F453418

General Info

Members Datasets Scaffolds Average Seq Length
487 183 486 314

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100006646|Ga0068863_1000066467
Length 344
Sequence LIRKGYRKLDQLTFEQPAISPDAAKFSMAINLLNLKSIKMRSGNSFKIFILPFVCFLFHSSVNAQLDTTAIEKITGIKGKSNNGEYKITVPQNDLNIEVDGFKIIPAMGLGTWIAFTPTKDGAMIMGDIILTETDLKPVQQEVIKQGLTITAIHNHFVRNHPNVVYMHIGGSGKNDMMAQKAKAVLDKVKEVRGGDPSKGTASSEPVTNTLDTKKLDEVLGYKAEMTKGVYKYTIGRPDVSLKEHGTTITTFFGFNTWAAFQGTPDHAAVAGDFTMLEDEVAPVIKALVENGIEVVAVHNHMVHEQPRIFFLHYWGVGNAEQLAKGLKAALNETGKNKSNKMKM

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
156 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
162 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
163 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
164 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
165 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
166 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
167 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
168 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
169 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
172 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
176 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
177 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
178 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
179 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.62
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c004130 3300000044 Unclassified 1237
2 rootH1_10090526 3300003316 Bacteria 1479
3 rootL2_10211758 3300003322 Unclassified 3237
4 rootL2_10292120 3300003322 Bacteria 3177
5 rootH1_10006023 3300003323 Bacteria 26459
6 rootH1_10329690 3300003323 Bacteria 2644
7 Ga0055530_10006610 3300003791 Bacteria 5130
8 Ga0065712_10002588 3300005290 Bacteria 4696
9 Ga0065712_10003083 3300005290 Bacteria 3954
10 Ga0065712_10019474 3300005290 Bacteria 1904
11 Ga0065712_10087397 3300005290 Bacteria 2580
12 Ga0065715_10092691 3300005293 Bacteria 4986
13 Ga0065715_10097288 3300005293 Bacteria 3730
14 Ga0065707_10206805 3300005295 Bacteria 1277
15 Ga0070658_10013164 3300005327 Bacteria 6635
16 Ga0070658_10329131 3300005327 Bacteria 1305
17 Ga0070676_10002132 3300005328 Bacteria 10078
18 Ga0070676_10007967 3300005328 Bacteria 5697
19 Ga0070676_10028672 3300005328 Bacteria 3162
20 Ga0070683_100015091 3300005329 Bacteria 6779
21 Ga0070683_100062028 3300005329 Bacteria 3476
22 Ga0070683_100105465 3300005329 Unclassified 2657
23 Ga0070683_100150033 3300005329 Bacteria 2210
24 Ga0070670_100073221 3300005331 Unclassified 2943
25 Ga0070670_100092550 3300005331 Bacteria 2600
26 Ga0070670_100137964 3300005331 Bacteria 2108
27 Ga0070670_100155241 3300005331 Unclassified 1982
28 Ga0070670_100171679 3300005331 Bacteria 1881
29 Ga0068869_100007645 3300005334 Bacteria 6921
30 Ga0068869_100014641 3300005334 Bacteria 5244
31 Ga0068869_100067335 3300005334 Bacteria 2642
32 Ga0068869_100139056 3300005334 Bacteria 1873
33 Ga0068869_100201209 3300005334 Bacteria 1570
34 Ga0070666_10011049 3300005335 Bacteria 5659
35 Ga0070666_10082293 3300005335 Bacteria 2202
36 Ga0070682_100130316 3300005337 Bacteria 1701
37 Ga0068868_100002758 3300005338 Bacteria 12165
38 Ga0068868_100026832 3300005338 Bacteria 4392
39 Ga0068868_100072151 3300005338 Bacteria 2754
40 Ga0068868_100131932 3300005338 Bacteria 2045
41 Ga0068868_100185400 3300005338 Bacteria 1728
42 Ga0068868_100264656 3300005338 Bacteria 1451
43 Ga0070689_100014340 3300005340 Bacteria 5755
44 Ga0070689_100015977 3300005340 Bacteria 5487
45 Ga0070689_100023299 3300005340 Bacteria 4634
46 Ga0070689_100065476 3300005340 Unclassified 2830
47 Ga0070689_100137161 3300005340 Bacteria 1965
48 Ga0070661_100017277 3300005344 Bacteria 5116
49 Ga0070668_100018730 3300005347 Bacteria 5199
50 Ga0070668_100132583 3300005347 Bacteria 2001
51 Ga0070668_100261508 3300005347 Bacteria 1439
52 Ga0070669_100006284 3300005353 Bacteria 8566
53 Ga0070675_100003096 3300005354 Bacteria 12570
54 Ga0070675_100031117 3300005354 Bacteria 4312
55 Ga0070675_100032353 3300005354 Bacteria 4233
56 Ga0070675_100064227 3300005354 Bacteria 3035
57 Ga0070675_100122025 3300005354 Bacteria 2214
58 Ga0070675_100388646 3300005354 Bacteria 1243
59 Ga0070671_100029256 3300005355 Bacteria 4542
60 Ga0070671_100152748 3300005355 Bacteria 1950
61 Ga0070674_100033110 3300005356 Bacteria 3438
62 Ga0070674_100177509 3300005356 Unclassified 1628
63 Ga0070673_100004586 3300005364 Bacteria 8761
64 Ga0070673_100008358 3300005364 Bacteria 6879
65 Ga0070673_100034994 3300005364 Bacteria 3806
66 Ga0070673_100037321 3300005364 Bacteria 3701
67 Ga0070673_100048310 3300005364 Bacteria 3317
68 Ga0070673_100096402 3300005364 Bacteria 2427
69 Ga0070673_100122160 3300005364 Bacteria 2174
70 Ga0070688_100009883 3300005365 Bacteria 5242
71 Ga0070688_100033057 3300005365 Bacteria 3124
72 Ga0070688_100074132 3300005365 Bacteria 2185
73 Ga0070688_100164748 3300005365 Unclassified 1525
74 Ga0070659_100007872 3300005366 Bacteria 7760
75 Ga0070659_100031035 3300005366 Bacteria 4137
76 Ga0070667_100049538 3300005367 Bacteria 3538
77 Ga0070667_100137383 3300005367 Bacteria 2138
78 Ga0070667_100150645 3300005367 Bacteria 2043
79 Ga0070667_100252746 3300005367 Bacteria 1576
80 Ga0070663_100221652 3300005455 Bacteria 1485
81 Ga0070678_100004411 3300005456 Bacteria 7976
82 Ga0070678_100273060 3300005456 Bacteria 1427
83 Ga0070662_100005282 3300005457 Bacteria 8244
84 Ga0070662_100104698 3300005457 Bacteria 2147
85 Ga0070662_100258676 3300005457 Bacteria 1402
86 Ga0068867_100009802 3300005459 Bacteria 6750
87 Ga0068867_100027537 3300005459 Bacteria 4086
88 Ga0068867_100157156 3300005459 Bacteria 1791
89 Ga0068867_100271325 3300005459 Unclassified 1387
90 Ga0070685_10019343 3300005466 Bacteria 3673
91 Ga0070685_10032744 3300005466 Bacteria 2914
92 Ga0070685_10043055 3300005466 Bacteria 2580
93 Ga0070698_100001455 3300005471 Bacteria 26296
94 Ga0070698_100010680 3300005471 Bacteria 9784
95 Ga0070698_100016635 3300005471 Bacteria 7762
96 Ga0070698_100452619 3300005471 Bacteria 1219
97 Ga0070699_100050490 3300005518 Bacteria 3601
98 Ga0070684_100000282 3300005535 Bacteria 35284
99 Ga0070684_100054259 3300005535 Unclassified 3492
100 Ga0070684_100251525 3300005535 Unclassified 1615
101 Ga0068853_100000774 3300005539 Bacteria 22183
102 Ga0068853_100041972 3300005539 Bacteria 3909
103 Ga0068853_100135899 3300005539 Bacteria 2204
104 Ga0068853_100215672 3300005539 Bacteria 1751
105 Ga0070672_100003214 3300005543 Bacteria 10576
106 Ga0070672_100007653 3300005543 Bacteria 7350
107 Ga0070672_100022422 3300005543 Bacteria 4639
108 Ga0070672_100074813 3300005543 Bacteria 2703
109 Ga0070672_100128096 3300005543 Bacteria 2084
110 Ga0070672_100331488 3300005543 Bacteria 1295
111 Ga0070686_100143970 3300005544 Bacteria 1662
112 Ga0068855_100196612 3300005563 Bacteria 2272
113 Ga0068855_100269445 3300005563 Bacteria 1894
114 Ga0070664_100003521 3300005564 Bacteria 12644
115 Ga0070664_100030254 3300005564 Bacteria 4517
116 Ga0070664_100093945 3300005564 Bacteria 2600
117 Ga0070664_100135677 3300005564 Bacteria 2164
118 Ga0070664_100265115 3300005564 Bacteria 1546
119 Ga0070664_100319044 3300005564 Bacteria 1407
120 Ga0070664_100516473 3300005564 Viruses 1102
121 Ga0068857_100001911 3300005577 Bacteria 16786
122 Ga0068857_100017073 3300005577 Bacteria 6358
123 Ga0068857_100018261 3300005577 Bacteria 6152
124 Ga0068854_100277278 3300005578 Bacteria 1348
125 Ga0068852_100023983 3300005616 Unclassified 4922
126 Ga0068859_100000063 3300005617 Bacteria 106123
127 Ga0068859_100027384 3300005617 Bacteria 5717
128 Ga0068859_100033843 3300005617 Bacteria 5130
129 Ga0068859_100038487 3300005617 Bacteria 4799
