F453321

General Info

Members Datasets Scaffolds Average Seq Length
486 231 413 499

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0000031|Ga0495605_0000031_65123_66736
Length 537
Sequence MRLTDATVAIRPRNPWEAIDLGVLLARDHRRLLMTSWAIVTLPVFTLLSLMLWDYPSLALFMFWWLKPLYERLTLLILSQALFGATPTLKQALGAWPGTLKTQLLASLTWRRLSLSRSFKLPIQQLEGLSGPERAQRIAMLSQKGLRAARCLTSIGSTLEMCFWVGLMVLFYAFLPQQLEIDWSWQSLLNVDGXXXXLEHLTNAFYALVLIVWGPIYVTCGFTLYLNRRTELEAWDIELTFRRLRQRLIGSAYALLLGCTLLLSIPPMSAMADEGSSIPPDSQQLSCPLPPLDLPQSEDAVAAPSSPRLLNQTLSSKGSETAIKSVLENPPFKNLKTVSGWRIAEHSDVKKSAKSTDTPAWLVSLIRGLLAVTTLLANAIEVLLWSAVLLLLIGLAWRYRSWISTFVSRRKPKAAPRPTTPKQLFGLQIVPQSLPVDVAGSVERLWPQQPREALSLLYRALLSRLMTDYQLPLKNSDTEGQVLERIATLDQPSLEHFSRTLTNHWQNLAYGHRLPPVDAQQTLCDDWRRLFAIRPSA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231010 Pseudomonas sp. GM25 Isolate Nodule
4 2511231011 Pseudomonas sp. GM30 Isolate Nodule
5 2511231023 Pseudomonas sp. GM80 Isolate Nodule
6 2511231031 Pseudomonas sp. GM16 Isolate Nodule
7 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
8 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
9 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
10 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
11 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
12 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
13 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
14 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
15 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
16 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
17 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
18 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
19 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
20 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
21 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
22 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
23 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
24 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
25 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
26 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
27 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
28 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
29 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
30 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
31 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
32 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
33 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
34 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
35 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
36 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
37 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
38 2784132063 Pseudomonas sp. 424 Isolate Unclassified
39 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
40 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
41 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
42 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
43 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
44 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
45 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
46 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
47 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
48 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
49 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
50 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
51 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
52 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
53 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
54 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
55 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
