ga0070683_101062389 3300005329 Bacteria 777
14 Ga0070690_100012400 3300005330 Bacteria 5016
15 Ga0070690_100078084 3300005330 Bacteria 2162
16 Ga0070690_100228631 3300005330 Bacteria 1307
17 Ga0070690_100319186 3300005330 Bacteria 1119
18 Ga0070670_100041620 3300005331 Bacteria 3948
19 Ga0070670_100158890 3300005331 Bacteria 1958
20 Ga0070677_10047234 3300005333 Bacteria 1725
21 Ga0070677_10110130 3300005333 Bacteria 1228
22 Ga0068869_100087983 3300005334 Bacteria 2331
23 Ga0070666_10069000 3300005335 Unclassified 2403
24 Ga0068868_100036415 3300005338 Unclassified 3809
25 Ga0068868_100053088 3300005338 Bacteria 3193
26 Ga0068868_100240102 3300005338 Bacteria 1522
27 Ga0070660_100019487 3300005339 Bacteria 4972
28 Ga0070689_100037337 3300005340 Bacteria 3714
29 Ga0070689_100063281 3300005340 Bacteria 2879
30 Ga0070689_100125434 3300005340 Unclassified 2054
31 Ga0070691_10105045 3300005341 Bacteria 1407
32 Ga0070687_100004226 3300005343 Bacteria 5701
33 Ga0070687_100329138 3300005343 Unclassified 979
34 Ga0070687_100358971 3300005343 Unclassified 943
35 Ga0070668_100112649 3300005347 Bacteria 2166
36 Ga0070668_100113805 3300005347 Bacteria 2156
37 Ga0070668_100516172 3300005347 Unclassified 1036
38 Ga0070669_100011904 3300005353 Bacteria 6173
39 Ga0070669_100015506 3300005353 Bacteria 5432
40 Ga0070669_100018079 3300005353 Bacteria 5035
41 Ga0070669_100161192 3300005353 Bacteria 1743
42 Ga0070669_100206871 3300005353 Bacteria 1546
43 Ga0070675_100008745 3300005354 Bacteria 7865
44 Ga0070675_100041741 3300005354 Unclassified 3747
45 Ga0070675_100182193 3300005354 Bacteria 1816
46 Ga0070675_101022489 3300005354 Bacteria 759
47 Ga0070671_100468664 3300005355 Bacteria 1081
48 Ga0070671_100852576 3300005355 Bacteria 795
49 Ga0070674_100005662 3300005356 Bacteria 7239
50 Ga0070673_100067656 3300005364 Bacteria 2857
51 Ga0070673_100160347 3300005364 Bacteria 1912
52 Ga0070673_100705291 3300005364 Bacteria 927
53 Ga0070688_100135405 3300005365 Bacteria 1667
54 Ga0070688_100230976 3300005365 Bacteria 1309
55 Ga0070688_100273932 3300005365 Bacteria 1210
56 Ga0070688_100418186 3300005365 Bacteria 996
57 Ga0070667_100015693 3300005367 Bacteria 6262
58 Ga0070667_100063387 3300005367 Bacteria 3132
59 Ga0070667_100321571 3300005367 Unclassified 1396
60 Ga0070667_100450428 3300005367 Unclassified 1176
61 Ga0070701_10008910 3300005438 Bacteria 4368
62 Ga0070701_10053173 3300005438 Bacteria 2107
63 Ga0070705_100002429 3300005440 Bacteria 9368
64 Ga0070705_100048387 3300005440 Bacteria 2463
65 Ga0070705_100062378 3300005440 Bacteria 2219
66 Ga0070700_100007620 3300005441 Bacteria 5857
67 Ga0070700_100224943 3300005441 Bacteria 1332
68 Ga0070700_100370757 3300005441 Bacteria 1068
69 Ga0070694_100151606 3300005444 Bacteria 1693
70 Ga0070694_100310484 3300005444 Unclassified 1211
71 Ga0070708_100456417 3300005445 Bacteria 1205
72 Ga0070678_100407292 3300005456 Bacteria 1183
73 Ga0070662_100093777 3300005457 Bacteria 2259
74 Ga0070662_100300145 3300005457 Unclassified 1305
75 Ga0070662_100463947 3300005457 Unclassified 1053
76 Ga0070662_100611700 3300005457 Bacteria 917
77 Ga0070681_10111959 3300005458 Bacteria 2669
78 Ga0070681_11090901 3300005458 Bacteria 719
79 Ga0068867_100198756 3300005459 Bacteria 1604
80 Ga0070685_10060295 3300005466 Bacteria 2218
81 Ga0070685_10189814 3300005466 Unclassified 1328
82 Ga0070706_100796279 3300005467 Bacteria 875
83 Ga0070706_101182758 3300005467 Bacteria 703
84 Ga0070707_100179883 3300005468 Bacteria 2061
85 Ga0070707_100931154 3300005468 Unclassified 834
86 Ga0070698_100167682 3300005471 Bacteria 2137
87 Ga0070698_100299417 3300005471 Bacteria 1539
88 Ga0070698_100401028 3300005471 Bacteria 1305
89 Ga0070699_100018075 3300005518 Bacteria 6056
90 Ga0070699_100075617 3300005518 Bacteria 2931
91 Ga0070699_100272677 3300005518 Unclassified 1515
92 Ga0070699_100313773 3300005518 Bacteria 1408
93 Ga0070679_100015095 3300005530 Bacteria 7423
94 Ga0070679_100048292 3300005530 Bacteria 4241
95 Ga0070697_100038470 3300005536 Bacteria 3865
96 Ga0070672_100033022 3300005543 Bacteria 3915
97 Ga0070672_100117998 3300005543 Unclassified 2169
98 Ga0070686_100006844 3300005544 Bacteria 6348
99 Ga0070686_100110144 3300005544 Bacteria 1874
100 Ga0070686_100143096 3300005544 Bacteria 1667
101 Ga0070695_100152777 3300005545 Unclassified 1613
102 Ga0070695_100356894 3300005545 Bacteria 1097
103 Ga0070695_100397628 3300005545 Unclassified 1044
104 Ga0070696_100060052 3300005546 Bacteria 2658