130 Ga0068859_100067790 3300005617 Bacteria 3603
131 Ga0068859_100110649 3300005617 Bacteria 2808
132 Ga0068859_100831876 3300005617 Bacteria 1010
133 Ga0068864_100014506 3300005618 Bacteria 6545
134 Ga0068864_100036579 3300005618 Bacteria 4185
135 Ga0068864_100072672 3300005618 Bacteria 2998
136 Ga0068864_100126623 3300005618 Bacteria 2290
137 Ga0068864_100350172 3300005618 Bacteria 1393
138 Ga0068861_100020375 3300005719 Bacteria 4750
139 Ga0068861_100025112 3300005719 Bacteria 4317
140 Ga0068861_100054532 3300005719 Bacteria 3046
141 Ga0068861_100056541 3300005719 Bacteria 2995
142 Ga0068870_10017874 3300005840 Bacteria 3412
143 Ga0068870_10039812 3300005840 Bacteria 2434
144 Ga0068870_10076498 3300005840 Bacteria 1838
145 Ga0068870_10208757 3300005840 Bacteria 1188
146 Ga0068863_100006646 3300005841 Bacteria 11352
147 Ga0068863_100011608 3300005841 Bacteria 8523
148 Ga0068863_100062318 3300005841 Bacteria 3527
149 Ga0068863_100210700 3300005841 Bacteria 1871
150 Ga0068863_100426141 3300005841 Unclassified 1300
151 Ga0068863_100465334 3300005841 Bacteria 1242
152 Ga0068858_100006614 3300005842 Bacteria 11278
153 Ga0068858_100049209 3300005842 Bacteria 3904
154 Ga0068858_100141839 3300005842 Bacteria 2256
155 Ga0068858_100443846 3300005842 Bacteria 1250
156 Ga0068860_100002526 3300005843 Bacteria 19183
157 Ga0068860_100013144 3300005843 Bacteria 8124
158 Ga0068860_100015121 3300005843 Bacteria 7542
159 Ga0068860_100021364 3300005843 Bacteria 6267
160 Ga0068860_100167233 3300005843 Bacteria 2123
161 Ga0068860_100198724 3300005843 Bacteria 1942
162 Ga0068862_100010083 3300005844 Bacteria 7799
163 Ga0068862_100014984 3300005844 Bacteria 6438
164 Ga0081539_10020758 3300005985 Unclassified 4422
165 Ga0097621_100000278 3300006237 Bacteria 34561
166 Ga0068871_100000825 3300006358 Bacteria 20742
167 Ga0068871_100012267 3300006358 Bacteria 6312
168 Ga0068871_100046871 3300006358 Bacteria 3483
169 Ga0068871_100121934 3300006358 Bacteria 2203
170 Ga0068871_100159361 3300006358 Bacteria 1929
171 Ga0068871_100206068 3300006358 Unclassified 1699
172 Ga0075428_100160975 3300006844 Bacteria 2436
173 Ga0075431_100052698 3300006847 Bacteria 4195
174 Ga0075429_100063200 3300006880 Bacteria 3226
175 Ga0068865_100008171 3300006881 Bacteria 6459
176 Ga0068865_100022908 3300006881 Bacteria 4082
177 Ga0068865_100229373 3300006881 Bacteria 1456
178 Ga0097620_100000063 3300006931 Bacteria 106123
179 Ga0097620_100027383 3300006931 Bacteria 5717
180 Ga0097620_100033843 3300006931 Bacteria 5130
181 Ga0097620_100038487 3300006931 Bacteria 4799
182 Ga0097620_100067792 3300006931 Bacteria 3603
183 Ga0097620_100110650 3300006931 Bacteria 2808
184 Ga0097620_100831904 3300006931 Bacteria 1010
185 Ga0105251_10063404 3300009011 Bacteria 1734
186 Ga0105240_10103010 3300009093 Bacteria 3468
187 Ga0111539_10037349 3300009094 Bacteria 5866
188 Ga0111539_10163056 3300009094 Bacteria 2607
189 Ga0105245_10236895 3300009098 Bacteria 1767
190 Ga0105245_10644334 3300009098 Unclassified 1089
191 Ga0105247_10007651 3300009101 Bacteria 6612
192 Ga0105247_10070706 3300009101 Bacteria 2181
193 Ga0114129_10051972 3300009147 Bacteria 5752
194 Ga0114129_10079601 3300009147 Bacteria 4556
195 Ga0114129_10938593 3300009147 Bacteria 1094
196 Ga0105241_10003825 3300009174 Bacteria 11159
197 Ga0105241_10063133 3300009174 Bacteria 2857
198 Ga0105241_10157136 3300009174 Bacteria 1866
199 Ga0105242_10008224 3300009176 Bacteria 8016
200 Ga0105242_10017233 3300009176 Bacteria 5625
201 Ga0105242_10063444 3300009176 Bacteria 3042
202 Ga0105242_10103182 3300009176 Bacteria 2419
203 Ga0105242_10110246 3300009176 Bacteria 2344
204 Ga0105242_10285255 3300009176 Bacteria 1501
205 Ga0105248_10041499 3300009177 Bacteria 5158
206 Ga0105237_10071501 3300009545 Unclassified 3464
207 Ga0105249_10000611 3300009553 Bacteria 32583
208 Ga0105249_10002990 3300009553 Bacteria 14581
209 Ga0105249_10003302 3300009553 Bacteria 13975
210 Ga0105249_10005548 3300009553 Bacteria 10904
211 Ga0105249_10031748 3300009553 Unclassified 4778
212 Ga0105249_10061555 3300009553 Unclassified 3445
213 Ga0105249_10084316 3300009553 Bacteria 2959
214 Ga0105249_10393483 3300009553 Bacteria 1414
215 Ga0105239_10045264 3300010375 Bacteria 4822
216 Ga0105239_10068467 3300010375 Unclassified 3901
217 Ga0105239_10131422 3300010375 Bacteria 2785
218 Ga0105246_10011869 3300011119 Bacteria 5419
219 Ga0157373_10034606 3300013100 Bacteria 3628
220 Ga0157373_10060013 3300013100 Bacteria 2695
221 Ga0157373_10069875 3300013100 Bacteria 2482
222 Ga0157371_10045674 3300013102 Bacteria 3116
223 Ga0157371_10045879 3300013102 Bacteria 3109
224 Ga0157371_10052723 3300013102 Bacteria 2888
225 Ga0157370_10001708 3300013104 Bacteria 27039
226 Ga0157370_10274356 3300013104 Unclassified 1558
227 Ga0157369_10238801 3300013105 Bacteria 1898
228 Ga0157374_10004418 3300013296 Bacteria 11821
229 Ga0157374_10013841 3300013296 Bacteria 7047
230 Ga0157374_10025353 3300013296 Bacteria 5323
231 Ga0157374_10033564 3300013296 Bacteria 4683
232 Ga0157374_10074831 3300013296 Bacteria 3199
233 Ga0157374_10078802 3300013296 Bacteria 3121
234 Ga0157374_10192720 3300013296 Bacteria 1994
235 Ga0157378_10021898 3300013297 Bacteria 5620
236 Ga0157378_10025888 3300013297 Bacteria 5169
237 Ga0157378_10026320 3300013297 Bacteria 5128
238 Ga0157378_10087626 3300013297 Unclassified 2824
239 Ga0157378_10447231 3300013297 Bacteria 1282
240 Ga0163162_10003033 3300013306 Bacteria 16038
241 Ga0163162_10004476 3300013306 Bacteria 13464
242 Ga0163162_10009737 3300013306 Bacteria 9353
243 Ga0163162_10011662 3300013306 Bacteria 8568
244 Ga0163162_10015845 3300013306 Bacteria 7366
245 Ga0163162_10038294 3300013306 Bacteria 4785
246 Ga0163162_10196804 3300013306 Bacteria 2144
247 Ga0163162_10215434 3300013306 Bacteria 2050
248 Ga0163162_10480889 3300013306 Bacteria 1373
249 Ga0157372_10033977 3300013307 Bacteria 5603
250 Ga0157372_10116658 3300013307 Bacteria 3061
251 Ga0157372_10138336 3300013307 Unclassified 2805
252 Ga0157372_10263420 3300013307 Unclassified 2002
253 Ga0157372_10332736 3300013307 Bacteria 1769
254 Ga0157375_10005056 3300013308 Bacteria 11447
255 Ga0157375_10006853 3300013308 Bacteria 9931
256 Ga0157375_10022129 3300013308 Bacteria 5847
257 Ga0157375_10041405 3300013308 Bacteria 4448
258 Ga0157375_10077968 3300013308 Bacteria 3345
259 Ga0157375_10110195 3300013308 Bacteria 2850
260 Ga0157375_10127386 3300013308 Bacteria 2663
261 Ga0157375_10129506 3300013308 Bacteria 2642
262 Ga0157375_10229490 3300013308 Bacteria 2015
263 Ga0157375_10244483 3300013308 Bacteria 1954
264 Ga0157375_10572784 3300013308 Bacteria 1290
265 Ga0163163_10000622 3300014325 Bacteria 30476
266 Ga0163163_10007499 3300014325 Bacteria 9629
267 Ga0163163_10009065 3300014325 Bacteria 8868
268 Ga0163163_10049712 3300014325 Bacteria 4127
269 Ga0157380_10001323 3300014326 Bacteria 16093
270 Ga0157380_10069101 3300014326 Bacteria 2849
271 Ga0157380_10076226 3300014326 Bacteria 2728
272 Ga0157380_10185019 3300014326 Bacteria 1834
273 Ga0157380_10258675 3300014326 Bacteria 1580
274 Ga0157380_10313604 3300014326 Bacteria 1451
275 Ga0157377_10013488 3300014745 Bacteria 4136
276 Ga0157377_10014015 3300014745 Bacteria 4071
277 Ga0157377_10027957 3300014745 Bacteria 3032
278 Ga0157377_10033055 3300014745 Bacteria 2820
279 Ga0157377_10079677 3300014745 Bacteria 1911
280 Ga0157377_10118909 3300014745 Bacteria 1599
281 Ga0157379_10004450 3300014968 Bacteria 12015
282 Ga0157379_10084371 3300014968 Bacteria 2847
283 Ga0157376_10000470 3300014969 Bacteria 25946
284 Ga0157376_10010426 3300014969 Bacteria 6797
285 Ga0157376_10011727 3300014969 Bacteria 6472
286 Ga0157376_10097385 3300014969 Bacteria 2563
287 Ga0157376_10169364 3300014969 Bacteria 1987