56 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
57 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
58 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
59 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
60 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
61 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
62 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
63 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
64 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
65 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
66 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
67 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
68 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
76 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
120 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
129 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
130 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
135 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
136 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
137 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
138 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
139 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
140 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
141 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
142 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
143 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
147 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
223 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
224 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
225 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
226 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
227 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
228 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
229 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
230 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
231 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.98
Metatranscriptomes 0
Isolates 15.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 1.85
Rhizoplane 4.53
Rhizosphere 78.4
Stem 0
Stem Tuber 0
Unclassified 9.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2802131 2162886007 Bacteria 3347
2 JGI25162J39368_1000224 3300002737 Bacteria 58359
3 JGI25162J39368_1000582 3300002737 Bacteria 26728
4 JGI25163J39215_1000180 3300002771 Bacteria 24276
5 JGI25163J39215_1000571 3300002771 Bacteria 10425
6 JGI25164J39214_1000185 3300002772 Bacteria 55122
7 JGI25164J39214_1000370 3300002772 Bacteria 26728
8 JGI25165J46597_1000315 3300003214 Bacteria 58359
9 JGI25165J46597_1000699 3300003214 Bacteria 26728
10 rootH1_10261452 3300003323 Bacteria 3273
11 Ga0055536_1000335 3300003781 Bacteria 34801
12 Ga0055530_10000047 3300003791 Bacteria 108305
13 Ga0055540_1000083 3300003792 Bacteria 108305
14 Ga0065714_10003602 3300005288 Bacteria 20004
15 Ga0065714_10005407 3300005288 Bacteria 5170
16 Ga0065704_10001489 3300005289 Bacteria 11041
17 Ga0065712_10067890 3300005290 Bacteria 22656
18 Ga0070670_100005718 3300005331 Bacteria 10506
19 Ga0070669_100000303 3300005353 Bacteria 38771
20 Ga0070665_100082500 3300005548 Bacteria 3220
21 Ga0075364_10035266 3300006051 Bacteria 3233
22 Ga0075432_10004023 3300006058 Bacteria 5021
23 Ga0079104_1000909 3300006946 Bacteria 23912
24 Ga0099826_10001047 3300006948 Bacteria 15613
25 Ga0105251_10000004 3300009011 Bacteria 285212
26 Ga0105251_10001636 3300009011 Bacteria 18970
27 Ga0105244_10000906 3300009036 Bacteria 25033
28 Ga0105244_10003461 3300009036 Bacteria 11246
29 Ga0105244_10007953 3300009036 Bacteria 6679
30 Ga0105244_10027991 3300009036 Bacteria 3029
31 Ga0105250_10000179 3300009092 Bacteria 54856
