F453398

General Info

Members Datasets Scaffolds Average Seq Length
487 264 487 351

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100066598|Ga0070690_1000665982
Length 377
Sequence MGSFVDSPPFNLSACPEKPLATSPAEFLTEQLRALLPASPDAYAQKLDPIRDAVLVIRFDAAAYRAASFLDDRILGPQTQGAWLPVGAVNEAVRGAAEGRIVHFIFHTGHVGSTLVSRLLDETGDVLSLREPLPLRTLADALDVLPLPESLLSSAQFGSRLEMFLRLWGRGYADTRRVVLKATSSAGRMAVPLLERSAASRAVYMNLRAEPYLAALLAGENSPSDLRGHGPGRIRRLQSRLHTPLAPLHELSIGELAAMSWLSESWAQHDAVESFRERLIALDFDDFLADVAAGMRTVLEHFGLTSDPPAVSRLMRSPVLTRYSKAPEYEYTPGTRAEVIAASRRANREEIRRGMAWLDRIAGSNSAVAAVANRQRP

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
261 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 3.29
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000209 3300003214 Bacteria 83865
2 Ga0065715_10156438 3300005293 Bacteria 1672
3 Ga0070676_10004000 3300005328 Bacteria 7735
4 Ga0070683_100316684 3300005329 Bacteria 1485
5 Ga0070690_100005497 3300005330 Bacteria 7123
6 Ga0070690_100066598 3300005330 Unclassified 2332
7 Ga0070670_100223466 3300005331 Unclassified 1639
8 Ga0070677_10002986 3300005333 Bacteria 5439
9 Ga0068869_100002962 3300005334 Bacteria 10311
10 Ga0068869_100093333 3300005334 Unclassified 2267
11 Ga0068869_100101383 3300005334 Bacteria 2178
12 Ga0070666_10002368 3300005335 Bacteria 11394
13 Ga0070666_10006815 3300005335 Bacteria 7039
14 Ga0070680_100000251 3300005336 Bacteria 35342
15 Ga0070680_100088897 3300005336 Bacteria 2556
16 Ga0070682_100114102 3300005337 Bacteria 1805
17 Ga0068868_100005127 3300005338 Bacteria 9201
18 Ga0068868_100021315 3300005338 Bacteria 4880
19 Ga0070689_100082696 3300005340 Unclassified 2522
20 Ga0070689_100216871 3300005340 Bacteria 1568
21 Ga0070661_100008937 3300005344 Bacteria 6933
22 Ga0070692_10054505 3300005345 Unclassified 2088
23 Ga0070668_100007181 3300005347 Bacteria 8260
24 Ga0070668_100053281 3300005347 Bacteria 3119
25 Ga0070669_100003327 3300005353 Bacteria 11553
26 Ga0070669_100133628 3300005353 Bacteria 1906
27 Ga0070675_100008080 3300005354 Bacteria 8156
28 Ga0070671_100062488 3300005355 Bacteria 3101
29 Ga0070671_100103912 3300005355 Bacteria 2384
30 Ga0070671_100196772 3300005355 Unclassified 1709
31 Ga0070674_100167291 3300005356 Bacteria 1673
32 Ga0070673_100000093 3300005364 Bacteria 39643
33 Ga0070673_100123730 3300005364 Bacteria 2162
34 Ga0070688_100000276 3300005365 Bacteria 26672
35 Ga0070659_100020509 3300005366 Bacteria 5022
36 Ga0070659_100095025 3300005366 Unclassified 2394
37 Ga0070667_100002945 3300005367 Bacteria 14630
38 Ga0070667_100047460 3300005367 Bacteria 3613
39 Ga0070667_100061634 3300005367 Bacteria 3176
40 Ga0070709_10021336 3300005434 Bacteria 3771
41 Ga0070713_100108949 3300005436 Bacteria 2412
42 Ga0070713_100166922 3300005436 Unclassified 1969
43 Ga0070710_10003227 3300005437 Bacteria 7720
44 Ga0070710_10057463 3300005437 Unclassified 2205
45 Ga0070701_10060402 3300005438 Bacteria 1996
46 Ga0070711_100010762 3300005439 Bacteria 5671
47 Ga0070700_100101578 3300005441 Bacteria 1895
48 Ga0070694_100075256 3300005444 Unclassified 2335
49 Ga0070708_100011041 3300005445 Bacteria 7336
50 Ga0070708_100390068 3300005445 Bacteria 1313
51 Ga0070678_100155371 3300005456 Bacteria 1847
52 Ga0070678_100162237 3300005456 Bacteria 1812
53 Ga0070662_100002869 3300005457 Bacteria 10691
54 Ga0070662_100061315 3300005457 Bacteria 2745
55 Ga0070662_100087524 3300005457 Unclassified 2332
56 Ga0070681_10000001 3300005458 Bacteria 946857
57 Ga0070681_10008821 3300005458 Bacteria 9902
58 Ga0070685_10000793 3300005466 Bacteria 17135
59 Ga0070685_10021719 3300005466 Bacteria 3491
60 Ga0070706_100029385 3300005467 Bacteria 5065
61 Ga0070706_100190084 3300005467 Bacteria 1918
62 Ga0070706_100315691 3300005467 Bacteria 1458
63 Ga0070707_100016272 3300005468 Bacteria 6981
64 Ga0070707_100023821 3300005468 Bacteria 5791
65 Ga0070699_100004973 3300005518 Bacteria 11719
66 Ga0070699_100056406 3300005518 Bacteria 3401
67 Ga0070679_100001250 3300005530 Bacteria 22400
68 Ga0070679_100010565 3300005530 Bacteria 8758
69 Ga0070679_100192312 3300005530 Bacteria 2009
70 Ga0070697_100008496 3300005536 Bacteria 8014
71 Ga0070697_100011058 3300005536 Bacteria 7052
72 Ga0068853_100040892 3300005539 Unclassified 3958
73 Ga0070672_100021424 3300005543 Bacteria 4729
74 Ga0070686_100065967 3300005544 Bacteria 2353
75 Ga0070686_100187654 3300005544 Unclassified 1473
76 Ga0070695_100003924 3300005545 Bacteria 8690
77 Ga0070696_100068064 3300005546 Unclassified 2499
78 Ga0070693_100000803 3300005547 Bacteria 13890
79 Ga0070693_100002719 3300005547 Bacteria 8135
80 Ga0070665_100007579 3300005548 Bacteria 11036
81 Ga0070665_100011618 3300005548 Bacteria 8903
82 Ga0070665_100060292 3300005548 Bacteria 3803
83 Ga0068855_100000032 3300005563 Bacteria 168335
84 Ga0068855_100012667 3300005563 Bacteria 10177
85 Ga0070664_100002473 3300005564 Bacteria 14879
86 Ga0070664_100035857 3300005564 Unclassified 4165
87 Ga0070664_100220718 3300005564 Unclassified 1696
88 Ga0068857_100004974 3300005577 Bacteria 11290
89 Ga0068857_100014206 3300005577 Bacteria 6935
90 Ga0068857_100154996 3300005577 Unclassified 2077
91 Ga0068854_100005371 3300005578 Bacteria 8089
92 Ga0068854_100043945 3300005578 Unclassified 3169
93 Ga0068856_100007782 3300005614 Bacteria 10471
94 Ga0070702_100023134 3300005615 Bacteria 3297
95 Ga0070702_100038595 3300005615 Unclassified 2661
96 Ga0068852_100019499 3300005616 Bacteria 5369
97 Ga0068852_100322482 3300005616 Bacteria 1501
98 Ga0068859_100007101 3300005617 Bacteria 11367
99 Ga0068864_100002824 3300005618 Bacteria 14328
100 Ga0068866_10001062 3300005718 Bacteria 12107
101 Ga0068866_10140978 3300005718 Bacteria 1384
102 Ga0068861_100002500 3300005719 Bacteria 11996
103 Ga0068861_100006241 3300005719 Bacteria 8108
104 Ga0068861_100040534 3300005719 Bacteria 3484
105 Ga0068861_100204393 3300005719 Bacteria 1660
106 Ga0068851_10068197 3300005834 Bacteria 1836
107 Ga0068870_10002466 3300005840 Bacteria 7709
108 Ga0068863_100001465 3300005841 Bacteria 23413
109 Ga0068863_100004298 3300005841 Bacteria 14031
110 Ga0068863_100370133 3300005841 Bacteria 1398
111 Ga0068858_100006714 3300005842 Bacteria 11195
112 Ga0068858_100015509 3300005842 Bacteria 7166
113 Ga0068858_100019499 3300005842 Bacteria 6342
114 Ga0068858_100117802 3300005842 Bacteria 2482
115 Ga0068860_100106723 3300005843 Bacteria 2675
116 Ga0068860_100217312 3300005843 Unclassified 1855
117 Ga0068862_100000444 3300005844 Bacteria 45032
118 Ga0068862_100018688 3300005844 Bacteria 5773
119 Ga0070716_100180404 3300006173 Bacteria 1386
120 Ga0070712_100001697 3300006175 Bacteria 13499
121 Ga0070712_100030712 3300006175 Bacteria 3615
122 Ga0097621_100174398 3300006237 Unclassified 1855
123 Ga0068871_100217449 3300006358 Bacteria 1654
124 Ga0075428_100000877 3300006844 Bacteria 31669
125 Ga0075428_100007914 3300006844 Bacteria 11782
126 Ga0075428_100018420 3300006844 Bacteria 7720
127 Ga0075428_100040811 3300006844 Bacteria 5104