288 Ga0157376_10440791 3300014969 Bacteria 1268
289 Ga0163161_10002759 3300017792 Bacteria 12490
290 Ga0163161_10054257 3300017792 Bacteria 2908
291 Ga0163161_10319285 3300017792 Unclassified 1227
292 Ga0207666_1005494 3300025271 Bacteria 1620
293 Ga0207697_10007748 3300025315 Bacteria 4760
294 Ga0207710_10100439 3300025900 Bacteria 1364
295 Ga0207688_10045517 3300025901 Bacteria 2448
296 Ga0207688_10213900 3300025901 Bacteria 1159
297 Ga0207680_10001013 3300025903 Bacteria 13240
298 Ga0207647_10037949 3300025904 Bacteria 3050
299 Ga0207647_10050347 3300025904 Bacteria 2579
300 Ga0207645_10004292 3300025907 Bacteria 10577
301 Ga0207645_10006111 3300025907 Bacteria 8656
302 Ga0207645_10028120 3300025907 Bacteria 3631
303 Ga0207645_10028163 3300025907 Bacteria 3628
304 Ga0207643_10018856 3300025908 Bacteria 3779
305 Ga0207643_10046412 3300025908 Bacteria 2456
306 Ga0207643_10069573 3300025908 Bacteria 2023
307 Ga0207705_10133664 3300025909 Bacteria 1848
308 Ga0207654_10001540 3300025911 Bacteria 12125
309 Ga0207695_10069798 3300025913 Bacteria 3594
310 Ga0207662_10065721 3300025918 Bacteria 2184
311 Ga0207662_10065888 3300025918 Bacteria 2181
312 Ga0207649_10011416 3300025920 Bacteria 4899
313 Ga0207649_10100423 3300025920 Bacteria 1914
314 Ga0207681_10003649 3300025923 Bacteria 9570
315 Ga0207681_10078262 3300025923 Bacteria 2327
316 Ga0207650_10095642 3300025925 Bacteria 2277
317 Ga0207650_10128637 3300025925 Unclassified 1980
318 Ga0207650_10138872 3300025925 Bacteria 1909
319 Ga0207650_10176175 3300025925 Bacteria 1702
320 Ga0207659_10019217 3300025926 Bacteria 4492
321 Ga0207659_10025237 3300025926 Bacteria 3991
322 Ga0207659_10028919 3300025926 Bacteria 3771
323 Ga0207659_10057450 3300025926 Bacteria 2790
324 Ga0207659_10062093 3300025926 Bacteria 2696
325 Ga0207659_10074987 3300025926 Bacteria 2481
326 Ga0207659_10121013 3300025926 Bacteria 2006
327 Ga0207644_10007894 3300025931 Bacteria 6958
328 Ga0207644_10131501 3300025931 Bacteria 1916
329 Ga0207644_10178874 3300025931 Unclassified 1661
330 Ga0207690_10016430 3300025932 Bacteria 4502
331 Ga0207690_10132618 3300025932 Bacteria 1825
332 Ga0207706_10003615 3300025933 Bacteria 14774
333 Ga0207706_10010668 3300025933 Bacteria 8392
334 Ga0207706_10019180 3300025933 Bacteria 6150
335 Ga0207706_10061907 3300025933 Bacteria 3296
336 Ga0207706_10112023 3300025933 Bacteria 2401
337 Ga0207686_10002249 3300025934 Bacteria 10600
338 Ga0207686_10155454 3300025934 Bacteria 1597
339 Ga0207686_10330031 3300025934 Bacteria 1142
340 Ga0207670_10002890 3300025936 Bacteria 9067
341 Ga0207670_10045260 3300025936 Bacteria 2916
342 Ga0207669_10273437 3300025937 Bacteria 1270
343 Ga0207704_10014800 3300025938 Bacteria 3953
344 Ga0207704_10015976 3300025938 Bacteria 3844
345 Ga0207704_10080127 3300025938 Bacteria 2107
346 Ga0207691_10000054 3300025940 Bacteria 91463
347 Ga0207691_10022400 3300025940 Bacteria 5957
348 Ga0207691_10036500 3300025940 Bacteria 4554
349 Ga0207691_10047045 3300025940 Bacteria 3962
350 Ga0207691_10164710 3300025940 Bacteria 1943
351 Ga0207691_10217605 3300025940 Bacteria 1657
352 Ga0207689_10003626 3300025942 Bacteria 14111
353 Ga0207689_10006314 3300025942 Bacteria 10500
354 Ga0207689_10035409 3300025942 Bacteria 4148
355 Ga0207689_10036246 3300025942 Bacteria 4096
356 Ga0207689_10044077 3300025942 Bacteria 3688
357 Ga0207689_10062893 3300025942 Bacteria 3053
358 Ga0207689_10163679 3300025942 Bacteria 1833
359 Ga0207661_10069300 3300025944 Unclassified 2875
360 Ga0207661_10109325 3300025944 Bacteria 2335
361 Ga0207679_10000324 3300025945 Bacteria 35673
362 Ga0207679_10004625 3300025945 Bacteria 8571
363 Ga0207679_10062382 3300025945 Bacteria 2777
364 Ga0207679_10191289 3300025945 Bacteria 1701
365 Ga0207679_10210980 3300025945 Unclassified 1628
366 Ga0207667_10197351 3300025949 Bacteria 2065
367 Ga0207667_10227229 3300025949 Bacteria 1912
368 Ga0207651_10006957 3300025960 Bacteria 5985
369 Ga0207651_10067058 3300025960 Bacteria 2524
370 Ga0207651_10142858 3300025960 Bacteria 1851
371 Ga0207651_10182236 3300025960 Bacteria 1667
372 Ga0207712_10003748 3300025961 Bacteria 9593
373 Ga0207712_10014253 3300025961 Bacteria 5107
374 Ga0207712_10015131 3300025961 Bacteria 4972
375 Ga0207712_10087344 3300025961 Unclassified 2287
376 Ga0207712_10172415 3300025961 Bacteria 1692
377 Ga0207668_10009816 3300025972 Bacteria 5751
378 Ga0207668_10198850 3300025972 Bacteria 1594
379 Ga0207658_10007355 3300025986 Bacteria 7505
380 Ga0207677_10050362 3300026023 Bacteria 2817
381 Ga0207677_10208311 3300026023 Bacteria 1559
382 Ga0207703_10009714 3300026035 Bacteria 7549
383 Ga0207703_10010563 3300026035 Bacteria 7217
384 Ga0207703_10010801 3300026035 Bacteria 7124
385 Ga0207703_10407297 3300026035 Bacteria 1263
386 Ga0207639_10105141 3300026041 Bacteria 2290
387 Ga0207639_10357583 3300026041 Bacteria 1306
388 Ga0207708_10196303 3300026075 Bacteria 1608
389 Ga0207641_10000873 3300026088 Bacteria 31566
390 Ga0207641_10030185 3300026088 Bacteria 4489
391 Ga0207641_10122785 3300026088 Bacteria 2321
392 Ga0207641_10163843 3300026088 Unclassified 2023
393 Ga0207641_10219586 3300026088 Unclassified 1762
394 Ga0207648_10012173 3300026089 Bacteria 8061
395 Ga0207648_10025722 3300026089 Bacteria 5239
396 Ga0207648_10108958 3300026089 Bacteria 2431
397 Ga0207648_10122287 3300026089 Unclassified 2289
398 Ga0207648_10150217 3300026089 Bacteria 2055
399 Ga0207648_10152668 3300026089 Bacteria 2038
400 Ga0207648_10259090 3300026089 Bacteria 1552
401 Ga0207676_10025338 3300026095 Bacteria 4401
402 Ga0207676_10032126 3300026095 Bacteria 3953
403 Ga0207676_10032980 3300026095 Bacteria 3909
404 Ga0207676_10081617 3300026095 Bacteria 2627
405 Ga0207676_10192438 3300026095 Unclassified 1796
406 Ga0207676_10261343 3300026095 Unclassified 1563
407 Ga0207674_10004504 3300026116 Bacteria 16746
408 Ga0207674_10024798 3300026116 Bacteria 6402
409 Ga0207674_10026060 3300026116 Bacteria 6220
410 Ga0207674_10065499 3300026116 Bacteria 3662
411 Ga0207674_10234747 3300026116 Unclassified 1782
412 Ga0207674_10332130 3300026116 Bacteria 1470
413 Ga0207675_100007215 3300026118 Bacteria 10498
414 Ga0207675_100017141 3300026118 Bacteria 6764
415 Ga0207675_100022631 3300026118 Bacteria 5850
416 Ga0207675_100069281 3300026118 Unclassified 3297
417 Ga0207675_100078124 3300026118 Bacteria 3101
418 Ga0207675_100155294 3300026118 Bacteria 2180
419 Ga0207683_10001021 3300026121 Bacteria 25523
420 Ga0207683_10284529 3300026121 Bacteria 1511
421 Ga0268266_10026810 3300028379 Bacteria 4903
422 Ga0268266_10184219 3300028379 Bacteria 1903
423 Ga0268265_10024399 3300028380 Bacteria 4277
424 Ga0268264_10060219 3300028381 Bacteria 3182
425 Ga0268264_10060463 3300028381 Bacteria 3175
426 Ga0268264_10074982 3300028381 Bacteria 2875
427 Ga0268264_10234220 3300028381 Bacteria 1697
428 Ga0268264_10388967 3300028381 Bacteria 1337
429 Ga0307515_10000246 3300028794 Bacteria 134348
430 Ga0265327_10000659 3300031251 Bacteria 55479
431 Ga0307508_10001577 3300031616 Bacteria 25442
432 Ga0307406_10130924 3300031901 Bacteria 1761
433 Ga0373947_0066221 3300035725 Bacteria 2205
434 Ga0373937_0111295 3300036401 Bacteria 2547
435 Ga0395900_0107581 3300037418 Unclassified 2865
436 Ga0395905_0013062 3300037471 Bacteria 7976
437 Ga0395905_0031821 3300037471 Bacteria 4964
438 Ga0395905_0264319 3300037471 Bacteria 1606
439 Ga0436365_1354401 3300039437 Bacteria 12100
440 Ga0436365_1417769 3300039437 Unclassified 1500
441 Ga0439436_0010999 3300041404 Bacteria 2752
442 Ga0451807_2677103 3300041486 Bacteria 1859
443 Ga0439449_0012220 3300042007 Bacteria 3228
444 Ga0466969_0000083 3300044656 Bacteria 49836
445 Ga0466966_0000204 3300044684 Bacteria 39652
446 Ga0466961_0069381 3300044693 Bacteria 2238