32 Ga0105250_10000553 3300009092 Bacteria 25472
33 Ga0105243_10001357 3300009148 Bacteria 21769
34 Ga0105243_10004240 3300009148 Bacteria 11361
35 Ga0105246_10005899 3300011119 Bacteria 7470
36 Ga0157345_1000050 3300012498 Bacteria 26732
37 Ga0157373_10000390 3300013100 Bacteria 35143
38 Ga0157373_10002323 3300013100 Bacteria 14420
39 Ga0157373_10011239 3300013100 Bacteria 6587
40 Ga0157373_10012055 3300013100 Bacteria 6354
41 Ga0157373_10068006 3300013100 Bacteria 2519
42 Ga0157373_10075532 3300013100 Bacteria 2377
43 Ga0157371_10002679 3300013102 Bacteria 16849
44 Ga0157371_10035082 3300013102 Bacteria 3596
45 Ga0157370_10000055 3300013104 Bacteria 118355
46 Ga0157370_10057591 3300013104 Bacteria 3694
47 Ga0157369_10001031 3300013105 Bacteria 35204
48 Ga0163162_10000258 3300013306 Bacteria 48199
49 Ga0157372_10006820 3300013307 Bacteria 12145
50 Ga0157375_10011008 3300013308 Bacteria 7978
51 Ga0182008_10000861 3300014497 Bacteria 21065
52 Ga0182008_10009835 3300014497 Bacteria 5143
53 Ga0182006_1000711 3300015261 Bacteria 23048
54 Ga0182006_1002678 3300015261 Bacteria 9588
55 Ga0182006_1003060 3300015261 Bacteria 8774
56 Ga0182006_1005478 3300015261 Bacteria 6047
57 Ga0182007_10007015 3300015262 Bacteria 4778
58 Ga0182005_1001659 3300015265 Bacteria 8644
59 Ga0163161_10000759 3300017792 Bacteria 25384
60 Ga0163161_10001744 3300017792 Bacteria 15910
61 Ga0163161_10013829 3300017792 Bacteria 5621
62 Ga0209760_100134 3300025207 Bacteria 47696
63 Ga0209760_100175 3300025207 Bacteria 34836
64 Ga0207427_100004 3300025231 Bacteria 939600
65 Ga0207427_100007 3300025231 Bacteria 746220
66 Ga0209437_100006 3300025233 Bacteria 1042724
67 Ga0209437_100028 3300025233 Bacteria 540136
68 Ga0209233_1000008 3300025261 Bacteria 1356712
69 Ga0209233_1000086 3300025261 Bacteria 331687
70 Ga0209676_1000365 3300025292 Bacteria 84690
71 Ga0209676_1003246 3300025292 Bacteria 10246
72 Ga0209050_1000027 3300025298 Bacteria 483261
73 Ga0209051_1000065 3300025303 Bacteria 231445
74 Ga0209257_1006497 3300025304 Bacteria 7491
75 Ga0207696_1000044 3300025711 Bacteria 300953
76 Ga0207696_1002103 3300025711 Bacteria 10013
77 Ga0207655_1000895 3300025728 Bacteria 31342
78 Ga0207655_1001861 3300025728 Bacteria 18205
79 Ga0207655_1002950 3300025728 Bacteria 13079
80 Ga0207655_1003104 3300025728 Bacteria 12628
81 Ga0207655_1005161 3300025728 Bacteria 8988
82 Ga0207655_1011799 3300025728 Bacteria 5165
83 Ga0207713_1000013 3300025735 Bacteria 475751
84 Ga0207713_1019848 3300025735 Bacteria 3275
85 Ga0207706_10040942 3300025933 Bacteria 4107
86 Ga0207709_10000013 3300025935 Bacteria 531977
87 Ga0207709_10000333 3300025935 Bacteria 49685
88 Ga0209281_1000010 3300027111 Bacteria 726106
89 Ga0209281_1001937 3300027111 Bacteria 9703
90 Ga0209371_1000232 3300027312 Bacteria 70412
91 Ga0207428_10017175 3300027907 Bacteria 6216
92 Ga0268266_10069444 3300028379 Bacteria 3052
93 Ga0268256_1000169 3300030500 Bacteria 81272
94 Ga0316178_1149586 3300030735 Bacteria 40815
95 Ga0307408_100020659 3300031548 Bacteria 4447
96 Ga0307408_100035953 3300031548 Bacteria 3478
97 Ga0307408_100062994 3300031548 Bacteria 2711
98 Ga0307408_100101244 3300031548 Bacteria 2195
99 Ga0307412_10017211 3300031911 Bacteria 4323
100 Ga0307412_10034664 3300031911 Bacteria 3218
101 Ga0307412_10071984 3300031911 Bacteria 2361
102 Ga0307414_10182043 3300032004 Bacteria 1691
103 Ga0307411_10000134 3300032005 Bacteria 23447
104 Ga0307510_10000993 3300033180 Bacteria 30087
105 Ga0237819_00779 3300038705 Bacteria 10178
106 Ga0439436_0000678 3300041404 Bacteria 9151
107 Ga0439438_000220 3300041405 Bacteria 26270
108 Ga0439438_000274 3300041405 Bacteria 23206
109 Ga0439438_000409 3300041405 Bacteria 19294
110 Ga0439447_000113 3300041407 Bacteria 27299
111 Ga0439466_0000614 3300041411 Bacteria 13400