128 Ga0075428_100042148 3300006844 Bacteria 5020
129 Ga0075428_100057303 3300006844 Bacteria 4265
130 Ga0075428_100333632 3300006844 Bacteria 1629
131 Ga0075428_100358019 3300006844 Bacteria 1566
132 Ga0075430_100018228 3300006846 Bacteria 5975
133 Ga0075430_100152144 3300006846 Unclassified 1927
134 Ga0075430_100205258 3300006846 Bacteria 1636
135 Ga0075431_100000544 3300006847 Bacteria 31685
136 Ga0075431_100008278 3300006847 Bacteria 10398
137 Ga0075431_100026534 3300006847 Bacteria 5943
138 Ga0075431_100079817 3300006847 Bacteria 3378
139 Ga0075431_100103786 3300006847 Unclassified 2934
140 Ga0075433_10017881 3300006852 Bacteria 5881
141 Ga0075433_10132964 3300006852 Bacteria 2211
142 Ga0075434_100003190 3300006871 Bacteria 14628
143 Ga0075434_100019940 3300006871 Bacteria 6494
144 Ga0075429_100005178 3300006880 Bacteria 11217
145 Ga0075429_100011888 3300006880 Bacteria 7549
146 Ga0075429_100090701 3300006880 Unclassified 2666
147 Ga0075429_100130984 3300006880 Bacteria 2194
148 Ga0068865_100001893 3300006881 Bacteria 12305
149 Ga0068865_100112502 3300006881 Unclassified 2011
150 Ga0068865_100171086 3300006881 Bacteria 1665
151 Ga0068865_100305603 3300006881 Bacteria 1275
152 Ga0075436_100083935 3300006914 Bacteria 2211
153 Ga0097620_100007101 3300006931 Bacteria 11367
154 Ga0075435_100009355 3300007076 Bacteria 7087
155 Ga0075435_100020144 3300007076 Bacteria 5104
156 Ga0075435_100072106 3300007076 Unclassified 2821
157 Ga0105240_10002548 3300009093 Bacteria 29222
158 Ga0105240_10026611 3300009093 Bacteria 7591
159 Ga0105240_10092410 3300009093 Bacteria 3695
160 Ga0105240_10104620 3300009093 Unclassified 3437
161 Ga0111539_10007604 3300009094 Bacteria 13845
162 Ga0111539_10011478 3300009094 Bacteria 11119
163 Ga0111539_10030246 3300009094 Bacteria 6585
164 Ga0111539_10031518 3300009094 Bacteria 6439
165 Ga0105245_10008789 3300009098 Bacteria 8810
166 Ga0105245_10013055 3300009098 Bacteria 7237
167 Ga0105245_10013246 3300009098 Bacteria 7186
168 Ga0105247_10010520 3300009101 Bacteria 5591
169 Ga0105247_10023040 3300009101 Bacteria 3750
170 Ga0105247_10096618 3300009101 Bacteria 1883
171 Ga0114129_10024009 3300009147 Bacteria 8642
172 Ga0114129_10063753 3300009147 Bacteria 5144
173 Ga0105243_10025164 3300009148 Bacteria 4546
174 Ga0105241_10004711 3300009174 Bacteria 10064
175 Ga0105241_10012094 3300009174 Bacteria 6338
176 Ga0105241_10027083 3300009174 Bacteria 4267
177 Ga0105241_10133934 3300009174 Bacteria 2010
178 Ga0105242_10023678 3300009176 Bacteria 4841
179 Ga0105242_10029321 3300009176 Bacteria 4388
180 Ga0105242_10070447 3300009176 Unclassified 2899
181 Ga0105242_10082735 3300009176 Unclassified 2687
182 Ga0105248_10004440 3300009177 Bacteria 15538
183 Ga0105248_10009722 3300009177 Bacteria 10591
184 Ga0105248_10032414 3300009177 Bacteria 5839
185 Ga0105248_10070286 3300009177 Bacteria 3931
186 Ga0105237_10049368 3300009545 Bacteria 4230
187 Ga0105237_10255583 3300009545 Bacteria 1754
188 Ga0105238_10015669 3300009551 Bacteria 7674
189 Ga0105238_10016704 3300009551 Bacteria 7436
190 Ga0105249_10069988 3300009553 Unclassified 3239
191 Ga0105249_10101921 3300009553 Bacteria 2701
192 Ga0105249_10143834 3300009553 Bacteria 2289
193 Ga0105239_10002225 3300010375 Bacteria 24899
194 Ga0105239_10006084 3300010375 Bacteria 14051
195 Ga0105239_10011114 3300010375 Bacteria 10048
196 Ga0105239_10307773 3300010375 Bacteria 1785
197 Ga0157373_10008821 3300013100 Bacteria 7470
198 Ga0157369_10008880 3300013105 Bacteria 11514
199 Ga0157369_10043765 3300013105 Bacteria 4879
200 Ga0157369_10166085 3300013105 Bacteria 2328
201 Ga0157374_10000101 3300013296 Bacteria 79331
202 Ga0157374_10018951 3300013296 Bacteria 6086
203 Ga0157374_10072217 3300013296 Bacteria 3256
204 Ga0157378_10019510 3300013297 Bacteria 5961
205 Ga0157378_10020523 3300013297 Bacteria 5809
206 Ga0157378_10145616 3300013297 Unclassified 2203
207 Ga0157378_10439532 3300013297 Unclassified 1293
208 Ga0163162_10002363 3300013306 Bacteria 17730
209 Ga0163162_10004568 3300013306 Bacteria 13337
210 Ga0163162_10042345 3300013306 Bacteria 4557
211 Ga0163162_10095816 3300013306 Bacteria 3055
212 Ga0163162_10109179 3300013306 Bacteria 2863
213 Ga0157372_10007675 3300013307 Bacteria 11476
214 Ga0157375_10010351 3300013308 Bacteria 8211
215 Ga0157375_10027818 3300013308 Bacteria 5290
216 Ga0157375_10083872 3300013308 Bacteria 3233
217 Ga0157375_10095338 3300013308 Bacteria 3046
218 Ga0163163_10001987 3300014325 Bacteria 17292
219 Ga0163163_10051502 3300014325 Bacteria 4060
220 Ga0157380_10001965 3300014326 Bacteria 13683
221 Ga0157377_10004524 3300014745 Bacteria 6417
222 Ga0157377_10022483 3300014745 Bacteria 3329
223 Ga0157379_10000336 3300014968 Bacteria 37683
224 Ga0157379_10013356 3300014968 Bacteria 7192
225 Ga0157379_10092670 3300014968 Unclassified 2710
226 Ga0157376_10005793 3300014969 Bacteria 8660
227 Ga0157376_10008441 3300014969 Bacteria 7434
228 Ga0157376_10064592 3300014969 Bacteria 3088
229 Ga0157376_10346787 3300014969 Bacteria 1420
230 Ga0163161_10008179 3300017792 Bacteria 7235
231 Ga0163161_10032520 3300017792 Bacteria 3725
232 Ga0163161_10122501 3300017792 Bacteria 1955
233 Ga0213876_10000264 3300021384 Bacteria 48604
234 Ga0209233_1000013 3300025261 Bacteria 1013785
235 Ga0207692_10066710 3300025898 Bacteria 1882
236 Ga0207710_10101195 3300025900 Unclassified 1359
237 Ga0207680_10020949 3300025903 Bacteria 3530
238 Ga0207645_10000519 3300025907 Bacteria 31964
239 Ga0207645_10003186 3300025907 Bacteria 12555
240 Ga0207684_10229846 3300025910 Bacteria 1600
241 Ga0207684_10292130 3300025910 Bacteria 1405
242 Ga0207654_10052577 3300025911 Bacteria 2348
243 Ga0207707_10000048 3300025912 Bacteria 117799
244 Ga0207707_10005164 3300025912 Bacteria 11442
245 Ga0207695_10000018 3300025913 Bacteria 766611
246 Ga0207695_10047604 3300025913 Unclassified 4535
247 Ga0207693_10000069 3300025915 Bacteria 90103
248 Ga0207693_10014778 3300025915 Bacteria 6271
249 Ga0207693_10044544 3300025915 Bacteria 3488
250 Ga0207663_10008985 3300025916 Bacteria 5260
251 Ga0207660_10000122 3300025917 Bacteria 45383
252 Ga0207660_10019483 3300025917 Bacteria 4536
253 Ga0207662_10011318 3300025918 Bacteria 4943
254 Ga0207657_10005709 3300025919 Bacteria 12990
255 Ga0207649_10005567 3300025920 Bacteria 6812
256 Ga0207652_10000502 3300025921 Bacteria 39810
257 Ga0207652_10057090 3300025921 Unclassified 3361
258 Ga0207646_10010339 3300025922 Bacteria 9130
259 Ga0207694_10000005 3300025924 Bacteria 823704
260 Ga0207650_10014595 3300025925 Bacteria 5457
261 Ga0207650_10014702 3300025925 Bacteria 5440
262 Ga0207650_10019208 3300025925 Bacteria 4800
263 Ga0207659_10083840 3300025926 Bacteria 2364
264 Ga0207687_10000293 3300025927 Bacteria 34325
265 Ga0207700_10065688 3300025928 Unclassified 2769
266 Ga0207644_10004459 3300025931 Bacteria 9089
267 Ga0207690_10206194 3300025932 Bacteria 1496
268 Ga0207706_10003660 3300025933 Bacteria 14686
269 Ga0207706_10003690 3300025933 Bacteria 14613
270 Ga0207706_10012004 3300025933 Bacteria 7892