105 Ga0070696_101177775 3300005546 Unclassified 647
106 Ga0070665_100001839 3300005548 Bacteria 24104
107 Ga0070665_100010350 3300005548 Bacteria 9436
108 Ga0070665_101148411 3300005548 Bacteria 788
109 Ga0068855_101023733 3300005563 Unclassified 867
110 Ga0070664_100099796 3300005564 Bacteria 2523
111 Ga0070664_100350298 3300005564 Bacteria 1343
112 Ga0070702_100107394 3300005615 Bacteria 1723
113 Ga0068864_100042763 3300005618 Bacteria 3877
114 Ga0068866_10087967 3300005718 Bacteria 1685
115 Ga0068861_100013671 3300005719 Bacteria 5685
116 Ga0068861_100056745 3300005719 Bacteria 2990
117 Ga0068861_101370076 3300005719 Bacteria 690
118 Ga0068863_100143320 3300005841 Unclassified 2285
119 Ga0068863_100541332 3300005841 Unclassified 1149
120 Ga0068858_100015561 3300005842 Bacteria 7154
121 Ga0068858_100272526 3300005842 Unclassified 1611
122 Ga0068860_100008327 3300005843 Bacteria 10322
123 Ga0068860_100130817 3300005843 Unclassified 2408
124 Ga0068860_100350833 3300005843 Bacteria 1452
125 Ga0068862_100008018 3300005844 Bacteria 8739
126 Ga0068862_100033768 3300005844 Bacteria 4327
127 Ga0081455_10305422 3300005937 Unclassified 1139
128 Ga0081539_10012935 3300005985 Bacteria 6348
129 Ga0097621_100021402 3300006237 Bacteria 5002
130 Ga0068871_100179123 3300006358 Bacteria 1821
131 Ga0068871_100319513 3300006358 Bacteria 1367
132 Ga0068871_100624450 3300006358 Unclassified 982
133 Ga0075431_100170833 3300006847 Bacteria 2234
134 Ga0075433_10179963 3300006852 Unclassified 1881
135 Ga0075434_100000538 3300006871 Bacteria 28855
136 Ga0075434_100009534 3300006871 Bacteria 9059
137 Ga0075434_100185869 3300006871 Bacteria 2099
138 Ga0075434_100211462 3300006871 Bacteria 1960
139 Ga0075429_100801487 3300006880 Bacteria 825
140 Ga0068865_100007735 3300006881 Bacteria 6625
141 Ga0068865_100475910 3300006881 Bacteria 1037
142 Ga0075436_100008370 3300006914 Bacteria 7075
143 Ga0075436_100258935 3300006914 Unclassified 1240
144 Ga0075435_100000009 3300007076 Bacteria 114381
145 Ga0075435_100001512 3300007076 Bacteria 14953
146 Ga0075435_100069259 3300007076 Bacteria 2876
147 Ga0075435_100208632 3300007076 Unclassified 1656
148 Ga0075435_100214281 3300007076 Bacteria 1634
149 Ga0105240_11384428 3300009093 Unclassified 740
150 Ga0111539_10003337 3300009094 Bacteria 21204
151 Ga0111539_10012163 3300009094 Bacteria 10796
152 Ga0111539_10025066 3300009094 Bacteria 7310
153 Ga0111539_10031900 3300009094 Bacteria 6400
154 Ga0111539_10032308 3300009094 Bacteria 6357
155 Ga0111539_10043109 3300009094 Bacteria 5411
156 Ga0111539_10063954 3300009094 Bacteria 4354
157 Ga0111539_10135440 3300009094 Unclassified 2884
158 Ga0111539_10467391 3300009094 Bacteria 1469
159 Ga0111539_11347680 3300009094 Unclassified 828
160 Ga0105245_10683045 3300009098 Unclassified 1059
161 Ga0114129_10018980 3300009147 Bacteria 9795
162 Ga0114129_10043267 3300009147 Bacteria 6336
163 Ga0114129_10059424 3300009147 Bacteria 5345
164 Ga0114129_10282730 3300009147 Unclassified 2216
165 Ga0114129_10793117 3300009147 Bacteria 1209
166 Ga0105243_10026848 3300009148 Bacteria 4411
167 Ga0105243_10252600 3300009148 Bacteria 1575
168 Ga0105243_10499085 3300009148 Bacteria 1153
169 Ga0105241_10027803 3300009174 Bacteria 4211
170 Ga0105242_10006962 3300009176 Bacteria 8728
171 Ga0105242_10240841 3300009176 Bacteria 1626
172 Ga0105248_10007272 3300009177 Bacteria 12146
173 Ga0105248_10036345 3300009177 Bacteria 5508
174 Ga0105248_10083271 3300009177 Bacteria 3598
175 Ga0105248_10196059 3300009177 Bacteria 2275
176 Ga0105248_10697469 3300009177 Unclassified 1145
177 Ga0105248_11106651 3300009177 Bacteria 895
178 Ga0105248_11549139 3300009177 Bacteria 751
179 Ga0105249_10015744 3300009553 Bacteria 6697
180 Ga0105249_10366464 3300009553 Unclassified 1463
181 Ga0105239_10556081 3300010375 Unclassified 1307
182 Ga0105239_10564475 3300010375 Unclassified 1297
183 Ga0105246_10095509 3300011119 Bacteria 2152
184 Ga0157374_10017231 3300013296 Bacteria 6360
185 Ga0157374_11335140 3300013296 Unclassified 739
186 Ga0157378_11035509 3300013297 Bacteria 856
187 Ga0163162_10051238 3300013306 Bacteria 4141
188 Ga0163162_10079610 3300013306 Unclassified 3343
189 Ga0163162_11115322 3300013306 Bacteria 894
190 Ga0157375_10030362 3300013308 Bacteria 5095
191 Ga0157375_10137184 3300013308 Unclassified 2571
192 Ga0157375_10214228 3300013308 Bacteria 2084
193 Ga0157375_10320620 3300013308 Bacteria 1714
194 Ga0157375_10371605 3300013308 Unclassified 1596
195 Ga0163163_10121883 3300014325 Bacteria 2642