447 Ga0466964_0022986 3300044706 Bacteria 2422
448 Ga0466959_0000008 3300045049 Bacteria 179537
449 Ga0495628_0018508 3300046516 Bacteria 5768
450 Ga0495635_0096952 3300046663 Bacteria 2016
451 Ga0496104_0477093 3300048907 Bacteria 1159
452 Ga0496110_0069335 3300048913 Bacteria 3123
453 Ga0501292_010455 3300049515 Bacteria 1389
454 Ga0501298_003833 3300049521 Unclassified 2348
455 Ga0501047_0024231 3300049581 Bacteria 5826
456 Ga0501202_001838 3300049652 Unclassified 3479
457 Ga0501207_001425 3300049654 Unclassified 2988
458 Ga0501223_004531 3300049663 Bacteria 2965
459 Ga0501224_003392 3300049664 Bacteria 2219
460 Ga0501233_007009 3300049668 Bacteria 2136
461 Ga0501235_019112 3300049669 Bacteria 1520
462 Ga0501238_006844 3300049671 Bacteria 1474
463 Ga0501240_011486 3300049673 Bacteria 1194
464 Ga0501242_006803 3300049674 Unclassified 1311
465 Ga0501243_006503 3300049675 Bacteria 1772
466 Ga0501250_000826 3300049680 Unclassified 2305
467 Ga0501252_002354 3300049682 Bacteria 1870
468 Ga0501257_016642 3300049686 Unclassified 1707
469 Ga0501257_027732 3300049686 Bacteria 1356
470 Ga0501259_001745 3300049688 Bacteria 3600
471 Ga0501259_006547 3300049688 Bacteria 1854
472 Ga0501261_011776 3300049690 Unclassified 1170
473 Ga0501221_001490 3300049704 Bacteria 3879
474 Ga0501225_0006931 3300049705 Unclassified 3300
475 Ga0501245_002114 3300049708 Bacteria 2637
476 Ga0501245_012366 3300049708 Unclassified 1252
477 Ga0501266_003098 3300049763 Bacteria 2069
478 Ga0501266_007962 3300049763 Bacteria 1333
479 Ga0501270_010297 3300049767 Unclassified 1229
480 Ga0501279_002446 3300049775 Unclassified 2436
481 Ga0501212_013863 3300049851 Bacteria 1187
482 nmdc:mga05p37_289700_c1 3300050507 Unclassified 1949
483 nmdc:mga05p37_78607_c1 3300050507 Bacteria 4062
484 nmdc:mga06r32_16860_c1 3300050510 Bacteria 6662
485 nmdc:mga08y16_301063_c1 3300050511 Bacteria 1653
486 Ga0500568_0007506 3300053139 Bacteria 5343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10110246 Ga0105242_101102462 264
2 3300053139 Ga0500568_0007506 Ga0500568_0007506_11_808 265
3 3300013307 Ga0157372_10332736 Ga0157372_103327363 272
4 3300026116 Ga0207674_10234747 Ga0207674_102347472 273
5 3300005354 Ga0070675_100388646 Ga0070675_1003886461 280
6 3300025940 Ga0207691_10217605 Ga0207691_102176051 283
7 3300013297 Ga0157378_10026320 Ga0157378_100263202 285
8 3300005290 Ga0065712_10002588 Ga0065712_100025883 289
9 3300005293 Ga0065715_10092691 Ga0065715_100926915 289
10 3300005340 Ga0070689_100065476 Ga0070689_1000654763 289
11 3300005347 Ga0070668_100132583 Ga0070668_1001325832 289
12 3300005353 Ga0070669_100006284 Ga0070669_1000062842 289
13 3300005354 Ga0070675_100003096 Ga0070675_1000030965 289
14 3300005364 Ga0070673_100004586 Ga0070673_1000045865 289
15 3300005365 Ga0070688_100033057 Ga0070688_1000330572 289
16 3300005457 Ga0070662_100258676 Ga0070662_1002586762 289
17 3300005543 Ga0070672_100022422 Ga0070672_1000224223 289
18 3300005719 Ga0068861_100020375 Ga0068861_1000203754 289
19 3300005840 Ga0068870_10017874 Ga0068870_100178744 289
20 3300005841 Ga0068863_100210700 Ga0068863_1002107002 289
21 3300005843 Ga0068860_100167233 Ga0068860_1001672332 289
22 3300005844 Ga0068862_100014984 Ga0068862_1000149842 289
23 3300006358 Ga0068871_100046871 Ga0068871_1000468713 289
24 3300009094 Ga0111539_10037349 Ga0111539_100373491 289
25 3300009553 Ga0105249_10003302 Ga0105249_100033025 289
26 3300013297 Ga0157378_10447231 Ga0157378_104472311 289
27 3300013306 Ga0163162_10215434 Ga0163162_102154343 289
28 3300013308 Ga0157375_10244483 Ga0157375_102444833 289
29 3300014326 Ga0157380_10001323 Ga0157380_100013235 289
30 3300025271 Ga0207666_1005494 Ga0207666_10054941 289
31 3300025315 Ga0207697_10007748 Ga0207697_100077484 289
32 3300025908 Ga0207643_10018856 Ga0207643_100188561 289
33 3300025918 Ga0207662_10065721 Ga0207662_100657212 289
34 3300025923 Ga0207681_10003649 Ga0207681_100036498 289
35 3300025926 Ga0207659_10019217 Ga0207659_100192173 289
36 3300025933 Ga0207706_10112023 Ga0207706_101120233 289
37 3300025934 Ga0207686_10002249 Ga0207686_100022494 289
38 3300025938 Ga0207704_10080127 Ga0207704_100801271 289
39 3300025961 Ga0207712_10087344 Ga0207712_100873442 289
40 3300026088 Ga0207641_10163843 Ga0207641_101638432 289
41 3300026095 Ga0207676_10192438 Ga0207676_101924383 289
42 3300026095 Ga0207676_10261343 Ga0207676_102613432 289
43 3300026116 Ga0207674_10024798 Ga0207674_100247983 289
44 3300026118 Ga0207675_100007215 Ga0207675_1000072158 289
45 3300026118 Ga0207675_100069281 Ga0207675_1000692812 289
46 3300028380 Ga0268265_10024399 Ga0268265_100243995 289
47 3300048907 Ga0496104_0477093 Ga0496104_0477093_16_900 289
48 3300005564 Ga0070664_100093945 Ga0070664_1000939452 291
49 3300009176 Ga0105242_10285255 Ga0105242_102852552 291
50 3300025907 Ga0207645_10028120 Ga0207645_100281204 291
51 3300005290 Ga0065712_10019474 Ga0065712_100194742 293
52 3300005327 Ga0070658_10329131 Ga0070658_103291311 293
53 3300005329 Ga0070683_100062028 Ga0070683_1000620284 293
54 3300005331 Ga0070670_100171679 Ga0070670_1001716792 293
55 3300005334 Ga0068869_100139056 Ga0068869_1001390563 293
56 3300005338 Ga0068868_100026832 Ga0068868_1000268324 293
57 3300005340 Ga0070689_100014340 Ga0070689_1000143406 293
58 3300005344 Ga0070661_100017277 Ga0070661_1000172773 293
59 3300005455 Ga0070663_100221652 Ga0070663_1002216522 293
60 3300005543 Ga0070672_100331488 Ga0070672_1003314881 293
61 3300005564 Ga0070664_100319044 Ga0070664_1003190441 293
62 3300005577 Ga0068857_100018261 Ga0068857_1000182614 293
63 3300005617 Ga0068859_100110649 Ga0068859_1001106492 293
64 3300005618 Ga0068864_100014506 Ga0068864_1000145062 293
65 3300005841 Ga0068863_100465334 Ga0068863_1004653341 293
66 3300005843 Ga0068860_100015121 Ga0068860_1000151214 293
67 3300006358 Ga0068871_100121934 Ga0068871_1001219343 293
68 3300006931 Ga0097620_100110650 Ga0097620_1001106503 293
69 3300013100 Ga0157373_10069875 Ga0157373_100698751 293
70 3300013296 Ga0157374_10004418 Ga0157374_100044189 293
71 3300013306 Ga0163162_10038294 Ga0163162_100382944 293
72 3300013308 Ga0157375_10005056 Ga0157375_100050565 293
73 3300013308 Ga0157375_10110195 Ga0157375_101101952 293
74 3300014325 Ga0163163_10000622 Ga0163163_1000062219 293
75 3300014326 Ga0157380_10313604 Ga0157380_103136042 293
76 3300014745 Ga0157377_10014015 Ga0157377_100140154 293
77 3300025901 Ga0207688_10213900 Ga0207688_102139002 293
78 3300025904 Ga0207647_10037949 Ga0207647_100379494 293
79 3300025920 Ga0207649_10011416 Ga0207649_100114165 293
80 3300025923 Ga0207681_10078262 Ga0207681_100782622 293
81 3300025925 Ga0207650_10176175 Ga0207650_101761751 293
82 3300025926 Ga0207659_10121013 Ga0207659_101210133 293
83 3300025933 Ga0207706_10019180 Ga0207706_100191804 293
84 3300025940 Ga0207691_10047045 Ga0207691_100470452 293
85 3300025942 Ga0207689_10044077 Ga0207689_100440772 293
86 3300025944 Ga0207661_10109325 Ga0207661_101093252 293
87 3300025945 Ga0207679_10004625 Ga0207679_100046254 293
88 3300026116 Ga0207674_10026060 Ga0207674_100260603 293
89 3300028381 Ga0268264_10388967 Ga0268264_103889672 293
90 3300037471 Ga0395905_0264319 Ga0395905_0264319_26_1021 293
91 3300048913 Ga0496110_0069335 Ga0496110_0069335_802_1737 293
92 iso_pu_bacteria 2738541278 2738726833 293
93 3300005356 Ga0070674_100177509 Ga0070674_1001775091 294
94 3300025934 Ga0207686_10155454 Ga0207686_101554542 294
95 3300005459 Ga0068867_100271325 Ga0068867_1002713252 295
96 3300005843 Ga0068860_100013144 Ga0068860_1000131446 295
97 3300005844 Ga0068862_100010083 Ga0068862_1000100831 295
98 3300013104 Ga0157370_10001708 Ga0157370_1000170819 295
99 3300028381 Ga0268264_10234220 Ga0268264_102342202 295