271 Ga0207706_10125511 3300025933 Unclassified 2257
272 Ga0207686_10003736 3300025934 Bacteria 8168
273 Ga0207686_10009426 3300025934 Bacteria 5295
274 Ga0207670_10013499 3300025936 Bacteria 4820
275 Ga0207670_10174150 3300025936 Bacteria 1616
276 Ga0207704_10030467 3300025938 Bacteria 3025
277 Ga0207704_10127660 3300025938 Bacteria 1754
278 Ga0207665_10057822 3300025939 Bacteria 2620
279 Ga0207691_10002302 3300025940 Bacteria 18712
280 Ga0207691_10009801 3300025940 Bacteria 9197
281 Ga0207691_10029213 3300025940 Bacteria 5157
282 Ga0207691_10081064 3300025940 Unclassified 2918
283 Ga0207711_10000164 3300025941 Bacteria 71542
284 Ga0207689_10073814 3300025942 Unclassified 2803
285 Ga0207679_10015584 3300025945 Bacteria 5028
286 Ga0207679_10022968 3300025945 Unclassified 4257
287 Ga0207667_10000011 3300025949 Bacteria 447785
288 Ga0207667_10008828 3300025949 Bacteria 11930
289 Ga0207712_10003697 3300025961 Bacteria 9652
290 Ga0207668_10012197 3300025972 Bacteria 5253
291 Ga0207640_10005719 3300025981 Bacteria 6775
292 Ga0207640_10052277 3300025981 Unclassified 2660
293 Ga0207677_10000092 3300026023 Bacteria 73792
294 Ga0207677_10108114 3300026023 Unclassified 2064
295 Ga0207703_10000506 3300026035 Bacteria 40394
296 Ga0207703_10014040 3300026035 Bacteria 6242
297 Ga0207703_10075691 3300026035 Bacteria 2791
298 Ga0207708_10039008 3300026075 Bacteria 3618
299 Ga0207708_10131105 3300026075 Bacteria 1960
300 Ga0207702_10005357 3300026078 Bacteria 11241
301 Ga0207641_10003625 3300026088 Bacteria 13621
302 Ga0207648_10002591 3300026089 Bacteria 19359
303 Ga0207648_10007290 3300026089 Bacteria 10900
304 Ga0207648_10010404 3300026089 Bacteria 8819
305 Ga0207648_10060157 3300026089 Bacteria 3313
306 Ga0207674_10004739 3300026116 Bacteria 16307
307 Ga0207674_10010887 3300026116 Bacteria 10247
308 Ga0207675_100005028 3300026118 Bacteria 12739
309 Ga0207675_100005404 3300026118 Bacteria 12239
310 Ga0207675_100015576 3300026118 Bacteria 7092
311 Ga0207675_100066610 3300026118 Bacteria 3367
312 Ga0207683_10000827 3300026121 Bacteria 28309
313 Ga0207683_10004272 3300026121 Bacteria 12334
314 Ga0207683_10010567 3300026121 Bacteria 7877
315 Ga0207683_10017048 3300026121 Bacteria 6182
316 Ga0207698_10181082 3300026142 Unclassified 1867
317 Ga0209983_1001601 3300027665 Bacteria 5010
318 Ga0209998_10004303 3300027717 Bacteria 3032
319 Ga0207428_10001433 3300027907 Bacteria 25077
320 Ga0207428_10031036 3300027907 Bacteria 4415
321 Ga0207428_10067182 3300027907 Bacteria 2823
322 Ga0268266_10016563 3300028379 Bacteria 6298
323 Ga0268265_10023659 3300028380 Bacteria 4333
324 Ga0268265_10033604 3300028380 Bacteria 3730
325 Ga0268265_10147527 3300028380 Bacteria 1979
326 Ga0268264_10022242 3300028381 Bacteria 5177
327 Ga0268264_10303681 3300028381 Bacteria 1503
328 Ga0265318_10000015 3300028577 Bacteria 187234
329 Ga0265338_10090545 3300028800 Unclassified 2531
330 Ga0265330_10104011 3300031235 Bacteria 1215
331 Ga0265332_10000179 3300031238 Bacteria 52359
332 Ga0265332_10088490 3300031238 Bacteria 1310
333 Ga0265331_10000865 3300031250 Bacteria 24639
334 Ga0265331_10018131 3300031250 Unclassified 3656
335 Ga0265316_10017799 3300031344 Bacteria 6126
336 Ga0307408_100031427 3300031548 Unclassified 3697
337 Ga0265313_10091769 3300031595 Bacteria 1362
338 Ga0265314_10013548 3300031711 Bacteria 6580
339 Ga0265314_10057547 3300031711 Viruses 2669
340 Ga0307516_10076121 3300031730 Bacteria 3209
341 Ga0307405_10003438 3300031731 Bacteria 7272
342 Ga0307405_10070536 3300031731 Unclassified 2245
343 Ga0307410_10001595 3300031852 Bacteria 10400
344 Ga0307410_10210540 3300031852 Bacteria 1489
345 Ga0307406_10078160 3300031901 Bacteria 2191
346 Ga0307406_10139445 3300031901 Unclassified 1714
347 Ga0307407_10026988 3300031903 Unclassified 3049
348 Ga0307412_10008572 3300031911 Bacteria 5843
349 Ga0307409_100005580 3300031995 Bacteria 7272
350 Ga0307416_100001112 3300032002 Bacteria 14440
351 Ga0307414_10210348 3300032004 Unclassified 1589
352 Ga0307411_10000563 3300032005 Bacteria 13225
353 Ga0307415_100000772 3300032126 Bacteria 14475
354 Ga0307415_100196296 3300032126 Bacteria 1597
355 Ga0373923_0000314 3300035111 Bacteria 10804
356 Ga0373936_0009664 3300035113 Unclassified 3636
357 Ga0373945_0013264 3300035116 Unclassified 2748
358 Ga0373953_0010090 3300035117 Bacteria 3274
359 Ga0373953_0089035 3300035117 Unclassified 1290
360 Ga0373956_0008049 3300035119 Bacteria 4262
361 Ga0373956_0055577 3300035119 Bacteria 1786
362 Ga0373957_0000406 3300035120 Bacteria 10928
363 Ga0373943_0001963 3300035170 Bacteria 9307
364 Ga0373943_0014910 3300035170 Bacteria 3527
365 Ga0373943_0086624 3300035170 Bacteria 1615
366 Ga0373946_0024737 3300035171 Bacteria 2356
367 Ga0373955_0027072 3300035172 Unclassified 2960
368 Ga0373955_0110451 3300035172 Bacteria 1589
369 Ga0373924_0013897 3300035410 Bacteria 3032
370 Ga0373927_0017225 3300035695 Bacteria 4760
371 Ga0373927_0029128 3300035695 Bacteria 3598
372 Ga0373933_0002291 3300035724 Bacteria 10892
373 Ga0373933_0057362 3300035724 Unclassified 2340
374 Ga0373947_0028891 3300035725 Unclassified 3252
375 Ga0373947_0042830 3300035725 Bacteria 2703
376 Ga0373937_0006497 3300036401 Bacteria 10089
377 Ga0373937_0006500 3300036401 Bacteria 10087
378 Ga0373937_0020919 3300036401 Bacteria 5869
379 Ga0373937_0215038 3300036401 Unclassified 1809
380 Ga0373925_0008011 3300037068 Bacteria 7694
381 Ga0373925_0014292 3300037068 Bacteria 5743
382 Ga0373925_0040352 3300037068 Bacteria 3456
383 Ga0373925_0157854 3300037068 Unclassified 1785
384 Ga0395899_0015619 3300037312 Bacteria 5789
385 Ga0395900_0037156 3300037418 Bacteria 5022
386 Ga0436365_1196036 3300039437 Bacteria 119165
387 Ga0436363_0375975 3300039450 Bacteria 36949
388 Ga0439439_0065453 3300041406 Bacteria 969
389 Ga0439448_0045156 3300042005 Bacteria 1434
390 Ga0439446_0028122 3300042156 Unclassified 1617
391 Ga0439434_0004884 3300042435 Bacteria 3923
392 Ga0439444_0003353 3300042437 Unclassified 2260
393 Ga0495629_0044111 3300046459 Unclassified 3130
394 Ga0495638_0007310 3300046460 Bacteria 7936
395 Ga0495580_0041376 3300046472 Bacteria 3286
396 Ga0495580_0044816 3300046472 Bacteria 3144
397 Ga0495580_0189826 3300046472 Unclassified 1417
398 Ga0495639_0003377 3300046475 Bacteria 6918
399 Ga0495630_0120756 3300046517 Bacteria 1988
400 Ga0495621_0002582 3300046539 Bacteria 4886
401 Ga0495645_0044691 3300046543 Bacteria 3231
402 Ga0495625_0016672 3300046660 Bacteria 5772
403 Ga0495635_0008503 3300046663 Bacteria 7171
404 Ga0495623_0051961 3300046679 Unclassified 2591
405 Ga0495647_0049534 3300046681 Bacteria 1627
406 Ga0495613_0166746 3300046689 Unclassified 1564
407 Ga0495600_0045779 3300046809 Unclassified 2855
408 Ga0495581_0056346 3300047315 Unclassified 2268
409 Ga0495684_0302675 3300047471 Unclassified 1148
410 Ga0495593_0025369 3300047673 Unclassified 3281
411 Ga0496100_0057812 3300048903 Bacteria 2542
412 Ga0496102_0164295 3300048905 Bacteria 2089