196 Ga0163163_10370145 3300014325 Bacteria 1490
197 Ga0163163_10445761 3300014325 Bacteria 1354
198 Ga0163163_10609933 3300014325 Unclassified 1155
199 Ga0157380_10051254 3300014326 Bacteria 3263
200 Ga0157380_10072138 3300014326 Bacteria 2796
201 Ga0157380_10336031 3300014326 Bacteria 1407
202 Ga0157380_10407814 3300014326 Bacteria 1292
203 Ga0157380_10412008 3300014326 Bacteria 1286
204 Ga0157380_10830942 3300014326 Unclassified 944
205 Ga0157379_10021815 3300014968 Bacteria 5674
206 Ga0157379_10369567 3300014968 Bacteria 1315
207 Ga0157379_10570185 3300014968 Bacteria 1054
208 Ga0157376_10117456 3300014969 Bacteria 2352
209 Ga0163161_10382401 3300017792 Bacteria 1125
210 Ga0206353_10882012 3300020082 Bacteria 1101
211 Ga0207653_10029171 3300025885 Bacteria 1777
212 Ga0207682_10102425 3300025893 Bacteria 1253
213 Ga0207642_10009411 3300025899 Bacteria 3396
214 Ga0207710_10309963 3300025900 Unclassified 799
215 Ga0207680_10003847 3300025903 Bacteria 7071
216 Ga0207680_10013160 3300025903 Bacteria 4240
217 Ga0207680_10213941 3300025903 Bacteria 1319
218 Ga0207645_10026225 3300025907 Bacteria 3766
219 Ga0207684_10200578 3300025910 Bacteria 1721
220 Ga0207684_10743283 3300025910 Bacteria 832
221 Ga0207654_10134739 3300025911 Unclassified 1568
222 Ga0207707_10033546 3300025912 Bacteria 4492
223 Ga0207707_10234929 3300025912 Bacteria 1595
224 Ga0207695_10487317 3300025913 Bacteria 1115
225 Ga0207693_10368942 3300025915 Bacteria 1123
226 Ga0207660_10064728 3300025917 Bacteria 2639
227 Ga0207660_10363590 3300025917 Bacteria 1161
228 Ga0207662_10057659 3300025918 Bacteria 2322
229 Ga0207662_10066444 3300025918 Bacteria 2173
230 Ga0207662_10253611 3300025918 Bacteria 1156
231 Ga0207662_10564635 3300025918 Bacteria 789
232 Ga0207657_10016986 3300025919 Bacteria 7000
233 Ga0207657_10229985 3300025919 Bacteria 1483
234 Ga0207649_10307025 3300025920 Bacteria 1162
235 Ga0207646_10025073 3300025922 Bacteria 5458
236 Ga0207646_10140697 3300025922 Unclassified 2173
237 Ga0207681_10024100 3300025923 Bacteria 3901
238 Ga0207681_10041869 3300025923 Bacteria 3056
239 Ga0207681_10077771 3300025923 Bacteria 2333
240 Ga0207681_10322545 3300025923 Bacteria 1229
241 Ga0207681_10349561 3300025923 Bacteria 1183
242 Ga0207681_10473450 3300025923 Unclassified 1022
243 Ga0207650_10134493 3300025925 Unclassified 1938
244 Ga0207650_10825004 3300025925 Bacteria 786
245 Ga0207659_10010903 3300025926 Bacteria 5724
246 Ga0207700_10346158 3300025928 Bacteria 1293
247 Ga0207664_10110711 3300025929 Bacteria 2283
248 Ga0207644_10785883 3300025931 Bacteria 796
249 Ga0207706_10058818 3300025933 Bacteria 3385
250 Ga0207706_10617833 3300025933 Bacteria 930
251 Ga0207686_10049219 3300025934 Unclassified 2615
252 Ga0207686_10130783 3300025934 Bacteria 1721
253 Ga0207686_10203786 3300025934 Bacteria 1418
254 Ga0207709_10219266 3300025935 Bacteria 1371
255 Ga0207709_10239829 3300025935 Bacteria 1318
256 Ga0207670_10091123 3300025936 Bacteria 2155
257 Ga0207670_10187931 3300025936 Bacteria 1561
258 Ga0207670_10232251 3300025936 Unclassified 1417
259 Ga0207670_10312425 3300025936 Bacteria 1234
260 Ga0207670_10350274 3300025936 Unclassified 1169
261 Ga0207669_10017354 3300025937 Bacteria 3689
262 Ga0207669_10576965 3300025937 Bacteria 911
263 Ga0207669_10982275 3300025937 Bacteria 709
264 Ga0207704_10114440 3300025938 Bacteria 1831
265 Ga0207704_10420422 3300025938 Bacteria 1060
266 Ga0207704_10825458 3300025938 Bacteria 775
267 Ga0207691_10015740 3300025940 Bacteria 7188
268 Ga0207691_10031819 3300025940 Unclassified 4923
269 Ga0207691_10101048 3300025940 Unclassified 2574
270 Ga0207691_10295460 3300025940 Bacteria 1393
271 Ga0207711_10040506 3300025941 Bacteria 3964
272 Ga0207711_10069651 3300025941 Unclassified 3050
273 Ga0207711_10135709 3300025941 Bacteria 2210
274 Ga0207711_10647746 3300025941 Bacteria 986
275 Ga0207711_10799140 3300025941 Unclassified 879
276 Ga0207689_10082405 3300025942 Bacteria 2645
277 Ga0207661_10604483 3300025944 Bacteria 1007
278 Ga0207679_10167553 3300025945 Bacteria 1805
279 Ga0207679_10306068 3300025945 Unclassified 1371
280 Ga0207667_10045266 3300025949 Bacteria 4662
281 Ga0207651_10070476 3300025960 Bacteria 2473
282 Ga0207651_10098273 3300025960 Bacteria 2164
283 Ga0207651_10211620 3300025960 Unclassified 1561
284 Ga0207651_10278663 3300025960 Bacteria 1381
285 Ga0207651_10574570 3300025960 Bacteria 983
286 Ga0207712_10294864 3300025961 Bacteria 1329
287 Ga0207668_10034432 3300025972 Bacteria 3364
288 Ga0207668_10054539 3300025972 Bacteria 2775