100 3300039437 Ga0436365_1354401 Ga0436365_1354401_7291_8235 295
101 3300003322 rootL2_10211758 rootL2_102117584 296
102 3300003322 rootL2_10292120 rootL2_102921201 296
103 3300003323 rootH1_10006023 rootH1_100060239 296
104 3300005328 Ga0070676_10002132 Ga0070676_100021327 296
105 3300005334 Ga0068869_100014641 Ga0068869_1000146413 296
106 3300005335 Ga0070666_10082293 Ga0070666_100822931 296
107 3300005338 Ga0068868_100072151 Ga0068868_1000721512 296
108 3300005354 Ga0070675_100122025 Ga0070675_1001220252 296
109 3300005356 Ga0070674_100033110 Ga0070674_1000331104 296
110 3300005364 Ga0070673_100034994 Ga0070673_1000349945 296
111 3300005456 Ga0070678_100004411 Ga0070678_1000044117 296
112 3300005459 Ga0068867_100009802 Ga0068867_1000098026 296
113 3300005466 Ga0070685_10043055 Ga0070685_100430553 296
114 3300005539 Ga0068853_100041972 Ga0068853_1000419722 296
115 3300005543 Ga0070672_100007653 Ga0070672_1000076532 296
116 3300005617 Ga0068859_100033843 Ga0068859_1000338432 296
117 3300005719 Ga0068861_100054532 Ga0068861_1000545322 296
118 3300005840 Ga0068870_10076498 Ga0068870_100764982 296
119 3300006881 Ga0068865_100008171 Ga0068865_1000081715 296
120 3300006931 Ga0097620_100033843 Ga0097620_1000338432 296
121 3300009098 Ga0105245_10236895 Ga0105245_102368952 296
122 3300009174 Ga0105241_10063133 Ga0105241_100631332 296
123 3300009174 Ga0105241_10157136 Ga0105241_101571363 296
124 3300013296 Ga0157374_10078802 Ga0157374_100788022 296
125 3300025901 Ga0207688_10045517 Ga0207688_100455172 296
126 3300025907 Ga0207645_10004292 Ga0207645_100042924 296
127 3300025908 Ga0207643_10069573 Ga0207643_100695732 296
128 3300025926 Ga0207659_10057450 Ga0207659_100574502 296
129 3300025931 Ga0207644_10178874 Ga0207644_101788742 296
130 3300025938 Ga0207704_10015976 Ga0207704_100159763 296
131 3300025940 Ga0207691_10022400 Ga0207691_100224002 296
132 3300025942 Ga0207689_10003626 Ga0207689_1000362611 296
133 3300025942 Ga0207689_10062893 Ga0207689_100628932 296
134 3300025960 Ga0207651_10067058 Ga0207651_100670583 296
135 3300025972 Ga0207668_10198850 Ga0207668_101988502 296
136 3300026041 Ga0207639_10105141 Ga0207639_101051412 296
137 3300026089 Ga0207648_10025722 Ga0207648_100257225 296
138 3300026118 Ga0207675_100022631 Ga0207675_1000226314 296
139 3300026121 Ga0207683_10001021 Ga0207683_100010215 296
140 3300028379 Ga0268266_10026810 Ga0268266_100268102 296
141 3300028381 Ga0268264_10060219 Ga0268264_100602194 296
142 3300049763 Ga0501266_007962 Ga0501266_007962_149_1159 296
143 3300005290 Ga0065712_10003083 Ga0065712_100030834 297
144 3300005293 Ga0065715_10097288 Ga0065715_100972883 297
145 3300005334 Ga0068869_100067335 Ga0068869_1000673354 297
146 3300005340 Ga0070689_100015977 Ga0070689_1000159777 297
147 3300005354 Ga0070675_100064227 Ga0070675_1000642274 297
148 3300005364 Ga0070673_100037321 Ga0070673_1000373214 297
149 3300005365 Ga0070688_100009883 Ga0070688_1000098834 297
150 3300005459 Ga0068867_100157156 Ga0068867_1001571562 297
151 3300005466 Ga0070685_10032744 Ga0070685_100327442 297
152 3300005539 Ga0068853_100215672 Ga0068853_1002156723 297
153 3300005543 Ga0070672_100074813 Ga0070672_1000748133 297
154 3300005840 Ga0068870_10039812 Ga0068870_100398121 297
155 3300009176 Ga0105242_10103182 Ga0105242_101031822 297
156 3300013308 Ga0157375_10127386 Ga0157375_101273862 297
157 3300014745 Ga0157377_10013488 Ga0157377_100134884 297
158 3300025908 Ga0207643_10046412 Ga0207643_100464121 297
159 3300025918 Ga0207662_10065888 Ga0207662_100658882 297
160 3300025936 Ga0207670_10045260 Ga0207670_100452603 297
161 3300025960 Ga0207651_10142858 Ga0207651_101428582 297
162 3300026118 Ga0207675_100155294 Ga0207675_1001552942 297
163 3300031616 Ga0307508_10001577 Ga0307508_1000157717 297
164 3300041486 Ga0451807_2677103 Ga0451807_2677103_366_1277 297
165 3300003791 Ga0055530_10006610 Ga0055530_100066105 298
166 3300005331 Ga0070670_100092550 Ga0070670_1000925503 298
167 3300005338 Ga0068868_100185400 Ga0068868_1001854001 298
168 3300005364 Ga0070673_100096402 Ga0070673_1000964024 298
169 3300005367 Ga0070667_100252746 Ga0070667_1002527462 298
170 3300005456 Ga0070678_100273060 Ga0070678_1002730602 298
171 3300005617 Ga0068859_100831876 Ga0068859_1008318761 298
172 3300005841 Ga0068863_100006646 Ga0068863_1000066467 298
173 3300005842 Ga0068858_100443846 Ga0068858_1004438461 298
174 3300006844 Ga0075428_100160975 Ga0075428_1001609752 298
175 3300006931 Ga0097620_100831904 Ga0097620_1008319041 298
176 3300009147 Ga0114129_10938593 Ga0114129_109385931 298
177 3300009176 Ga0105242_10017233 Ga0105242_100172333 298
178 3300009553 Ga0105249_10002990 Ga0105249_100029904 298
179 3300010375 Ga0105239_10068467 Ga0105239_100684671 298
180 3300013308 Ga0157375_10077968 Ga0157375_100779682 298
181 3300013308 Ga0157375_10572784 Ga0157375_105727841 298
182 3300014745 Ga0157377_10027957 Ga0157377_100279572 298
183 3300014745 Ga0157377_10118909 Ga0157377_101189092 298
184 3300025925 Ga0207650_10095642 Ga0207650_100956423 298
185 3300025931 Ga0207644_10131501 Ga0207644_101315012 298
186 3300025934 Ga0207686_10330031 Ga0207686_103300311 298
187 3300025940 Ga0207691_10036500 Ga0207691_100365005 298
188 3300025945 Ga0207679_10191289 Ga0207679_101912891 298
189 3300025960 Ga0207651_10182236 Ga0207651_101822362 298
190 3300025961 Ga0207712_10015131 Ga0207712_100151313 298
191 3300026035 Ga0207703_10407297 Ga0207703_104072971 298
192 3300026075 Ga0207708_10196303 Ga0207708_101963032 298
193 3300026088 Ga0207641_10000873 Ga0207641_1000087323 298
194 3300026116 Ga0207674_10332130 Ga0207674_103321302 298
195 3300026121 Ga0207683_10284529 Ga0207683_102845291 298
196 3300031901 Ga0307406_10130924 Ga0307406_101309241 298
197 3300044706 Ga0466964_0022986 Ga0466964_0022986_947_1909 298
198 3300049581 Ga0501047_0024231 Ga0501047_0024231_603_1559 298
199 3300049671 Ga0501238_006844 Ga0501238_006844_74_1036 298
200 3300005365 Ga0070688_100164748 Ga0070688_1001647482 299
201 3300005366 Ga0070659_100031035 Ga0070659_1000310353 299
202 3300005471 Ga0070698_100016635 Ga0070698_1000166354 299
203 3300005471 Ga0070698_100452619 Ga0070698_1004526192 299
204 3300005719 Ga0068861_100025112 Ga0068861_1000251125 299
205 3300006237 Ga0097621_100000278 Ga0097621_10000027818 299
206 3300006358 Ga0068871_100000825 Ga0068871_10000082512 299
207 3300009176 Ga0105242_10008224 Ga0105242_100082247 299
208 3300009553 Ga0105249_10000611 Ga0105249_1000061136 299
209 3300009553 Ga0105249_10031748 Ga0105249_100317483 299
210 3300013100 Ga0157373_10060013 Ga0157373_100600132 299
211 3300013297 Ga0157378_10021898 Ga0157378_100218985 299
212 3300013306 Ga0163162_10003033 Ga0163162_100030336 299
213 3300013306 Ga0163162_10480889 Ga0163162_104808892 299
214 3300013308 Ga0157375_10006853 Ga0157375_100068536 299
215 3300014969 Ga0157376_10000470 Ga0157376_100004705 299
216 3300025931 Ga0207644_10007894 Ga0207644_100078942 299
217 3300025932 Ga0207690_10132618 Ga0207690_101326183 299
218 3300025961 Ga0207712_10003748 Ga0207712_100037486 299
219 3300026089 Ga0207648_10259090 Ga0207648_102590902 299
220 3300026118 Ga0207675_100017141 Ga0207675_1000171411 299
221 3300031251 Ga0265327_10000659 Ga0265327_1000065912 299
222 3300046663 Ga0495635_0096952 Ga0495635_0096952_223_1164 299
223 3300005295 Ga0065707_10206805 Ga0065707_102068052 300
224 3300005327 Ga0070658_10013164 Ga0070658_100131643 300
225 3300005328 Ga0070676_10028672 Ga0070676_100286723 300
226 3300005331 Ga0070670_100073221 Ga0070670_1000732211 300
227 3300005334 Ga0068869_100201209 Ga0068869_1002012092 300
228 3300005335 Ga0070666_10011049 Ga0070666_100110493 300
229 3300005338 Ga0068868_100264656 Ga0068868_1002646562 300
230 3300005347 Ga0070668_100018730 Ga0070668_1000187305 300