413 Ga0496103_0142096 3300048906 Unclassified 1535
414 Ga0496104_0000858 3300048907 Bacteria 26186
415 Ga0496104_0066108 3300048907 Bacteria 3432
416 Ga0496106_0044881 3300048909 Bacteria 3319
417 Ga0496106_0056731 3300048909 Bacteria 2961
418 Ga0496108_0015061 3300048911 Bacteria 6313
419 Ga0496108_0076945 3300048911 Bacteria 2821
420 Ga0496109_0059822 3300048912 Bacteria 3481
421 Ga0496110_0153169 3300048913 Bacteria 2088
422 Ga0496111_0003521 3300048914 Bacteria 9689
423 Ga0496112_0027219 3300048915 Bacteria 5513
424 Ga0496112_0049036 3300048915 Unclassified 4139
425 Ga0496112_0212217 3300048915 Bacteria 1893
426 Ga0496114_0019703 3300048917 Bacteria 5467
427 Ga0496118_0077146 3300048921 Bacteria 2365
428 Ga0495682_0005816 3300049460 Bacteria 5069
429 Ga0501036_0006052 3300049572 Bacteria 9812
430 Ga0501036_0152891 3300049572 Bacteria 1946
431 Ga0501037_0094413 3300049573 Unclassified 2163
432 Ga0501039_0002245 3300049575 Bacteria 14318
433 Ga0501040_0004068 3300049576 Bacteria 9509
434 Ga0501040_0018139 3300049576 Bacteria 4675
435 Ga0501040_0094513 3300049576 Bacteria 2080
436 Ga0501042_0158034 3300049578 Bacteria 1635
437 Ga0501046_0031133 3300049580 Bacteria 4328
438 Ga0501046_0117812 3300049580 Unclassified 2023
439 Ga0501048_0197852 3300049582 Bacteria 1424
440 Ga0501067_0010741 3300049583 Bacteria 5065
441 Ga0501071_0126930 3300049587 Unclassified 1894
442 Ga0501072_0021294 3300049588 Bacteria 5028
443 Ga0501072_0039249 3300049588 Bacteria 3718
444 Ga0501073_0003874 3300049589 Bacteria 11234
445 Ga0501075_0013253 3300049591 Bacteria 5880
446 Ga0501075_0041354 3300049591 Bacteria 3454
447 Ga0501076_0107660 3300049592 Bacteria 2251
448 Ga0501076_0360981 3300049592 Bacteria 1193
449 Ga0501077_0004095 3300049593 Bacteria 8799
450 Ga0501079_0191731 3300049741 Bacteria 1595
451 Ga0501080_0025414 3300049742 Bacteria 5496
452 Ga0501045_0003160 3300049824 Bacteria 11256
453 Ga0501045_0027070 3300049824 Bacteria 4129
454 Ga0501045_0112683 3300049824 Bacteria 2017
455 nmdc:mga05p37_593770_c1 3300050507 Unclassified 1251
456 nmdc:mga09592_101073_c1 3300050508 Unclassified 2470
457 nmdc:mga09592_3846_c1 3300050508 Bacteria 12087
458 nmdc:mga09592_53371_c1 3300050508 Bacteria 3413
459 nmdc:mga09592_82055_c1 3300050508 Bacteria 2748
460 nmdc:mga0qj67_2416_c1 3300050509 Bacteria 13306
461 nmdc:mga0qj67_317992_c1 3300050509 Bacteria 1260
462 nmdc:mga0qj67_42267_c1 3300050509 Unclassified 3588
463 nmdc:mga06r32_12468_c1 3300050510 Bacteria 7672
464 nmdc:mga06r32_14649_c1 3300050510 Bacteria 7118
465 nmdc:mga06r32_28592_c1 3300050510 Bacteria 5219
466 nmdc:mga06r32_344991_c1 3300050510 Unclassified 1474
467 nmdc:mga06r32_84216_c1 3300050510 Unclassified 3099
468 nmdc:mga06r32_8_c1 3300050510 Bacteria 120971
469 nmdc:mga06r32_94595_c1 3300050510 Bacteria 2923
470 nmdc:mga08y16_1386_c1 3300050511 Bacteria 24240
471 nmdc:mga08y16_6546_c1 3300050511 Bacteria 12212
472 nmdc:mga0n895_27402_c1 3300050512 Bacteria 5413
473 nmdc:mga0n895_4038_c1 3300050512 Bacteria 11941
474 nmdc:mga0rr50_15004_c1 3300050513 Bacteria 5103
475 nmdc:mga0rr50_22801_c1 3300050513 Bacteria 4303
476 nmdc:mga0rr50_26145_c1 3300050513 Unclassified 4067
477 nmdc:mga08x19_5947_c1 3300050514 Bacteria 7219
478 nmdc:mga0a205_3120_c1 3300050515 Bacteria 14709
479 nmdc:mga0a205_47355_c1 3300050515 Unclassified 4148
480 Ga0495619_0019783 3300053085 Bacteria 4283
481 Ga0495619_0076307 3300053085 Unclassified 2250
482 Ga0500583_0016167 3300053092 Unclassified 2973
483 Ga0500588_0038283 3300053146 Bacteria 1429
484 Ga0501084_0011756 3300054114 Bacteria 7248
485 Ga0501084_0053774 3300054114 Bacteria 3368
486 Ga0501082_0404597 3300060353 Bacteria 1191
487 Ga0530510_0152439 3300061734 Bacteria 1707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0065453 Ga0439439_0065453_23_949 283
2 3300049583 Ga0501067_0010741 Ga0501067_0010741_30_986 294
3 3300025910 Ga0207684_10292130 Ga0207684_102921302 300
4 3300025932 Ga0207690_10206194 Ga0207690_102061941 300
5 3300049587 Ga0501071_0126930 Ga0501071_0126930_27_1004 300
6 3300035172 Ga0373955_0027072 Ga0373955_0027072_959_1981 309
7 3300009176 Ga0105242_10070447 Ga0105242_100704472 311
8 3300025934 Ga0207686_10009426 Ga0207686_100094264 311
9 3300035724 Ga0373933_0057362 Ga0373933_0057362_15_1025 311
10 3300021384 Ga0213876_10000264 Ga0213876_1000026441 312
11 3300039437 Ga0436365_1196036 Ga0436365_1196036_95136_96125 312
12 3300048905 Ga0496102_0164295 Ga0496102_0164295_665_1687 314
13 3300009093 Ga0105240_10026611 Ga0105240_100266115 315
14 3300049580 Ga0501046_0031133 Ga0501046_0031133_855_1850 315
15 3300054114 Ga0501084_0011756 Ga0501084_0011756_1373_2347 315
16 3300060353 Ga0501082_0404597 Ga0501082_0404597_80_1054 315
17 3300005530 Ga0070679_100192312 Ga0070679_1001923123 316
18 3300037312 Ga0395899_0015619 Ga0395899_0015619_314_1318 316
19 3300037418 Ga0395900_0037156 Ga0395900_0037156_98_1102 316
20 3300005331 Ga0070670_100223466 Ga0070670_1002234662 317
21 3300049572 Ga0501036_0152891 Ga0501036_0152891_794_1837 317
22 3300005336 Ga0070680_100000251 Ga0070680_1000002519 318
23 3300005458 Ga0070681_10000001 Ga0070681_10000001224 318
24 3300005530 Ga0070679_100001250 Ga0070679_10000125012 318
25 3300010375 Ga0105239_10006084 Ga0105239_100060844 318
26 3300013297 Ga0157378_10439532 Ga0157378_104395322 318
27 3300025912 Ga0207707_10000048 Ga0207707_1000004890 318
28 3300025917 Ga0207660_10000122 Ga0207660_1000012227 318
29 3300025921 Ga0207652_10000502 Ga0207652_1000050234 318
30 3300028577 Ga0265318_10000015 Ga0265318_100000153 318
31 3300005436 Ga0070713_100166922 Ga0070713_1001669222 319
32 3300036401 Ga0373937_0215038 Ga0373937_0215038_432_1430 319
33 3300005335 Ga0070666_10002368 Ga0070666_100023684 320
34 3300005367 Ga0070667_100061634 Ga0070667_1000616342 320
35 3300005436 Ga0070713_100108949 Ga0070713_1001089492 320
36 3300005437 Ga0070710_10057463 Ga0070710_100574632 320
37 3300005456 Ga0070678_100162237 Ga0070678_1001622372 320
38 3300005718 Ga0068866_10140978 Ga0068866_101409782 320
39 3300005841 Ga0068863_100370133 Ga0068863_1003701332 320
40 3300005842 Ga0068858_100117802 Ga0068858_1001178022 320
41 3300005843 Ga0068860_100106723 Ga0068860_1001067232 320
42 3300006173 Ga0070716_100180404 Ga0070716_1001804042 320
43 3300006175 Ga0070712_100030712 Ga0070712_1000307123 320
44 3300006844 Ga0075428_100333632 Ga0075428_1003336322 320
45 3300009094 Ga0111539_10011478 Ga0111539_100114786 320
46 3300009101 Ga0105247_10023040 Ga0105247_100230402 320
47 3300009177 Ga0105248_10032414 Ga0105248_100324143 320
48 3300009545 Ga0105237_10255583 Ga0105237_102555831 320
49 3300013296 Ga0157374_10072217 Ga0157374_100722172 320
50 3300014969 Ga0157376_10064592 Ga0157376_100645922 320
51 3300025898 Ga0207692_10066710 Ga0207692_100667103 320
52 3300025903 Ga0207680_10020949 Ga0207680_100209494 320
53 3300025915 Ga0207693_10044544 Ga0207693_100445443 320
54 3300025939 Ga0207665_10057822 Ga0207665_100578223 320
55 3300026116 Ga0207674_10004739 Ga0207674_100047396 320