289 Ga0207668_11074335 3300025972 Unclassified 721
290 Ga0207658_10466683 3300025986 Unclassified 1120
291 Ga0207658_10489980 3300025986 Unclassified 1093
292 Ga0207658_11055199 3300025986 Bacteria 742
293 Ga0207677_10061756 3300026023 Bacteria 2596
294 Ga0207677_10167652 3300026023 Bacteria 1713
295 Ga0207677_10626555 3300026023 Bacteria 947
296 Ga0207703_10040813 3300026035 Bacteria 3716
297 Ga0207703_10226406 3300026035 Unclassified 1674
298 Ga0207703_10234874 3300026035 Bacteria 1645
299 Ga0207639_10633031 3300026041 Unclassified 988
300 Ga0207708_10008047 3300026075 Bacteria 7816
301 Ga0207708_10517737 3300026075 Bacteria 1002
302 Ga0207641_10279042 3300026088 Unclassified 1571
303 Ga0207641_10559766 3300026088 Bacteria 1116
304 Ga0207641_11599497 3300026088 Bacteria 654
305 Ga0207648_10021705 3300026089 Bacteria 5769
306 Ga0207648_10080886 3300026089 Bacteria 2834
307 Ga0207648_10164862 3300026089 Bacteria 1958
308 Ga0207676_10204139 3300026095 Bacteria 1748
309 Ga0207676_11095003 3300026095 Bacteria 787
310 Ga0207675_100025146 3300026118 Bacteria 5540
311 Ga0207675_100087662 3300026118 Bacteria 2923
312 Ga0207675_100104104 3300026118 Bacteria 2675
313 Ga0207683_10123478 3300026121 Bacteria 2326
314 Ga0207698_10473977 3300026142 Bacteria 1213
315 Ga0207428_10006299 3300027907 Bacteria 10973
316 Ga0207428_10009308 3300027907 Bacteria 8813
317 Ga0207428_10020518 3300027907 Bacteria 5612
318 Ga0207428_10120522 3300027907 Unclassified 2012
319 Ga0207428_10376283 3300027907 Bacteria 1042
320 Ga0207428_10476483 3300027907 Bacteria 908
321 Ga0268266_10044017 3300028379 Bacteria 3815
322 Ga0268266_10692324 3300028379 Bacteria 982
323 Ga0268265_10023826 3300028380 Bacteria 4320
324 Ga0268265_10031116 3300028380 Bacteria 3852
325 Ga0268264_10195833 3300028381 Unclassified 1845
326 Ga0268264_10196882 3300028381 Bacteria 1840
327 Ga0268264_10276355 3300028381 Unclassified 1571
328 Ga0307405_10806388 3300031731 Bacteria 787
329 Ga0307410_10019807 3300031852 Bacteria 4101
330 Ga0307410_10109236 3300031852 Bacteria 1998
331 Ga0307406_10012138 3300031901 Bacteria 4904
332 Ga0307412_10382508 3300031911 Bacteria 1140
333 Ga0307409_100280077 3300031995 Bacteria 1541
334 Ga0307409_100300689 3300031995 Bacteria 1492
335 Ga0307409_101222883 3300031995 Bacteria 775
336 Ga0307416_100203605 3300032002 Bacteria 1880
337 Ga0307416_100688445 3300032002 Bacteria 1110
338 Ga0307415_100131535 3300032126 Bacteria 1895
339 Ga0373930_0014860 3300034816 Unclassified 1456
340 Ga0373948_0000323 3300034817 Bacteria 5791
341 Ga0373950_0003967 3300034818 Bacteria 2150
342 Ga0373958_0007592 3300034819 Bacteria 1734
343 Ga0373958_0057026 3300034819 Bacteria 838
344 Ga0373959_0003859 3300034820 Bacteria 2400
345 Ga0373928_0003040 3300035084 Bacteria 3222
346 Ga0373929_0001873 3300035085 Bacteria 3943
347 Ga0373929_0096013 3300035085 Unclassified 742
348 Ga0373940_0017583 3300035088 Bacteria 1784
349 Ga0373944_0067841 3300035089 Bacteria 1156
350 Ga0373949_0003167 3300035090 Bacteria 4001
351 Ga0373949_0134895 3300035090 Bacteria 703
352 Ga0373952_0164014 3300035092 Unclassified 631
353 Ga0373923_0333832 3300035111 Bacteria 722
354 Ga0373932_0007387 3300035112 Bacteria 2615
355 Ga0373939_0006421 3300035114 Bacteria 2832
356 Ga0373941_0005830 3300035115 Bacteria 2925
357 Ga0373956_0266817 3300035119 Bacteria 814
358 Ga0373960_0001058 3300035121 Bacteria 5932
359 Ga0373943_0221501 3300035170 Bacteria 1054
360 Ga0373942_0011478 3300035207 Bacteria 2101
361 Ga0373961_0000616 3300035241 Bacteria 12991
362 Ga0373962_0000331 3300035242 Bacteria 10348
363 Ga0373924_0023404 3300035410 Bacteria 2423
364 Ga0373924_0037125 3300035410 Unclassified 1982
365 Ga0373931_0119377 3300035691 Bacteria 1505
366 Ga0373947_0453250 3300035725 Bacteria 869
367 Ga0373937_0321407 3300036401 Unclassified 1464
368 Ga0373937_1115388 3300036401 Unclassified 737
369 Ga0373937_1218063 3300036401 Bacteria 701
370 Ga0373925_0672531 3300037068 Unclassified 853
371 Ga0373925_0678121 3300037068 Bacteria 850
372 Ga0451800_0874377 3300041459 Bacteria 795
373 Ga0451853_0966865 3300041512 Bacteria 1712
374 Ga0439446_0143221 3300042156 Bacteria 782
375 Ga0439434_0259149 3300042435 Bacteria 596
376 Ga0451577_0000589 3300042876 Bacteria 58314
377 Ga0451577_0000733 3300042876 Bacteria 50743
378 Ga0451577_0025612 3300042876 Bacteria 5351
379 Ga0451577_0087863 3300042876 Bacteria 2773
380 Ga0453684_0000261 3300044712 Bacteria 226765
381 Ga0453684_0002652 3300044712 Bacteria 42713