231 3300005354 Ga0070675_100031117 Ga0070675_1000311174 300
232 3300005364 Ga0070673_100008358 Ga0070673_1000083584 300
233 3300005367 Ga0070667_100049538 Ga0070667_1000495383 300
234 3300005471 Ga0070698_100001455 Ga0070698_10000145526 300
235 3300005471 Ga0070698_100010680 Ga0070698_1000106805 300
236 3300005539 Ga0068853_100135899 Ga0068853_1001358992 300
237 3300005543 Ga0070672_100003214 Ga0070672_1000032149 300
238 3300005563 Ga0068855_100269445 Ga0068855_1002694452 300
239 3300005564 Ga0070664_100516473 Ga0070664_1005164731 300
240 3300005618 Ga0068864_100072672 Ga0068864_1000726723 300
241 3300005719 Ga0068861_100056541 Ga0068861_1000565411 300
242 3300005841 Ga0068863_100011608 Ga0068863_1000116083 300
243 3300005842 Ga0068858_100049209 Ga0068858_1000492092 300
244 3300005843 Ga0068860_100021364 Ga0068860_1000213645 300
245 3300006358 Ga0068871_100159361 Ga0068871_1001593611 300
246 3300006881 Ga0068865_100022908 Ga0068865_1000229083 300
247 3300009093 Ga0105240_10103010 Ga0105240_101030102 300
248 3300009094 Ga0111539_10163056 Ga0111539_101630562 300
249 3300009177 Ga0105248_10041499 Ga0105248_100414993 300
250 3300009553 Ga0105249_10061555 Ga0105249_100615552 300
251 3300009553 Ga0105249_10084316 Ga0105249_100843163 300
252 3300010375 Ga0105239_10045264 Ga0105239_100452645 300
253 3300013296 Ga0157374_10025353 Ga0157374_100253535 300
254 3300013306 Ga0163162_10015845 Ga0163162_100158454 300
255 3300013308 Ga0157375_10129506 Ga0157375_101295062 300
256 3300014325 Ga0163163_10007499 Ga0163163_100074999 300
257 3300014326 Ga0157380_10069101 Ga0157380_100691012 300
258 3300014968 Ga0157379_10004450 Ga0157379_100044504 300
259 3300014969 Ga0157376_10010426 Ga0157376_100104264 300
260 3300017792 Ga0163161_10054257 Ga0163161_100542574 300
261 3300025903 Ga0207680_10001013 Ga0207680_1000101310 300
262 3300025904 Ga0207647_10050347 Ga0207647_100503474 300
263 3300025907 Ga0207645_10028163 Ga0207645_100281634 300
264 3300025909 Ga0207705_10133664 Ga0207705_101336642 300
265 3300025913 Ga0207695_10069798 Ga0207695_100697984 300
266 3300025926 Ga0207659_10074987 Ga0207659_100749873 300
267 3300025938 Ga0207704_10014800 Ga0207704_100148002 300
268 3300025940 Ga0207691_10000054 Ga0207691_100000545 300
269 3300025942 Ga0207689_10035409 Ga0207689_100354092 300
270 3300025942 Ga0207689_10036246 Ga0207689_100362462 300
271 3300025949 Ga0207667_10227229 Ga0207667_102272292 300
272 3300025960 Ga0207651_10006957 Ga0207651_100069573 300
273 3300025961 Ga0207712_10172415 Ga0207712_101724152 300
274 3300025972 Ga0207668_10009816 Ga0207668_100098163 300
275 3300025986 Ga0207658_10007355 Ga0207658_100073553 300
276 3300026023 Ga0207677_10208311 Ga0207677_102083112 300
277 3300026035 Ga0207703_10010801 Ga0207703_100108016 300
278 3300026041 Ga0207639_10357583 Ga0207639_103575832 300
279 3300026088 Ga0207641_10030185 Ga0207641_100301854 300
280 3300026095 Ga0207676_10081617 Ga0207676_100816172 300
281 3300028379 Ga0268266_10184219 Ga0268266_101842192 300
282 3300028381 Ga0268264_10060463 Ga0268264_100604633 300
283 3300049690 Ga0501261_011776 Ga0501261_011776_14_1015 300
284 3300050511 nmdc:mga08y16_301063_c1 nmdc:mga08y16_301063_c1_634_1602 300
285 3300003316 rootH1_10090526 rootH1_100905261 301
286 3300003323 rootH1_10329690 rootH1_103296902 301
287 3300005329 Ga0070683_100015091 Ga0070683_1000150917 301
288 3300005334 Ga0068869_100007645 Ga0068869_1000076451 301
289 3300005337 Ga0070682_100130316 Ga0070682_1001303161 301
290 3300005355 Ga0070671_100029256 Ga0070671_1000292562 301
291 3300005364 Ga0070673_100048310 Ga0070673_1000483103 301
292 3300005364 Ga0070673_100122160 Ga0070673_1001221602 301
293 3300005366 Ga0070659_100007872 Ga0070659_1000078725 301
294 3300005367 Ga0070667_100137383 Ga0070667_1001373832 301
295 3300005457 Ga0070662_100005282 Ga0070662_1000052821 301
296 3300005535 Ga0070684_100000282 Ga0070684_10000028228 301
297 3300005539 Ga0068853_100000774 Ga0068853_10000077417 301
298 3300005564 Ga0070664_100003521 Ga0070664_1000035218 301
299 3300005577 Ga0068857_100001911 Ga0068857_10000191112 301
300 3300005578 Ga0068854_100277278 Ga0068854_1002772782 301
301 3300005616 Ga0068852_100023983 Ga0068852_1000239833 301
302 3300005617 Ga0068859_100000063 Ga0068859_10000006313 301
303 3300005618 Ga0068864_100350172 Ga0068864_1003501722 301
304 3300005842 Ga0068858_100006614 Ga0068858_1000066143 301
305 3300005843 Ga0068860_100002526 Ga0068860_1000025263 301
306 3300006358 Ga0068871_100012267 Ga0068871_1000122675 301
307 3300006881 Ga0068865_100229373 Ga0068865_1002293732 301
308 3300006931 Ga0097620_100000063 Ga0097620_10000006313 301
309 3300009101 Ga0105247_10007651 Ga0105247_100076511 301
310 3300009147 Ga0114129_10079601 Ga0114129_100796013 301
311 3300009174 Ga0105241_10003825 Ga0105241_100038252 301
312 3300010375 Ga0105239_10131422 Ga0105239_101314222 301
313 3300011119 Ga0105246_10011869 Ga0105246_100118691 301
314 3300013104 Ga0157370_10274356 Ga0157370_102743561 301
315 3300013296 Ga0157374_10013841 Ga0157374_100138416 301
316 3300013306 Ga0163162_10004476 Ga0163162_100044767 301
317 3300013307 Ga0157372_10138336 Ga0157372_101383362 301
318 3300013308 Ga0157375_10022129 Ga0157375_100221297 301
319 3300014326 Ga0157380_10185019 Ga0157380_101850192 301
320 3300014969 Ga0157376_10097385 Ga0157376_100973852 301
321 3300014969 Ga0157376_10440791 Ga0157376_104407912 301
322 3300017792 Ga0163161_10002759 Ga0163161_100027596 301
323 3300017792 Ga0163161_10319285 Ga0163161_103192851 301
324 3300025911 Ga0207654_10001540 Ga0207654_100015402 301
325 3300025920 Ga0207649_10100423 Ga0207649_101004232 301
326 3300025932 Ga0207690_10016430 Ga0207690_100164302 301
327 3300025933 Ga0207706_10010668 Ga0207706_100106688 301
328 3300025937 Ga0207669_10273437 Ga0207669_102734372 301
329 3300025945 Ga0207679_10000324 Ga0207679_1000032426 301
330 3300026023 Ga0207677_10050362 Ga0207677_100503623 301
331 3300026035 Ga0207703_10009714 Ga0207703_100097143 301
332 3300026088 Ga0207641_10122785 Ga0207641_101227852 301
333 3300026088 Ga0207641_10219586 Ga0207641_102195862 301
334 3300026089 Ga0207648_10108958 Ga0207648_101089582 301
335 3300026095 Ga0207676_10032126 Ga0207676_100321264 301
336 3300026116 Ga0207674_10004504 Ga0207674_1000450410 301
337 3300035725 Ga0373947_0066221 Ga0373947_0066221_205_1125 301
338 3300036401 Ga0373937_0111295 Ga0373937_0111295_538_1458 301
339 3300044656 Ga0466969_0000083 Ga0466969_0000083_12844_13815 301
340 3300044684 Ga0466966_0000204 Ga0466966_0000204_34472_35443 301
341 3300044693 Ga0466961_0069381 Ga0466961_0069381_983_1954 301
342 3300045049 Ga0466959_0000008 Ga0466959_0000008_160917_161888 301
343 3300046516 Ga0495628_0018508 Ga0495628_0018508_2066_2986 301
344 3300049775 Ga0501279_002446 Ga0501279_002446_209_1210 301
345 3300050507 nmdc:mga05p37_289700_c1 nmdc:mga05p37_289700_c1_194_1111 301
346 3300005617 Ga0068859_100027384 Ga0068859_1000273846 302
347 3300005618 Ga0068864_100036579 Ga0068864_1000365795 302
348 3300005843 Ga0068860_100198724 Ga0068860_1001987243 302
349 3300006931 Ga0097620_100027383 Ga0097620_1000273832 302
350 3300009553 Ga0105249_10393483 Ga0105249_103934831 302
351 3300013102 Ga0157371_10045674 Ga0157371_100456744 302
352 3300025961 Ga0207712_10014253 Ga0207712_100142536 302
353 3300026089 Ga0207648_10152668 Ga0207648_101526682 302
354 3300026095 Ga0207676_10025338 Ga0207676_100253385 302
355 3300026118 Ga0207675_100078124 Ga0207675_1000781242 302
356 3300028381 Ga0268264_10074982 Ga0268264_100749823 302
357 3300037418 Ga0395900_0107581 Ga0395900_0107581_557_1531 302
358 3300037471 Ga0395905_0013062 Ga0395905_0013062_2670_3644 302
359 3300037471 Ga0395905_0031821 Ga0395905_0031821_3417_4391 302