56 3300027907 Ga0207428_10067182 Ga0207428_100671823 320
57 3300028381 Ga0268264_10303681 Ga0268264_103036811 320
58 3300028800 Ga0265338_10090545 Ga0265338_100905452 320
59 3300031235 Ga0265330_10104011 Ga0265330_101040111 320
60 3300031238 Ga0265332_10088490 Ga0265332_100884902 320
61 3300031711 Ga0265314_10013548 Ga0265314_100135484 320
62 3300035119 Ga0373956_0055577 Ga0373956_0055577_501_1562 320
63 3300035170 Ga0373943_0086624 Ga0373943_0086624_198_1259 320
64 3300035172 Ga0373955_0110451 Ga0373955_0110451_98_1159 320
65 3300036401 Ga0373937_0020919 Ga0373937_0020919_4518_5579 320
66 3300037068 Ga0373925_0040352 Ga0373925_0040352_1721_2782 320
67 3300046472 Ga0495580_0041376 Ga0495580_0041376_1265_2326 320
68 3300046517 Ga0495630_0120756 Ga0495630_0120756_414_1475 320
69 3300048907 Ga0496104_0066108 Ga0496104_0066108_930_1991 320
70 3300048909 Ga0496106_0044881 Ga0496106_0044881_173_1234 320
71 3300048911 Ga0496108_0015061 Ga0496108_0015061_4035_5084 320
72 3300048912 Ga0496109_0059822 Ga0496109_0059822_1639_2700 320
73 3300048914 Ga0496111_0003521 Ga0496111_0003521_6763_7824 320
74 3300048917 Ga0496114_0019703 Ga0496114_0019703_1363_2424 320
75 3300050511 nmdc:mga08y16_6546_c1 nmdc:mga08y16_6546_c1_8845_9891 320
76 3300005329 Ga0070683_100316684 Ga0070683_1003166842 321
77 3300005330 Ga0070690_100005497 Ga0070690_1000054978 321
78 3300005334 Ga0068869_100093333 Ga0068869_1000933331 321
79 3300005334 Ga0068869_100101383 Ga0068869_1001013832 321
80 3300005336 Ga0070680_100088897 Ga0070680_1000888973 321
81 3300005337 Ga0070682_100114102 Ga0070682_1001141022 321
82 3300005338 Ga0068868_100021315 Ga0068868_1000213155 321
83 3300005355 Ga0070671_100196772 Ga0070671_1001967721 321
84 3300005364 Ga0070673_100000093 Ga0070673_10000009310 321
85 3300005365 Ga0070688_100000276 Ga0070688_10000027623 321
86 3300005366 Ga0070659_100020509 Ga0070659_1000205091 321
87 3300005367 Ga0070667_100047460 Ga0070667_1000474603 321
88 3300005434 Ga0070709_10021336 Ga0070709_100213362 321
89 3300005437 Ga0070710_10003227 Ga0070710_100032273 321
90 3300005439 Ga0070711_100010762 Ga0070711_1000107622 321
91 3300005445 Ga0070708_100390068 Ga0070708_1003900681 321
92 3300005456 Ga0070678_100155371 Ga0070678_1001553712 321
93 3300005457 Ga0070662_100002869 Ga0070662_10000286915 321
94 3300005466 Ga0070685_10000793 Ga0070685_100007936 321
95 3300005467 Ga0070706_100315691 Ga0070706_1003156912 321
96 3300005468 Ga0070707_100023821 Ga0070707_1000238213 321
97 3300005518 Ga0070699_100056406 Ga0070699_1000564063 321
98 3300005536 Ga0070697_100008496 Ga0070697_1000084965 321
99 3300005539 Ga0068853_100040892 Ga0068853_1000408922 321
100 3300005543 Ga0070672_100021424 Ga0070672_1000214245 321
101 3300005544 Ga0070686_100065967 Ga0070686_1000659673 321
102 3300005547 Ga0070693_100000803 Ga0070693_1000008034 321
103 3300005548 Ga0070665_100011618 Ga0070665_1000116182 321
104 3300005563 Ga0068855_100000032 Ga0068855_100000032134 321
105 3300005564 Ga0070664_100220718 Ga0070664_1002207182 321
106 3300005578 Ga0068854_100005371 Ga0068854_1000053715 321
107 3300005615 Ga0070702_100038595 Ga0070702_1000385952 321
108 3300005616 Ga0068852_100019499 Ga0068852_1000194993 321
109 3300005616 Ga0068852_100322482 Ga0068852_1003224821 321
110 3300005617 Ga0068859_100007101 Ga0068859_1000071012 321
111 3300005618 Ga0068864_100002824 Ga0068864_10000282410 321
112 3300005718 Ga0068866_10001062 Ga0068866_100010629 321
113 3300005834 Ga0068851_10068197 Ga0068851_100681971 321
114 3300005840 Ga0068870_10002466 Ga0068870_100024665 321
115 3300005841 Ga0068863_100004298 Ga0068863_1000042988 321
116 3300005842 Ga0068858_100006714 Ga0068858_1000067142 321
117 3300005843 Ga0068860_100217312 Ga0068860_1002173121 321
118 3300006175 Ga0070712_100001697 Ga0070712_10000169714 321
119 3300006237 Ga0097621_100174398 Ga0097621_1001743982 321
120 3300006358 Ga0068871_100217449 Ga0068871_1002174492 321
121 3300006881 Ga0068865_100305603 Ga0068865_1003056031 321
122 3300006931 Ga0097620_100007101 Ga0097620_1000071012 321
123 3300007076 Ga0075435_100072106 Ga0075435_1000721063 321
124 3300009093 Ga0105240_10002548 Ga0105240_100025489 321
125 3300009101 Ga0105247_10096618 Ga0105247_100966182 321
126 3300009551 Ga0105238_10015669 Ga0105238_100156692 321
127 3300010375 Ga0105239_10002225 Ga0105239_100022259 321
128 3300010375 Ga0105239_10307773 Ga0105239_103077732 321
129 3300013105 Ga0157369_10008880 Ga0157369_100088804 321
130 3300013105 Ga0157369_10166085 Ga0157369_101660853 321
131 3300013297 Ga0157378_10145616 Ga0157378_101456163 321
132 3300017792 Ga0163161_10008179 Ga0163161_100081794 321
133 3300025900 Ga0207710_10101195 Ga0207710_101011952 321
134 3300025913 Ga0207695_10000018 Ga0207695_10000018730 321
135 3300025915 Ga0207693_10000069 Ga0207693_1000006946 321
136 3300025915 Ga0207693_10014778 Ga0207693_100147785 321
137 3300025916 Ga0207663_10008985 Ga0207663_100089853 321
138 3300025919 Ga0207657_10005709 Ga0207657_1000570910 321
139 3300025924 Ga0207694_10000005 Ga0207694_10000005178 321
140 3300025925 Ga0207650_10014595 Ga0207650_100145955 321
141 3300025927 Ga0207687_10000293 Ga0207687_1000029313 321
142 3300025928 Ga0207700_10065688 Ga0207700_100656882 321
143 3300025931 Ga0207644_10004459 Ga0207644_100044592 321
144 3300025933 Ga0207706_10003660 Ga0207706_100036608 321
145 3300025934 Ga0207686_10003736 Ga0207686_100037365 321
146 3300025938 Ga0207704_10030467 Ga0207704_100304673 321
147 3300025940 Ga0207691_10081064 Ga0207691_100810643 321
148 3300025941 Ga0207711_10000164 Ga0207711_1000016456 321
149 3300025942 Ga0207689_10073814 Ga0207689_100738142 321
150 3300025949 Ga0207667_10000011 Ga0207667_10000011405 321
151 3300025981 Ga0207640_10052277 Ga0207640_100522772 321
152 3300026023 Ga0207677_10000092 Ga0207677_1000009214 321
153 3300026023 Ga0207677_10108114 Ga0207677_101081142 321
154 3300026035 Ga0207703_10000506 Ga0207703_100005068 321
155 3300026088 Ga0207641_10003625 Ga0207641_100036259 321
156 3300026121 Ga0207683_10000827 Ga0207683_100008275 321
157 3300026142 Ga0207698_10181082 Ga0207698_101810822 321
158 3300028379 Ga0268266_10016563 Ga0268266_100165636 321
159 3300028381 Ga0268264_10022242 Ga0268264_100222425 321
160 3300031548 Ga0307408_100031427 Ga0307408_1000314273 321
161 3300031711 Ga0265314_10057547 Ga0265314_100575473 321
162 3300031730 Ga0307516_10076121 Ga0307516_100761212 321
163 3300031731 Ga0307405_10070536 Ga0307405_100705362 321
164 3300031901 Ga0307406_10139445 Ga0307406_101394452 321
165 3300032126 Ga0307415_100196296 Ga0307415_1001962962 321
166 3300035113 Ga0373936_0009664 Ga0373936_0009664_987_2027 321
167 3300035116 Ga0373945_0013264 Ga0373945_0013264_1417_2457 321
168 3300035170 Ga0373943_0014910 Ga0373943_0014910_443_1483 321
169 3300035171 Ga0373946_0024737 Ga0373946_0024737_238_1278 321
170 3300035725 Ga0373947_0028891 Ga0373947_0028891_1459_2499 321
171 3300036401 Ga0373937_0006497 Ga0373937_0006497_1731_2771 321