382 Ga0453684_0004645 3300044712 Bacteria 28543
383 Ga0453684_0273425 3300044712 Bacteria 1929
384 Ga0453684_0316064 3300044712 Bacteria 1770
385 Ga0451576_0000649 3300045051 Bacteria 71796
386 Ga0451576_0063645 3300045051 Bacteria 3844
387 Ga0495592_0123790 3300046454 Bacteria 1816
388 Ga0495603_0392402 3300046455 Bacteria 795
389 Ga0495629_0615471 3300046459 Bacteria 725
390 Ga0495653_0543302 3300046463 Unclassified 720
391 Ga0495580_0505338 3300046472 Bacteria 807
392 Ga0495582_0168471 3300046473 Bacteria 1247
393 Ga0495664_0401525 3300046477 Unclassified 823
394 Ga0495584_0375820 3300046491 Bacteria 722
395 Ga0495628_0148554 3300046516 Bacteria 1786
396 Ga0495644_0084373 3300046523 Bacteria 1198
397 Ga0495640_0401406 3300046533 Bacteria 842
398 Ga0495586_0123985 3300046535 Bacteria 1444
399 Ga0495621_0002894 3300046539 Bacteria 4677
400 Ga0495621_0075796 3300046539 Bacteria 1247
401 Ga0495645_0395595 3300046543 Unclassified 881
402 Ga0495633_0102827 3300046558 Unclassified 1326
403 Ga0495599_0040375 3300046678 Bacteria 2931
404 Ga0495647_0316415 3300046681 Bacteria 706
405 Ga0495647_0374224 3300046681 Bacteria 651
406 Ga0495658_0024435 3300046683 Bacteria 3219
407 Ga0495658_0402669 3300046683 Bacteria 872
408 Ga0495669_0461866 3300046684 Unclassified 617
409 Ga0495600_0539257 3300046809 Unclassified 714
410 Ga0495636_0037712 3300047318 Bacteria 1996
411 Ga0495674_0644218 3300047319 Unclassified 836
412 Ga0495676_0230984 3300047321 Bacteria 1271
413 Ga0495684_0499797 3300047471 Bacteria 836
414 Ga0495684_0808705 3300047471 Unclassified 612
415 Ga0496104_0606387 3300048907 Bacteria 1005
416 Ga0496104_1420816 3300048907 Bacteria 597
417 Ga0496106_0172121 3300048909 Unclassified 1717
418 Ga0496106_0339215 3300048909 Bacteria 1207
419 Ga0496106_0815685 3300048909 Bacteria 740
420 Ga0496112_0219853 3300048915 Bacteria 1856
421 Ga0496112_0240661 3300048915 Bacteria 1762
422 Ga0496112_0316508 3300048915 Bacteria 1505
423 Ga0496112_0337444 3300048915 Bacteria 1451
424 Ga0496113_0350091 3300048916 Bacteria 1185
425 Ga0496114_0037574 3300048917 Unclassified 4005
426 Ga0496114_0056838 3300048917 Bacteria 3266
427 Ga0496114_0174287 3300048917 Bacteria 1876
428 Ga0496114_0434183 3300048917 Bacteria 1163
429 Ga0496115_0097405 3300048918 Unclassified 2409
430 Ga0501039_0656579 3300049575 Bacteria 821
431 Ga0501040_0161955 3300049576 Bacteria 1582
432 Ga0501040_0425667 3300049576 Bacteria 954
433 Ga0501041_0117832 3300049577 Bacteria 1649
434 Ga0501067_0541488 3300049583 Bacteria 652
435 Ga0501068_0244297 3300049584 Unclassified 1143
436 Ga0501071_0427483 3300049587 Bacteria 1012
437 Ga0501071_0665619 3300049587 Bacteria 801
438 Ga0501073_0002952 3300049589 Bacteria 12754
439 Ga0501073_0550724 3300049589 Bacteria 797
440 Ga0501075_0092840 3300049591 Bacteria 2291
441 Ga0501075_0312770 3300049591 Bacteria 1197
442 Ga0501075_0883197 3300049591 Bacteria 680
443 Ga0501076_1102024 3300049592 Unclassified 654
444 Ga0501077_0164112 3300049593 Bacteria 1411
445 Ga0501079_0261033 3300049741 Bacteria 1354
446 Ga0501035_1016863 3300049822 Bacteria 651
447 Ga0501045_0434802 3300049824 Bacteria 976
448 nmdc:mga05p37_171236_c2 3300050507 Bacteria 1423
449 nmdc:mga05p37_185908_c1 3300050507 Bacteria 2526
450 nmdc:mga05p37_39643_c1 3300050507 Bacteria 5784
451 nmdc:mga05p37_4516_c1 3300050507 Bacteria 16267
452 nmdc:mga05p37_460421_c1 3300050507 Bacteria 1470
453 nmdc:mga05p37_66676_c1 3300050507 Bacteria 4427
454 nmdc:mga09592_973477_c1 3300050508 Bacteria 710
455 nmdc:mga06r32_50603_c1 3300050510 Bacteria 3974
456 nmdc:mga08y16_103011_c1 3300050511 Bacteria 2972
457 nmdc:mga08y16_127454_c1 3300050511 Bacteria 2647
458 nmdc:mga08y16_1461_c1 3300050511 Bacteria 23685
459 nmdc:mga08y16_18114_c1 3300050511 Bacteria 7419
460 nmdc:mga08y16_267584_c1 3300050511 Bacteria 1765
461 nmdc:mga08y16_364129_c1 3300050511 Unclassified 1484
462 nmdc:mga08y16_528439_c1 3300050511 Bacteria 1196
463 nmdc:mga08y16_57101_c1 3300050511 Bacteria 4080
464 nmdc:mga08y16_626090_c1 3300050511 Bacteria 1082
465 nmdc:mga08y16_7192_c1 3300050511 Bacteria 11681
466 nmdc:mga0n895_23854_c1 3300050512 Bacteria 5757
467 nmdc:mga0n895_301645_c1 3300050512 Bacteria 1624
468 nmdc:mga0n895_31223_c1 3300050512 Bacteria 5098
469 nmdc:mga0n895_331289_c1 3300050512 Bacteria 1542
470 nmdc:mga0n895_545281_c1 3300050512 Bacteria 1166
471 nmdc:mga0n895_59652_c1 3300050512 Bacteria 3764
472 nmdc:mga0n895_67_c1 3300050512 Bacteria 61603
473 nmdc:mga0rr50_25_c1 3300050513 Bacteria 114931