360 3300041404 Ga0439436_0010999 Ga0439436_0010999_96_1076 302
361 3300005329 Ga0070683_100150033 Ga0070683_1001500332 303
362 3300005338 Ga0068868_100131932 Ga0068868_1001319321 303
363 3300005340 Ga0070689_100023299 Ga0070689_1000232994 303
364 3300005347 Ga0070668_100261508 Ga0070668_1002615082 303
365 3300005355 Ga0070671_100152748 Ga0070671_1001527482 303
366 3300005365 Ga0070688_100074132 Ga0070688_1000741323 303
367 3300005367 Ga0070667_100150645 Ga0070667_1001506453 303
368 3300005457 Ga0070662_100104698 Ga0070662_1001046983 303
369 3300005466 Ga0070685_10019343 Ga0070685_100193433 303
370 3300005543 Ga0070672_100128096 Ga0070672_1001280963 303
371 3300005544 Ga0070686_100143970 Ga0070686_1001439702 303
372 3300005563 Ga0068855_100196612 Ga0068855_1001966122 303
373 3300005564 Ga0070664_100265115 Ga0070664_1002651152 303
374 3300005577 Ga0068857_100017073 Ga0068857_1000170732 303
375 3300005617 Ga0068859_100067790 Ga0068859_1000677902 303
376 3300005618 Ga0068864_100126623 Ga0068864_1001266232 303
377 3300005840 Ga0068870_10208757 Ga0068870_102087572 303
378 3300005841 Ga0068863_100426141 Ga0068863_1004261411 303
379 3300005842 Ga0068858_100141839 Ga0068858_1001418391 303
380 3300006358 Ga0068871_100206068 Ga0068871_1002060682 303
381 3300006847 Ga0075431_100052698 Ga0075431_1000526984 303
382 3300006880 Ga0075429_100063200 Ga0075429_1000632001 303
383 3300006931 Ga0097620_100067792 Ga0097620_1000677922 303
384 3300009011 Ga0105251_10063404 Ga0105251_100634042 303
385 3300009098 Ga0105245_10644334 Ga0105245_106443341 303
386 3300009101 Ga0105247_10070706 Ga0105247_100707062 303
387 3300009147 Ga0114129_10051972 Ga0114129_100519728 303
388 3300009553 Ga0105249_10005548 Ga0105249_100055485 303
389 3300013296 Ga0157374_10033564 Ga0157374_100335643 303
390 3300013297 Ga0157378_10025888 Ga0157378_100258882 303
391 3300013297 Ga0157378_10087626 Ga0157378_100876262 303
392 3300013306 Ga0163162_10011662 Ga0163162_100116625 303
393 3300014325 Ga0163163_10049712 Ga0163163_100497122 303
394 3300014745 Ga0157377_10079677 Ga0157377_100796772 303
395 3300014968 Ga0157379_10084371 Ga0157379_100843712 303
396 3300014969 Ga0157376_10011727 Ga0157376_100117274 303
397 3300014969 Ga0157376_10169364 Ga0157376_101693642 303
398 3300025900 Ga0207710_10100439 Ga0207710_101004392 303
399 3300025926 Ga0207659_10028919 Ga0207659_100289192 303
400 3300025933 Ga0207706_10061907 Ga0207706_100619072 303
401 3300025936 Ga0207670_10002890 Ga0207670_100028905 303
402 3300025940 Ga0207691_10164710 Ga0207691_101647103 303
403 3300025942 Ga0207689_10163679 Ga0207689_101636793 303
404 3300025945 Ga0207679_10062382 Ga0207679_100623822 303
405 3300025949 Ga0207667_10197351 Ga0207667_101973512 303
406 3300026035 Ga0207703_10010563 Ga0207703_100105635 303
407 3300026095 Ga0207676_10032980 Ga0207676_100329803 303
408 3300026116 Ga0207674_10065499 Ga0207674_100654992 303
409 3300028794 Ga0307515_10000246 Ga0307515_1000024630 303
410 3300039437 Ga0436365_1417769 Ga0436365_1417769_377_1297 303
411 3300049669 Ga0501235_019112 Ga0501235_019112_383_1372 303
412 3300049675 Ga0501243_006503 Ga0501243_006503_360_1349 303
413 3300050507 nmdc:mga05p37_78607_c1 nmdc:mga05p37_78607_c1_1995_2942 303
414 3300050510 nmdc:mga06r32_16860_c1 nmdc:mga06r32_16860_c1_1770_2717 303
415 3300005328 Ga0070676_10007967 Ga0070676_100079673 304
416 3300005329 Ga0070683_100105465 Ga0070683_1001054651 304
417 3300005331 Ga0070670_100137964 Ga0070670_1001379642 304
418 3300005338 Ga0068868_100002758 Ga0068868_1000027589 304
419 3300005340 Ga0070689_100137161 Ga0070689_1001371612 304
420 3300005354 Ga0070675_100032353 Ga0070675_1000323533 304
421 3300005459 Ga0068867_100027537 Ga0068867_1000275372 304
422 3300005518 Ga0070699_100050490 Ga0070699_1000504904 304
423 3300005535 Ga0070684_100054259 Ga0070684_1000542594 304
424 3300005535 Ga0070684_100251525 Ga0070684_1002515252 304
425 3300005564 Ga0070664_100030254 Ga0070664_1000302546 304
426 3300005617 Ga0068859_100038487 Ga0068859_1000384872 304
427 3300006931 Ga0097620_100038487 Ga0097620_1000384872 304
428 3300009176 Ga0105242_10063444 Ga0105242_100634442 304
429 3300009545 Ga0105237_10071501 Ga0105237_100715012 304
430 3300013102 Ga0157371_10045879 Ga0157371_100458792 304
431 3300013296 Ga0157374_10192720 Ga0157374_101927202 304
432 3300013306 Ga0163162_10009737 Ga0163162_100097377 304
433 3300013307 Ga0157372_10033977 Ga0157372_100339772 304
434 3300013308 Ga0157375_10041405 Ga0157375_100414053 304
435 3300014325 Ga0163163_10009065 Ga0163163_100090657 304
436 3300014745 Ga0157377_10033055 Ga0157377_100330552 304
437 3300025907 Ga0207645_10006111 Ga0207645_100061113 304
438 3300025925 Ga0207650_10138872 Ga0207650_101388722 304
439 3300025926 Ga0207659_10062093 Ga0207659_100620932 304
440 3300025933 Ga0207706_10003615 Ga0207706_100036159 304
441 3300025942 Ga0207689_10006314 Ga0207689_100063143 304
442 3300025944 Ga0207661_10069300 Ga0207661_100693001 304
443 3300026089 Ga0207648_10012173 Ga0207648_100121736 304
444 3300026089 Ga0207648_10122287 Ga0207648_101222872 304
445 3300042007 Ga0439449_0012220 Ga0439449_0012220_1059_2018 304
446 3300049515 Ga0501292_010455 Ga0501292_010455_308_1318 304
447 3300049521 Ga0501298_003833 Ga0501298_003833_179_1189 304
448 3300049652 Ga0501202_001838 Ga0501202_001838_1934_2944 304
449 3300049654 Ga0501207_001425 Ga0501207_001425_1656_2666 304
450 3300049663 Ga0501223_004531 Ga0501223_004531_548_1558 304
451 3300049664 Ga0501224_003392 Ga0501224_003392_784_1794 304
452 3300049668 Ga0501233_007009 Ga0501233_007009_422_1432 304
453 3300049673 Ga0501240_011486 Ga0501240_011486_155_1165 304
454 3300049682 Ga0501252_002354 Ga0501252_002354_618_1628 304
455 3300049686 Ga0501257_027732 Ga0501257_027732_306_1316 304
456 3300049688 Ga0501259_006547 Ga0501259_006547_369_1379 304
457 3300049704 Ga0501221_001490 Ga0501221_001490_1236_2246 304
458 3300049705 Ga0501225_0006931 Ga0501225_0006931_2161_3171 304
459 3300049708 Ga0501245_002114 Ga0501245_002114_31_1041 304
460 3300049851 Ga0501212_013863 Ga0501212_013863_21_1031 304
461 3300005290 Ga0065712_10087397 Ga0065712_100873972 305
462 3300005331 Ga0070670_100155241 Ga0070670_1001552412 305
463 3300005985 Ga0081539_10020758 Ga0081539_100207583 305
464 3300013100 Ga0157373_10034606 Ga0157373_100346062 305
465 3300013105 Ga0157369_10238801 Ga0157369_102388011 305
466 3300013296 Ga0157374_10074831 Ga0157374_100748312 305
467 3300013306 Ga0163162_10196804 Ga0163162_101968042 305
468 3300013307 Ga0157372_10116658 Ga0157372_101166582 305
469 3300013308 Ga0157375_10229490 Ga0157375_102294903 305
470 3300014326 Ga0157380_10076226 Ga0157380_100762262 305
471 3300014326 Ga0157380_10258675 Ga0157380_102586751 305
472 3300025925 Ga0207650_10128637 Ga0207650_101286372 305
473 3300025926 Ga0207659_10025237 Ga0207659_100252371 305
474 3300049674 Ga0501242_006803 Ga0501242_006803_68_1087 305
475 3300049680 Ga0501250_000826 Ga0501250_000826_893_1912 305
476 3300049686 Ga0501257_016642 Ga0501257_016642_384_1403 305
477 3300049688 Ga0501259_001745 Ga0501259_001745_443_1462 305
478 3300049708 Ga0501245_012366 Ga0501245_012366_187_1206 305
479 3300049763 Ga0501266_003098 Ga0501266_003098_1015_2034 305
480 3300049767 Ga0501270_010297 Ga0501270_010297_198_1217 305
481 3300013102 Ga0157371_10052723 Ga0157371_100527231 306
482 3300013307 Ga0157372_10263420 Ga0157372_102634202 306
483 3300000044 ARSoilOldRDRAFT_c004130 ARSoilOldRDRAFT_0041302 308
484 3300005564 Ga0070664_100135677 Ga0070664_1001356772 308
485 3300005841 Ga0068863_100062318 Ga0068863_1000623182 308
486 3300025945 Ga0207679_10210980 Ga0207679_102109802 308
487 3300026089 Ga0207648_10150217 Ga0207648_101502172 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07485