172 3300037068 Ga0373925_0008011 Ga0373925_0008011_5048_6088 321
173 3300046459 Ga0495629_0044111 Ga0495629_0044111_882_1922 321
174 3300046472 Ga0495580_0044816 Ga0495580_0044816_806_1846 321
175 3300046475 Ga0495639_0003377 Ga0495639_0003377_1745_2785 321
176 3300046663 Ga0495635_0008503 Ga0495635_0008503_2933_3973 321
177 3300046681 Ga0495647_0049534 Ga0495647_0049534_391_1431 321
178 3300046689 Ga0495613_0166746 Ga0495613_0166746_501_1541 321
179 3300046809 Ga0495600_0045779 Ga0495600_0045779_383_1423 321
180 3300047315 Ga0495581_0056346 Ga0495581_0056346_824_1864 321
181 3300047673 Ga0495593_0025369 Ga0495593_0025369_1510_2550 321
182 3300049460 Ga0495682_0005816 Ga0495682_0005816_2424_3428 321
183 3300053085 Ga0495619_0019783 Ga0495619_0019783_2544_3584 321
184 3300006844 Ga0075428_100018420 Ga0075428_1000184207 322
185 3300006844 Ga0075428_100042148 Ga0075428_1000421482 322
186 3300006846 Ga0075430_100152144 Ga0075430_1001521442 322
187 3300006847 Ga0075431_100103786 Ga0075431_1001037861 322
188 3300006852 Ga0075433_10132964 Ga0075433_101329642 322
189 3300006871 Ga0075434_100003190 Ga0075434_1000031902 322
190 3300006880 Ga0075429_100090701 Ga0075429_1000907012 322
191 3300007076 Ga0075435_100020144 Ga0075435_1000201442 322
192 3300031250 Ga0265331_10018131 Ga0265331_100181313 322
193 3300031595 Ga0265313_10091769 Ga0265313_100917691 322
194 3300039450 Ga0436363_0375975 Ga0436363_0375975_24798_25880 322
195 3300050508 nmdc:mga09592_101073_c1 nmdc:mga09592_101073_c1_214_1278 322
196 3300050509 nmdc:mga0qj67_42267_c1 nmdc:mga0qj67_42267_c1_2310_3374 322
197 3300050510 nmdc:mga06r32_344991_c1 nmdc:mga06r32_344991_c1_306_1370 322
198 3300050510 nmdc:mga06r32_94595_c1 nmdc:mga06r32_94595_c1_37_1104 322
199 3300050512 nmdc:mga0n895_4038_c1 nmdc:mga0n895_4038_c1_10314_11387 322
200 3300050513 nmdc:mga0rr50_15004_c1 nmdc:mga0rr50_15004_c1_3031_4104 322
201 3300050515 nmdc:mga0a205_3120_c1 nmdc:mga0a205_3120_c1_12933_14006 322
202 3300005293 Ga0065715_10156438 Ga0065715_101564382 323
203 3300005328 Ga0070676_10004000 Ga0070676_100040002 323
204 3300005330 Ga0070690_100066598 Ga0070690_1000665982 323
205 3300005333 Ga0070677_10002986 Ga0070677_100029862 323
206 3300005334 Ga0068869_100002962 Ga0068869_1000029626 323
207 3300005335 Ga0070666_10006815 Ga0070666_100068154 323
208 3300005338 Ga0068868_100005127 Ga0068868_1000051275 323
209 3300005340 Ga0070689_100082696 Ga0070689_1000826962 323
210 3300005340 Ga0070689_100216871 Ga0070689_1002168712 323
211 3300005344 Ga0070661_100008937 Ga0070661_1000089375 323
212 3300005345 Ga0070692_10054505 Ga0070692_100545051 323
213 3300005347 Ga0070668_100007181 Ga0070668_1000071812 323
214 3300005347 Ga0070668_100053281 Ga0070668_1000532811 323
215 3300005353 Ga0070669_100003327 Ga0070669_1000033273 323
216 3300005353 Ga0070669_100133628 Ga0070669_1001336282 323
217 3300005354 Ga0070675_100008080 Ga0070675_1000080802 323
218 3300005355 Ga0070671_100062488 Ga0070671_1000624882 323
219 3300005355 Ga0070671_100103912 Ga0070671_1001039122 323
220 3300005356 Ga0070674_100167291 Ga0070674_1001672912 323
221 3300005364 Ga0070673_100123730 Ga0070673_1001237302 323
222 3300005366 Ga0070659_100095025 Ga0070659_1000950252 323
223 3300005367 Ga0070667_100002945 Ga0070667_1000029452 323
224 3300005438 Ga0070701_10060402 Ga0070701_100604021 323
225 3300005441 Ga0070700_100101578 Ga0070700_1001015782 323
226 3300005444 Ga0070694_100075256 Ga0070694_1000752562 323
227 3300005445 Ga0070708_100011041 Ga0070708_1000110416 323
228 3300005457 Ga0070662_100061315 Ga0070662_1000613151 323
229 3300005457 Ga0070662_100087524 Ga0070662_1000875242 323
230 3300005458 Ga0070681_10008821 Ga0070681_100088217 323
231 3300005466 Ga0070685_10021719 Ga0070685_100217191 323
232 3300005467 Ga0070706_100029385 Ga0070706_1000293854 323
233 3300005467 Ga0070706_100190084 Ga0070706_1001900842 323
234 3300005468 Ga0070707_100016272 Ga0070707_1000162724 323
235 3300005518 Ga0070699_100004973 Ga0070699_1000049736 323
236 3300005530 Ga0070679_100010565 Ga0070679_1000105652 323
237 3300005536 Ga0070697_100011058 Ga0070697_1000110583 323
238 3300005544 Ga0070686_100187654 Ga0070686_1001876541 323
239 3300005545 Ga0070695_100003924 Ga0070695_1000039242 323
240 3300005546 Ga0070696_100068064 Ga0070696_1000680642 323
241 3300005547 Ga0070693_100002719 Ga0070693_1000027194 323
242 3300005548 Ga0070665_100007579 Ga0070665_1000075792 323
243 3300005548 Ga0070665_100060292 Ga0070665_1000602922 323
244 3300005563 Ga0068855_100012667 Ga0068855_1000126674 323
245 3300005564 Ga0070664_100002473 Ga0070664_10000247315 323
246 3300005564 Ga0070664_100035857 Ga0070664_1000358572 323
247 3300005577 Ga0068857_100004974 Ga0068857_1000049746 323
248 3300005577 Ga0068857_100014206 Ga0068857_1000142064 323
249 3300005577 Ga0068857_100154996 Ga0068857_1001549962 323
250 3300005578 Ga0068854_100043945 Ga0068854_1000439454 323
251 3300005614 Ga0068856_100007782 Ga0068856_1000077826 323
252 3300005615 Ga0070702_100023134 Ga0070702_1000231341 323
253 3300005719 Ga0068861_100002500 Ga0068861_1000025003 323
254 3300005719 Ga0068861_100006241 Ga0068861_1000062412 323
255 3300005719 Ga0068861_100040534 Ga0068861_1000405342 323
256 3300005719 Ga0068861_100204393 Ga0068861_1002043932 323
257 3300005841 Ga0068863_100001465 Ga0068863_1000014652 323
258 3300005842 Ga0068858_100015509 Ga0068858_1000155096 323
259 3300005842 Ga0068858_100019499 Ga0068858_1000194995 323
260 3300005844 Ga0068862_100000444 Ga0068862_10000044415 323
261 3300005844 Ga0068862_100018688 Ga0068862_1000186884 323
262 3300006844 Ga0075428_100000877 Ga0075428_1000008772 323
263 3300006844 Ga0075428_100007914 Ga0075428_1000079142 323
264 3300006844 Ga0075428_100040811 Ga0075428_1000408114 323
265 3300006844 Ga0075428_100057303 Ga0075428_1000573032 323
266 3300006844 Ga0075428_100358019 Ga0075428_1003580192 323
267 3300006846 Ga0075430_100018228 Ga0075430_1000182282 323
268 3300006846 Ga0075430_100205258 Ga0075430_1002052581 323
269 3300006847 Ga0075431_100000544 Ga0075431_10000054432 323
270 3300006847 Ga0075431_100008278 Ga0075431_10000827810 323
271 3300006847 Ga0075431_100026534 Ga0075431_1000265342 323
272 3300006847 Ga0075431_100079817 Ga0075431_1000798173 323
273 3300006852 Ga0075433_10017881 Ga0075433_100178815 323
274 3300006871 Ga0075434_100019940 Ga0075434_1000199405 323
275 3300006880 Ga0075429_100005178 Ga0075429_1000051788 323
276 3300006880 Ga0075429_100011888 Ga0075429_1000118882 323
277 3300006880 Ga0075429_100130984 Ga0075429_1001309842 323
278 3300006881 Ga0068865_100001893 Ga0068865_1000018935 323
279 3300006881 Ga0068865_100112502 Ga0068865_1001125022 323
280 3300006881 Ga0068865_100171086 Ga0068865_1001710862 323
281 3300006914 Ga0075436_100083935 Ga0075436_1000839352 323
282 3300007076 Ga0075435_100009355 Ga0075435_1000093552 323
283 3300009093 Ga0105240_10092410 Ga0105240_100924104 323
284 3300009093 Ga0105240_10104620 Ga0105240_101046202 323
285 3300009094 Ga0111539_10007604 Ga0111539_1000760416 323