474 nmdc:mga0rr50_317937_c1 3300050513 Bacteria 1305
475 nmdc:mga08x19_213_c1 3300050514 Bacteria 44077
476 nmdc:mga08x19_246507_c1 3300050514 Bacteria 1233
477 nmdc:mga08x19_97540_c1 3300050514 Bacteria 1946
478 nmdc:mga0a205_181090_c1 3300050515 Bacteria 2001
479 nmdc:mga0a205_186139_c2 3300050515 Bacteria 1526
480 nmdc:mga0a205_430442_c1 3300050515 Bacteria 1181
481 nmdc:mga0a205_482815_c1 3300050515 Bacteria 1097
482 nmdc:mga0a205_81922_c1 3300050515 Bacteria 3117
483 Ga0495601_0591422 3300053077 Bacteria 712
484 Ga0495619_0794501 3300053085 Bacteria 640
485 Ga0501084_1169031 3300054114 Unclassified 646
486 Ga0530510_1099316 3300061734 Bacteria 609
487 2524001537 2523533628 Bacteria 4098242
488 Ga0453683_0159910
489 JGI24751J29686_10021722
490 Ga0065714_10098862
491 Ga0065714_10259675
492 Ga0065712_10122628
493 Ga0065712_10143744
494 Ga0065712_10278247
495 Ga0065715_10034551
496 Ga0065715_10198017
497 Ga0065715_10282601
498 Ga0065715_10506275
499 Ga0070676_10118697
500 Ga0070683_101062389
501 Ga0070690_100012400
502 Ga0070690_100078084
503 Ga0070690_100228631
504 Ga0070690_100319186
505 Ga0070670_100041620
506 Ga0070670_100158890
507 Ga0070677_10047234
508 Ga0070677_10110130
509 Ga0068869_100087983
510 Ga0070666_10069000
511 Ga0068868_100036415
512 Ga0068868_100053088
513 Ga0068868_100240102
514 Ga0070660_100019487
515 Ga0070689_100037337
516 Ga0070689_100063281
517 Ga0070689_100125434
518 Ga0070691_10105045
519 Ga0070687_100004226
520 Ga0070687_100329138
521 Ga0070687_100358971
522 Ga0070668_100112649
523 Ga0070668_100113805
524 Ga0070668_100516172
525 Ga0070669_100011904
526 Ga0070669_100015506
527 Ga0070669_100018079
528 Ga0070669_100161192
529 Ga0070669_100206871
530 Ga0070675_100008745
531 Ga0070675_100041741
532 Ga0070675_100182193
533 Ga0070675_101022489
534 Ga0070671_100468664
535 Ga0070671_100852576
536 Ga0070674_100005662
537 Ga0070673_100067656
538 Ga0070673_100160347
539 Ga0070673_100705291
540 Ga0070688_100135405
541 Ga0070688_100230976
542 Ga0070688_100273932
543 Ga0070688_100418186
544 Ga0070667_100015693
545 Ga0070667_100063387
546 Ga0070667_100321571
547 Ga0070667_100450428
548 Ga0070701_10008910
549 Ga0070701_10053173
550 Ga0070705_100002429
551 Ga0070705_100048387
552 Ga0070705_100062378
553 Ga0070700_100007620
554 Ga0070700_100224943
555 Ga0070700_100370757
556 Ga0070694_100151606
557 Ga0070694_100310484
558 Ga0070708_100456417
559 Ga0070678_100407292
560 Ga0070662_100093777
561 Ga0070662_100300145
562 Ga0070662_100463947
563 Ga0070662_100611700
564 Ga0070681_10111959
565 Ga0070681_11090901
566 Ga0068867_100198756
567 Ga0070685_10060295
568 Ga0070685_10189814
569 Ga0070706_100796279
570 Ga0070706_101182758
571 Ga0070707_100179883
572 Ga0070707_100931154
573 Ga0070698_100167682
574 Ga0070698_100299417
575 Ga0070698_100401028
576 Ga0070699_100018075
577 Ga0070699_100075617
578 Ga0070699_100272677
579 Ga0070699_100313773
580 Ga0070679_100015095
581 Ga0070679_100048292
582 Ga0070697_100038470
583 Ga0070672_100033022
584 Ga0070672_100117998
585 Ga0070686_100006844
586 Ga0070686_100110144
587 Ga0070686_100143096
588 Ga0070695_100152777
589 Ga0070695_100356894
590 Ga0070695_100397628
591 Ga0070696_100060052
592 Ga0070696_101177775
593 Ga0070665_100001839
594 Ga0070665_100010350
595 Ga0070665_101148411
596 Ga0068855_101023733
597 Ga0070664_100099796
598 Ga0070664_100350298
599 Ga0070702_100107394
600 Ga0068864_100042763
601 Ga0068866_10087967
602 Ga0068861_100013671
603 Ga0068861_100056745
604 Ga0068861_101370076
605 Ga0068863_100143320
606 Ga0068863_100541332
607 Ga0068858_100015561
608 Ga0068858_100272526
609 Ga0068860_100008327
610 Ga0068860_100130817
611 Ga0068860_100350833
612 Ga0068862_100008018
613 Ga0068862_100033768
614 Ga0081455_10305422
615 Ga0081539_10012935
616 Ga0097621_100021402
617 Ga0068871_100179123
618 Ga0068871_100319513
619 Ga0068871_100624450
620 Ga0075431_100170833
621 Ga0075433_10179963
622 Ga0075434_100000538
623 Ga0075434_100009534
624 Ga0075434_100185869
625 Ga0075434_100211462
626 Ga0075429_100801487
627 Ga0068865_100007735
628 Ga0068865_100475910
629 Ga0075436_100008370
630 Ga0075436_100258935
631 Ga0075435_100000009
632 Ga0075435_100001512
633 Ga0075435_100069259
634 Ga0075435_100208632
635 Ga0075435_100214281
636 Ga0105240_11384428
637 Ga0111539_10003337
638 Ga0111539_10012163
639 Ga0111539_10025066
640 Ga0111539_10031900
641 Ga0111539_10032308
642 Ga0111539_10043109
643 Ga0111539_10063954
644 Ga0111539_10135440
645 Ga0111539_10467391
646 Ga0111539_11347680