DUF1529

Domain of Unknown Function (DUF1259)

214

333

0.98

PF07485

DUF1529

Domain of Unknown Function (DUF1259)

69

188

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bj3-assembly1.cif.gz_D nikr-apo 0.7193 228 293
7oyc-assembly1.cif.gz_v2 cryo-em structure of the xenopus egg 80s ribosome 0.6859 220 297
2p8z-assembly1.cif.gz_T fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp:sordarin cryo-em reconstruction 0.6811 230 297
2p8w-assembly1.cif.gz_T fitted structure of eef2 in the 80s:eef2:gdpnp cryo-em reconstruction 0.6811 230 297
7qri-assembly1.cif.gz_B regulatory domain dimer of tryptophan hydroxylase 2 in complex with l-phe 0.674 83 152
ID Description Score Start End Superfamily
af_I6X9E2_51_172_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9574 177 294 3.30.1460.10
af_I6X9E2_193_312_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9474 177 294 3.30.1460.10
af_I6X9E2_193_312_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9247 177 294 3.30.1460.10
af_I6X9E2_51_172_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9193 177 294 3.30.1460.10
af_K7LK48_364_621_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.832 233 278 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6G7J7U9-F1-model_v4 DUF1259 domain-containing protein 0.9941 26 297
AF-A0A2E8MYM2-F1-model_v4 deleted 0.9932 26 298
AF-A0A7K1U1J1-F1-model_v4 DUF1259 domain-containing protein 0.9903 27 297
AF-A0A522DYY4-F1-model_v4 DUF1259 domain-containing protein 0.9884 23 218
AF-A0A2V9LSU1-F1-model_v4 DUF1259 domain-containing protein 0.987 219 298

Feature Viewer

pLDDT pTM Quality
89.14 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map