286 3300009094 Ga0111539_10030246 Ga0111539_100302463 323
287 3300009094 Ga0111539_10031518 Ga0111539_100315182 323
288 3300009098 Ga0105245_10008789 Ga0105245_100087893 323
289 3300009098 Ga0105245_10013055 Ga0105245_100130552 323
290 3300009098 Ga0105245_10013246 Ga0105245_100132468 323
291 3300009101 Ga0105247_10010520 Ga0105247_100105205 323
292 3300009147 Ga0114129_10024009 Ga0114129_100240091 323
293 3300009147 Ga0114129_10063753 Ga0114129_100637534 323
294 3300009148 Ga0105243_10025164 Ga0105243_100251642 323
295 3300009174 Ga0105241_10004711 Ga0105241_100047114 323
296 3300009174 Ga0105241_10012094 Ga0105241_100120944 323
297 3300009174 Ga0105241_10027083 Ga0105241_100270835 323
298 3300009174 Ga0105241_10133934 Ga0105241_101339341 323
299 3300009176 Ga0105242_10023678 Ga0105242_100236782 323
300 3300009176 Ga0105242_10029321 Ga0105242_100293212 323
301 3300009176 Ga0105242_10082735 Ga0105242_100827353 323
302 3300009177 Ga0105248_10004440 Ga0105248_100044407 323
303 3300009177 Ga0105248_10009722 Ga0105248_100097222 323
304 3300009177 Ga0105248_10070286 Ga0105248_100702863 323
305 3300009545 Ga0105237_10049368 Ga0105237_100493682 323
306 3300009551 Ga0105238_10016704 Ga0105238_100167042 323
307 3300009553 Ga0105249_10069988 Ga0105249_100699883 323
308 3300009553 Ga0105249_10101921 Ga0105249_101019212 323
309 3300009553 Ga0105249_10143834 Ga0105249_101438342 323
310 3300010375 Ga0105239_10011114 Ga0105239_100111143 323
311 3300013100 Ga0157373_10008821 Ga0157373_100088213 323
312 3300013105 Ga0157369_10043765 Ga0157369_100437651 323
313 3300013296 Ga0157374_10000101 Ga0157374_1000010162 323
314 3300013296 Ga0157374_10018951 Ga0157374_100189513 323
315 3300013297 Ga0157378_10019510 Ga0157378_100195106 323
316 3300013297 Ga0157378_10020523 Ga0157378_100205236 323
317 3300013306 Ga0163162_10002363 Ga0163162_100023637 323
318 3300013306 Ga0163162_10004568 Ga0163162_100045687 323
319 3300013306 Ga0163162_10042345 Ga0163162_100423451 323
320 3300013306 Ga0163162_10095816 Ga0163162_100958162 323
321 3300013306 Ga0163162_10109179 Ga0163162_101091793 323
322 3300013307 Ga0157372_10007675 Ga0157372_100076757 323
323 3300013308 Ga0157375_10010351 Ga0157375_100103515 323
324 3300013308 Ga0157375_10027818 Ga0157375_100278185 323
325 3300013308 Ga0157375_10083872 Ga0157375_100838724 323
326 3300013308 Ga0157375_10095338 Ga0157375_100953382 323
327 3300014325 Ga0163163_10001987 Ga0163163_1000198713 323
328 3300014325 Ga0163163_10051502 Ga0163163_100515022 323
329 3300014326 Ga0157380_10001965 Ga0157380_100019653 323
330 3300014745 Ga0157377_10004524 Ga0157377_100045242 323
331 3300014745 Ga0157377_10022483 Ga0157377_100224832 323
332 3300014968 Ga0157379_10000336 Ga0157379_1000033627 323
333 3300014968 Ga0157379_10013356 Ga0157379_100133561 323
334 3300014968 Ga0157379_10092670 Ga0157379_100926702 323
335 3300014969 Ga0157376_10005793 Ga0157376_100057934 323
336 3300014969 Ga0157376_10008441 Ga0157376_100084418 323
337 3300014969 Ga0157376_10346787 Ga0157376_103467872 323
338 3300017792 Ga0163161_10032520 Ga0163161_100325203 323
339 3300017792 Ga0163161_10122501 Ga0163161_101225012 323
340 3300025907 Ga0207645_10000519 Ga0207645_100005196 323
341 3300025907 Ga0207645_10003186 Ga0207645_100031868 323
342 3300025910 Ga0207684_10229846 Ga0207684_102298461 323
343 3300025911 Ga0207654_10052577 Ga0207654_100525774 323
344 3300025912 Ga0207707_10005164 Ga0207707_100051648 323
345 3300025913 Ga0207695_10047604 Ga0207695_100476042 323
346 3300025917 Ga0207660_10019483 Ga0207660_100194832 323
347 3300025918 Ga0207662_10011318 Ga0207662_100113182 323
348 3300025920 Ga0207649_10005567 Ga0207649_100055672 323
349 3300025921 Ga0207652_10057090 Ga0207652_100570903 323
350 3300025922 Ga0207646_10010339 Ga0207646_100103395 323
351 3300025925 Ga0207650_10014702 Ga0207650_100147024 323
352 3300025925 Ga0207650_10019208 Ga0207650_100192083 323
353 3300025926 Ga0207659_10083840 Ga0207659_100838402 323
354 3300025933 Ga0207706_10003690 Ga0207706_100036908 323
355 3300025933 Ga0207706_10012004 Ga0207706_100120043 323
356 3300025933 Ga0207706_10125511 Ga0207706_101255112 323
357 3300025936 Ga0207670_10013499 Ga0207670_100134992 323
358 3300025936 Ga0207670_10174150 Ga0207670_101741501 323
359 3300025938 Ga0207704_10127660 Ga0207704_101276602 323
360 3300025940 Ga0207691_10002302 Ga0207691_100023029 323
361 3300025940 Ga0207691_10009801 Ga0207691_100098015 323
362 3300025940 Ga0207691_10029213 Ga0207691_100292133 323
363 3300025945 Ga0207679_10015584 Ga0207679_100155843 323
364 3300025945 Ga0207679_10022968 Ga0207679_100229684 323
365 3300025949 Ga0207667_10008828 Ga0207667_100088287 323
366 3300025961 Ga0207712_10003697 Ga0207712_100036975 323
367 3300025972 Ga0207668_10012197 Ga0207668_100121972 323
368 3300025981 Ga0207640_10005719 Ga0207640_100057192 323
369 3300026035 Ga0207703_10014040 Ga0207703_100140404 323
370 3300026035 Ga0207703_10075691 Ga0207703_100756912 323
371 3300026075 Ga0207708_10131105 Ga0207708_101311052 323
372 3300026078 Ga0207702_10005357 Ga0207702_100053576 323
373 3300026089 Ga0207648_10002591 Ga0207648_100025918 323
374 3300026089 Ga0207648_10007290 Ga0207648_100072909 323
375 3300026089 Ga0207648_10010404 Ga0207648_100104044 323
376 3300026089 Ga0207648_10060157 Ga0207648_100601572 323
377 3300026116 Ga0207674_10010887 Ga0207674_100108877 323
378 3300026118 Ga0207675_100005028 Ga0207675_1000050288 323
379 3300026118 Ga0207675_100005404 Ga0207675_1000054043 323
380 3300026118 Ga0207675_100015576 Ga0207675_1000155765 323
381 3300026118 Ga0207675_100066610 Ga0207675_1000666102 323
382 3300026121 Ga0207683_10004272 Ga0207683_100042728 323
383 3300026121 Ga0207683_10010567 Ga0207683_100105673 323
384 3300026121 Ga0207683_10017048 Ga0207683_100170485 323
385 3300027665 Ga0209983_1001601 Ga0209983_10016012 323
386 3300027717 Ga0209998_10004303 Ga0209998_100043032 323
387 3300027907 Ga0207428_10001433 Ga0207428_1000143320 323
388 3300027907 Ga0207428_10031036 Ga0207428_100310363 323
389 3300028380 Ga0268265_10023659 Ga0268265_100236592 323
390 3300028380 Ga0268265_10033604 Ga0268265_100336043 323
391 3300028380 Ga0268265_10147527 Ga0268265_101475272 323
392 3300031238 Ga0265332_10000179 Ga0265332_1000017942 323
393 3300031250 Ga0265331_10000865 Ga0265331_1000086512 323
394 3300031344 Ga0265316_10017799 Ga0265316_100177994 323
395 3300031731 Ga0307405_10003438 Ga0307405_100034384 323
396 3300031852 Ga0307410_10001595 Ga0307410_100015959 323
397 3300031852 Ga0307410_10210540 Ga0307410_102105402 323
398 3300031901 Ga0307406_10078160 Ga0307406_100781602 323
399 3300031903 Ga0307407_10026988 Ga0307407_100269882 323
400 3300031911 Ga0307412_10008572 Ga0307412_100085724 323
401 3300031995 Ga0307409_100005580 Ga0307409_1000055804 323
402 3300032002 Ga0307416_100001112 Ga0307416_1000011129 323
403 3300032004 Ga0307414_10210348 Ga0307414_102103482 323
404 3300032005 Ga0307411_10000563 Ga0307411_100005639 323
405 3300032126 Ga0307415_100000772 Ga0307415_1000007728 323