647 Ga0105245_10683045
648 Ga0114129_10018980
649 Ga0114129_10043267
650 Ga0114129_10059424
651 Ga0114129_10282730
652 Ga0114129_10793117
653 Ga0105243_10026848
654 Ga0105243_10252600
655 Ga0105243_10499085
656 Ga0105241_10027803
657 Ga0105242_10006962
658 Ga0105242_10240841
659 Ga0105248_10007272
660 Ga0105248_10036345
661 Ga0105248_10083271
662 Ga0105248_10196059
663 Ga0105248_10697469
664 Ga0105248_11106651
665 Ga0105248_11549139
666 Ga0105249_10015744
667 Ga0105249_10366464
668 Ga0105239_10556081
669 Ga0105239_10564475
670 Ga0105246_10095509
671 Ga0157374_10017231
672 Ga0157374_11335140
673 Ga0157378_11035509
674 Ga0163162_10051238
675 Ga0163162_10079610
676 Ga0163162_11115322
677 Ga0157375_10030362
678 Ga0157375_10137184
679 Ga0157375_10214228
680 Ga0157375_10320620
681 Ga0157375_10371605
682 Ga0163163_10121883
683 Ga0163163_10370145
684 Ga0163163_10445761
685 Ga0163163_10609933
686 Ga0157380_10051254
687 Ga0157380_10072138
688 Ga0157380_10336031
689 Ga0157380_10407814
690 Ga0157380_10412008
691 Ga0157380_10830942
692 Ga0157379_10021815
693 Ga0157379_10369567
694 Ga0157379_10570185
695 Ga0157376_10117456
696 Ga0163161_10382401
697 Ga0206353_10882012
698 Ga0207653_10029171
699 Ga0207682_10102425
700 Ga0207642_10009411
701 Ga0207710_10309963
702 Ga0207680_10003847
703 Ga0207680_10013160
704 Ga0207680_10213941
705 Ga0207645_10026225
706 Ga0207684_10200578
707 Ga0207684_10743283
708 Ga0207654_10134739
709 Ga0207707_10033546
710 Ga0207707_10234929
711 Ga0207695_10487317
712 Ga0207693_10368942
713 Ga0207660_10064728
714 Ga0207660_10363590
715 Ga0207662_10057659
716 Ga0207662_10066444
717 Ga0207662_10253611
718 Ga0207662_10564635
719 Ga0207657_10016986
720 Ga0207657_10229985
721 Ga0207649_10307025
722 Ga0207646_10025073
723 Ga0207646_10140697
724 Ga0207681_10024100
725 Ga0207681_10041869
726 Ga0207681_10077771
727 Ga0207681_10322545
728 Ga0207681_10349561
729 Ga0207681_10473450
730 Ga0207650_10134493
731 Ga0207650_10825004
732 Ga0207659_10010903
733 Ga0207700_10346158
734 Ga0207664_10110711
735 Ga0207644_10785883
736 Ga0207706_10058818
737 Ga0207706_10617833
738 Ga0207686_10049219
739 Ga0207686_10130783
740 Ga0207686_10203786
741 Ga0207709_10219266
742 Ga0207709_10239829
743 Ga0207670_10091123
744 Ga0207670_10187931
745 Ga0207670_10232251
746 Ga0207670_10312425
747 Ga0207670_10350274
748 Ga0207669_10017354
749 Ga0207669_10576965
750 Ga0207669_10982275
751 Ga0207704_10114440
752 Ga0207704_10420422
753 Ga0207704_10825458
754 Ga0207691_10015740
755 Ga0207691_10031819
756 Ga0207691_10101048
757 Ga0207691_10295460
758 Ga0207711_10040506
759 Ga0207711_10069651
760 Ga0207711_10135709
761 Ga0207711_10647746
762 Ga0207711_10799140
763 Ga0207689_10082405
764 Ga0207661_10604483
765 Ga0207679_10167553
766 Ga0207679_10306068
767 Ga0207667_10045266
768 Ga0207651_10070476
769 Ga0207651_10098273
770 Ga0207651_10211620
771 Ga0207651_10278663
772 Ga0207651_10574570
773 Ga0207712_10294864
774 Ga0207668_10034432
775 Ga0207668_10054539
776 Ga0207668_11074335
777 Ga0207658_10466683
778 Ga0207658_10489980
779 Ga0207658_11055199
780 Ga0207677_10061756
781 Ga0207677_10167652
782 Ga0207677_10626555
783 Ga0207703_10040813
784 Ga0207703_10226406
785 Ga0207703_10234874
786 Ga0207639_10633031
787 Ga0207708_10008047
788 Ga0207708_10517737
789 Ga0207641_10279042
790 Ga0207641_10559766
791 Ga0207641_11599497
792 Ga0207648_10021705
793 Ga0207648_10080886
794 Ga0207648_10164862
795 Ga0207676_10204139
796 Ga0207676_11095003
797 Ga0207675_100025146
798 Ga0207675_100087662
799 Ga0207675_100104104
800 Ga0207683_10123478
801 Ga0207698_10473977
802 Ga0207428_10006299
803 Ga0207428_10009308
804 Ga0207428_10020518
805 Ga0207428_10120522
806 Ga0207428_10376283
807 Ga0207428_10476483
808 Ga0268266_10044017
809 Ga0268266_10692324
810 Ga0268265_10023826
811 Ga0268265_10031116
812 Ga0268264_10195833
813 Ga0268264_10196882
814 Ga0268264_10276355
815 Ga0307405_10806388
816 Ga0307410_10019807
817 Ga0307410_10109236
818 Ga0307406_10012138
819 Ga0307412_10382508
820 Ga0307409_100280077
821 Ga0307409_100300689
822 Ga0307409_101222883
823 Ga0307416_100203605
824 Ga0307416_100688445
825 Ga0307415_100131535
826 Ga0373930_0014860
827 Ga0373948_0000323
828 Ga0373950_0003967
829 Ga0373958_0007592
830 Ga0373958_0057026
831 Ga0373959_0003859
832 Ga0373928_0003040
833 Ga0373929_0001873
834 Ga0373929_0096013
835 Ga0373940_0017583
836 Ga0373944_0067841
837 Ga0373949_0003167
838 Ga0373949_0134895
839 Ga0373952_0164014
840 Ga0373923_0333832
841 Ga0373932_0007387
842 Ga0373939_0006421