406 3300035111 Ga0373923_0000314 Ga0373923_0000314_3576_4652 323
407 3300035117 Ga0373953_0010090 Ga0373953_0010090_178_1254 323
408 3300035117 Ga0373953_0089035 Ga0373953_0089035_110_1174 323
409 3300035119 Ga0373956_0008049 Ga0373956_0008049_2774_3850 323
410 3300035120 Ga0373957_0000406 Ga0373957_0000406_1657_2733 323
411 3300035170 Ga0373943_0001963 Ga0373943_0001963_3046_4122 323
412 3300035410 Ga0373924_0013897 Ga0373924_0013897_1899_2975 323
413 3300035695 Ga0373927_0017225 Ga0373927_0017225_1331_2407 323
414 3300035695 Ga0373927_0029128 Ga0373927_0029128_1185_2261 323
415 3300035724 Ga0373933_0002291 Ga0373933_0002291_6131_7207 323
416 3300035725 Ga0373947_0042830 Ga0373947_0042830_322_1398 323
417 3300036401 Ga0373937_0006500 Ga0373937_0006500_2903_3979 323
418 3300037068 Ga0373925_0014292 Ga0373925_0014292_4170_5246 323
419 3300037068 Ga0373925_0157854 Ga0373925_0157854_19_1095 323
420 3300042005 Ga0439448_0045156 Ga0439448_0045156_258_1325 323
421 3300042156 Ga0439446_0028122 Ga0439446_0028122_156_1232 323
422 3300042435 Ga0439434_0004884 Ga0439434_0004884_695_1771 323
423 3300042437 Ga0439444_0003353 Ga0439444_0003353_445_1521 323
424 3300046460 Ga0495638_0007310 Ga0495638_0007310_5323_6393 323
425 3300046472 Ga0495580_0189826 Ga0495580_0189826_77_1153 323
426 3300046539 Ga0495621_0002582 Ga0495621_0002582_146_1222 323
427 3300046543 Ga0495645_0044691 Ga0495645_0044691_1287_2363 323
428 3300046660 Ga0495625_0016672 Ga0495625_0016672_2338_3408 323
429 3300046679 Ga0495623_0051961 Ga0495623_0051961_888_1964 323
430 3300047471 Ga0495684_0302675 Ga0495684_0302675_61_1137 323
431 3300048903 Ga0496100_0057812 Ga0496100_0057812_1354_2430 323
432 3300048906 Ga0496103_0142096 Ga0496103_0142096_368_1444 323
433 3300048907 Ga0496104_0000858 Ga0496104_0000858_20104_21180 323
434 3300048909 Ga0496106_0056731 Ga0496106_0056731_108_1148 323
435 3300048911 Ga0496108_0076945 Ga0496108_0076945_1555_2631 323
436 3300048913 Ga0496110_0153169 Ga0496110_0153169_734_1810 323
437 3300048915 Ga0496112_0027219 Ga0496112_0027219_4244_5320 323
438 3300048915 Ga0496112_0049036 Ga0496112_0049036_287_1330 323
439 3300048915 Ga0496112_0212217 Ga0496112_0212217_410_1489 323
440 3300048921 Ga0496118_0077146 Ga0496118_0077146_441_1502 323
441 3300049572 Ga0501036_0006052 Ga0501036_0006052_2537_3613 323
442 3300049573 Ga0501037_0094413 Ga0501037_0094413_1064_2140 323
443 3300049575 Ga0501039_0002245 Ga0501039_0002245_12056_13132 323
444 3300049576 Ga0501040_0004068 Ga0501040_0004068_4284_5375 323
445 3300049576 Ga0501040_0018139 Ga0501040_0018139_657_1733 323
446 3300049576 Ga0501040_0094513 Ga0501040_0094513_782_1858 323
447 3300049578 Ga0501042_0158034 Ga0501042_0158034_236_1312 323
448 3300049580 Ga0501046_0117812 Ga0501046_0117812_892_1974 323
449 3300049582 Ga0501048_0197852 Ga0501048_0197852_76_1149 323
450 3300049588 Ga0501072_0021294 Ga0501072_0021294_2390_3466 323
451 3300049588 Ga0501072_0039249 Ga0501072_0039249_31_1107 323
452 3300049589 Ga0501073_0003874 Ga0501073_0003874_7438_8511 323
453 3300049591 Ga0501075_0013253 Ga0501075_0013253_420_1502 323
454 3300049591 Ga0501075_0041354 Ga0501075_0041354_37_1113 323
455 3300049592 Ga0501076_0107660 Ga0501076_0107660_44_1123 323
456 3300049592 Ga0501076_0360981 Ga0501076_0360981_66_1139 323
457 3300049593 Ga0501077_0004095 Ga0501077_0004095_5016_6089 323
458 3300049741 Ga0501079_0191731 Ga0501079_0191731_473_1552 323
459 3300049742 Ga0501080_0025414 Ga0501080_0025414_2456_3529 323
460 3300049824 Ga0501045_0003160 Ga0501045_0003160_6613_7704 323
461 3300049824 Ga0501045_0027070 Ga0501045_0027070_727_1803 323
462 3300049824 Ga0501045_0112683 Ga0501045_0112683_735_1811 323
463 3300050507 nmdc:mga05p37_593770_c1 nmdc:mga05p37_593770_c1_151_1191 323
464 3300050508 nmdc:mga09592_3846_c1 nmdc:mga09592_3846_c1_985_2052 323
465 3300050508 nmdc:mga09592_53371_c1 nmdc:mga09592_53371_c1_931_1971 323
466 3300050508 nmdc:mga09592_82055_c1 nmdc:mga09592_82055_c1_1545_2585 323
467 3300050509 nmdc:mga0qj67_2416_c1 nmdc:mga0qj67_2416_c1_3689_4729 323
468 3300050509 nmdc:mga0qj67_317992_c1 nmdc:mga0qj67_317992_c1_186_1226 323
469 3300050510 nmdc:mga06r32_12468_c1 nmdc:mga06r32_12468_c1_4628_5737 323
470 3300050510 nmdc:mga06r32_14649_c1 nmdc:mga06r32_14649_c1_1153_2193 323
471 3300050510 nmdc:mga06r32_28592_c1 nmdc:mga06r32_28592_c1_1091_2167 323
472 3300050510 nmdc:mga06r32_84216_c1 nmdc:mga06r32_84216_c1_1198_2238 323
473 3300050510 nmdc:mga06r32_8_c1 nmdc:mga06r32_8_c1_583_1650 323
474 3300050511 nmdc:mga08y16_1386_c1 nmdc:mga08y16_1386_c1_1909_2976 323
475 3300050512 nmdc:mga0n895_27402_c1 nmdc:mga0n895_27402_c1_1304_2377 323
476 3300050513 nmdc:mga0rr50_22801_c1 nmdc:mga0rr50_22801_c1_2848_3924 323
477 3300050513 nmdc:mga0rr50_26145_c1 nmdc:mga0rr50_26145_c1_1874_2947 323
478 3300050514 nmdc:mga08x19_5947_c1 nmdc:mga08x19_5947_c1_5569_6642 323
479 3300050515 nmdc:mga0a205_47355_c1 nmdc:mga0a205_47355_c1_2461_3534 323
480 3300053085 Ga0495619_0076307 Ga0495619_0076307_1054_2154 323
481 3300053092 Ga0500583_0016167 Ga0500583_0016167_1694_2755 323
482 3300053146 Ga0500588_0038283 Ga0500588_0038283_120_1181 323
483 3300054114 Ga0501084_0053774 Ga0501084_0053774_1650_2723 323
484 3300061734 Ga0530510_0152439 Ga0530510_0152439_365_1456 323
485 3300026075 Ga0207708_10039008 Ga0207708_100390082 324
486 3300003214 JGI25165J46597_1000209 JGI25165J46597_100020946 325
487 3300025261 Ga0209233_1000013 Ga0209233_1000013904 325

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ap3-assembly2.cif.gz_C crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6948 70 283
3ap3-assembly1.cif.gz_B crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6875 71 286
3ap1-assembly1.cif.gz_A crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap and c4 peptide 0.6313 70 322
3ap3-assembly1.cif.gz_A crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6232 71 301
5wrj-assembly1.cif.gz_B crystal structure of human tyrosylprotein sulfotransferase-1 complexed with pap and gastrin peptide 0.5922 69 322
ID Description Score Start End Superfamily
af_A0A0N7KMX9_10_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6273 144 275 3.40.50.300
af_Q5RJS8_51_358_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6233 69 322 3.40.50.300
af_Q20351_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6163 90 318 3.40.50.300
af_A0A2R8QJJ2_583_782_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6063 72 246 3.40.50.300
af_O43916_60_387_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6058 71 323 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y8SS76-F1-model_v4 Sulfotransferase family protein 0.9586 8 324
AF-A0A539DE41-F1-model_v4 Sulfotransferase 0.9551 1 322
AF-A0A536TB53-F1-model_v4 Sulfotransferase 0.9539 8 322
AF-A0A1M3A964-F1-model_v4 deleted 0.9498 14 321
AF-A0A537D970-F1-model_v4 Sulfotransferase 0.9483 39 321

Feature Viewer

pLDDT pTM Quality
91.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map