843 Ga0373941_0005830
844 Ga0373956_0266817
845 Ga0373960_0001058
846 Ga0373943_0221501
847 Ga0373942_0011478
848 Ga0373961_0000616
849 Ga0373962_0000331
850 Ga0373924_0023404
851 Ga0373924_0037125
852 Ga0373931_0119377
853 Ga0373947_0453250
854 Ga0373937_0321407
855 Ga0373937_1115388
856 Ga0373937_1218063
857 Ga0373925_0672531
858 Ga0373925_0678121
859 Ga0451800_0874377
860 Ga0451853_0966865
861 Ga0439446_0143221
862 Ga0439434_0259149
863 Ga0451577_0000589
864 Ga0451577_0000733
865 Ga0451577_0025612
866 Ga0451577_0087863
867 Ga0453684_0000261
868 Ga0453684_0002652
869 Ga0453684_0004645
870 Ga0453684_0273425
871 Ga0453684_0316064
872 Ga0451576_0000649
873 Ga0451576_0063645
874 Ga0495592_0123790
875 Ga0495603_0392402
876 Ga0495629_0615471
877 Ga0495653_0543302
878 Ga0495580_0505338
879 Ga0495582_0168471
880 Ga0495664_0401525
881 Ga0495584_0375820
882 Ga0495628_0148554
883 Ga0495644_0084373
884 Ga0495640_0401406
885 Ga0495586_0123985
886 Ga0495621_0002894
887 Ga0495621_0075796
888 Ga0495645_0395595
889 Ga0495633_0102827
890 Ga0495599_0040375
891 Ga0495647_0316415
892 Ga0495647_0374224
893 Ga0495658_0024435
894 Ga0495658_0402669
895 Ga0495669_0461866
896 Ga0495600_0539257
897 Ga0495636_0037712
898 Ga0495674_0644218
899 Ga0495676_0230984
900 Ga0495684_0499797
901 Ga0495684_0808705
902 Ga0496104_0606387
903 Ga0496104_1420816
904 Ga0496106_0172121
905 Ga0496106_0339215
906 Ga0496106_0815685
907 Ga0496112_0219853
908 Ga0496112_0240661
909 Ga0496112_0316508
910 Ga0496112_0337444
911 Ga0496113_0350091
912 Ga0496114_0037574
913 Ga0496114_0056838
914 Ga0496114_0174287
915 Ga0496114_0434183
916 Ga0496115_0097405
917 Ga0501039_0656579
918 Ga0501040_0161955
919 Ga0501040_0425667
920 Ga0501041_0117832
921 Ga0501067_0541488
922 Ga0501068_0244297
923 Ga0501071_0427483
924 Ga0501071_0665619
925 Ga0501073_0002952
926 Ga0501073_0550724
927 Ga0501075_0092840
928 Ga0501075_0312770
929 Ga0501075_0883197
930 Ga0501076_1102024
931 Ga0501077_0164112
932 Ga0501079_0261033
933 Ga0501035_1016863
934 Ga0501045_0434802
935 nmdc:mga05p37_171236_c2
936 nmdc:mga05p37_185908_c1
937 nmdc:mga05p37_39643_c1
938 nmdc:mga05p37_4516_c1
939 nmdc:mga05p37_460421_c1
940 nmdc:mga05p37_66676_c1
941 nmdc:mga09592_973477_c1
942 nmdc:mga06r32_50603_c1
943 nmdc:mga08y16_103011_c1
944 nmdc:mga08y16_127454_c1
945 nmdc:mga08y16_1461_c1
946 nmdc:mga08y16_18114_c1
947 nmdc:mga08y16_267584_c1
948 nmdc:mga08y16_364129_c1
949 nmdc:mga08y16_528439_c1
950 nmdc:mga08y16_57101_c1
951 nmdc:mga08y16_626090_c1
952 nmdc:mga08y16_7192_c1
953 nmdc:mga0n895_23854_c1
954 nmdc:mga0n895_301645_c1
955 nmdc:mga0n895_31223_c1
956 nmdc:mga0n895_331289_c1
957 nmdc:mga0n895_545281_c1
958 nmdc:mga0n895_59652_c1
959 nmdc:mga0n895_67_c1
960 nmdc:mga0rr50_25_c1
961 nmdc:mga0rr50_317937_c1
962 nmdc:mga08x19_213_c1
963 nmdc:mga08x19_246507_c1
964 nmdc:mga08x19_97540_c1
965 nmdc:mga0a205_181090_c1
966 nmdc:mga0a205_186139_c2
967 nmdc:mga0a205_430442_c1
968 nmdc:mga0a205_482815_c1
969 nmdc:mga0a205_81922_c1
970 Ga0495601_0591422
971 Ga0495619_0794501
972 Ga0501084_1169031
973 Ga0530510_1099316
974 2524001537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bnc-assembly1.cif.gz_B three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase 0.7831 6 37
2qf7-assembly1.cif.gz_B-2 crystal structure of a complete multifunctional pyruvate carboxylase from rhizobium etli 0.7794 6 37
8sy8-assembly1.cif.gz_B-2 crystal structure of tsac 0.775 6 35
5bt9-assembly5.cif.gz_D crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.7742 1 38
3tw6-assembly2.cif.gz_D-3 structure of rhizobium etli pyruvate carboxylase t882a with the allosteric activator, acetyl coenzyme-a 0.7718 6 37
ID Description Score Start End Superfamily
af_P71538_1_451_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.789 6 37 3.30.470.20
af_Q58626_1_449_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7495 6 37 3.30.470.20
4ituD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7233 6 35 3.40.50.720
af_C0M4B0_278_410_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.6859 126 153 2.110.10.10
3imkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6683 1 133 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A7C7H3D2-F1-model_v4 Uncharacterized protein 0.9844 114 185
AF-A0A2V8LU73-F1-model_v4 Uncharacterized protein 0.9796 1 184
AF-A0A2H5ZJG4-F1-model_v4 Uncharacterized protein 0.9779 1 185
AF-A0A2N2HDY7-F1-model_v4 Uncharacterized protein 0.9778 1 185
AF-A0A1F2UCX6-F1-model_v4 Uncharacterized protein 0.9777 1 184

Map