112 Ga0439466_0000764 3300041411 Bacteria 12176
113 Ga0439431_0001697 3300041997 Bacteria 4856
114 Ga0439445_0005029 3300042004 Bacteria 3001
115 Ga0439432_001565 3300042006 Bacteria 8594
116 Ga0439432_002511 3300042006 Bacteria 6911
117 Ga0439451_008109 3300042009 Bacteria 2131
118 Ga0439452_000099 3300042010 Bacteria 72507
119 Ga0439452_004726 3300042010 Bacteria 4506
120 Ga0439456_000623 3300042013 Bacteria 7402
121 Ga0439463_010090 3300042016 Bacteria 2321
122 Ga0450911_000130 3300042115 Bacteria 29999
123 Ga0450902_002103 3300042137 Bacteria 2799
124 Ga0450904_000761 3300042139 Bacteria 5578
125 Ga0450905_006024 3300042142 Bacteria 1634
126 Ga0450906_000624 3300042145 Bacteria 7575
127 Ga0450910_000154 3300042147 Bacteria 7519
128 Ga0439446_0000286 3300042156 Bacteria 9575
129 Ga0439464_0002069 3300042439 Bacteria 4884
130 Ga0450918_002382 3300042531 Bacteria 3553
131 Ga0439440_0000927 3300042993 Bacteria 5135
132 Ga0495617_000398 3300046452 Bacteria 24072
133 Ga0495617_003325 3300046452 Bacteria 6080
134 Ga0495617_006238 3300046452 Bacteria 4191
135 Ga0495617_016991 3300046452 Bacteria 2459
136 Ga0495617_017388 3300046452 Bacteria 2429
137 Ga0495627_000556 3300046453 Bacteria 30697
138 Ga0495627_000628 3300046453 Bacteria 27907
139 Ga0495627_001164 3300046453 Bacteria 16866
140 Ga0495627_003313 3300046453 Bacteria 7185
141 Ga0495627_040226 3300046453 Bacteria 1440
142 Ga0495592_0021596 3300046454 Bacteria 4896
143 Ga0495590_0002344 3300046457 Bacteria 7860
144 Ga0495591_000498 3300046458 Bacteria 31018
145 Ga0495591_000526 3300046458 Bacteria 29924
146 Ga0495591_000582 3300046458 Bacteria 27796
147 Ga0495591_000671 3300046458 Bacteria 25171
148 Ga0495591_000733 3300046458 Bacteria 23740
149 Ga0495591_002288 3300046458 Bacteria 10861
150 Ga0495591_002526 3300046458 Bacteria 10099
151 Ga0495591_006292 3300046458 Bacteria 5279
152 Ga0495591_006542 3300046458 Bacteria 5131
153 Ga0495591_006733 3300046458 Bacteria 5008
154 Ga0495591_013263 3300046458 Bacteria 3026
155 Ga0495638_0003534 3300046460 Bacteria 12251
156 Ga0495638_0003630 3300046460 Bacteria 12043
157 Ga0495638_0004269 3300046460 Bacteria 10862
158 Ga0495638_0004429 3300046460 Bacteria 10632
159 Ga0495638_0007455 3300046460 Bacteria 7839
160 Ga0495638_0039738 3300046460 Bacteria 2985
161 Ga0495638_0064036 3300046460 Bacteria 2265
162 Ga0495653_0000838 3300046463 Bacteria 23720
163 Ga0495650_0005980 3300046471 Bacteria 7708
164 Ga0495650_0020509 3300046471 Bacteria 3220
165 Ga0495605_0000031 3300046474 Bacteria 213242
166 Ga0495605_0000606 3300046474 Bacteria 28067
167 Ga0495605_0021112 3300046474 Bacteria 3453
168 Ga0495639_0000301 3300046475 Bacteria 24068
169 Ga0495584_0001956 3300046491 Bacteria 11851
170 Ga0495584_0004150 3300046491 Bacteria 7820
171 Ga0495584_0005524 3300046491 Bacteria 6694
172 Ga0495584_0017940 3300046491 Bacteria 3599
173 Ga0495584_0018800 3300046491 Bacteria 3512
174 Ga0495584_0028787 3300046491 Bacteria 2816
175 Ga0495585_0000885 3300046492 Bacteria 25384
176 Ga0495585_0002880 3300046492 Bacteria 11955
177 Ga0495585_0006397 3300046492 Bacteria 7313
178 Ga0495585_0008139 3300046492 Bacteria 6369
179 Ga0495585_0011459 3300046492 Bacteria 5244
180 Ga0495594_0031835 3300046499 Bacteria 2861
181 Ga0495596_0000347 3300046500 Bacteria 30058
182 Ga0495596_0009900 3300046500 Bacteria 4177
183 Ga0495596_0017013 3300046500 Bacteria 3016
184 Ga0495607_0000723 3300046501 Bacteria 31710
185 Ga0495607_0000945 3300046501 Bacteria 26896
186 Ga0495607_0001058 3300046501 Bacteria 25138
187 Ga0495607_0002452 3300046501 Bacteria 15074
188 Ga0495607_0006423 3300046501 Bacteria 8280
189 Ga0495607_0009114 3300046501 Bacteria 6746
190 Ga0495607_0009145 3300046501 Bacteria 6735
191 Ga0495607_0018576 3300046501 Bacteria 4430
192 Ga0495607_0042587 3300046501 Bacteria 2690
193 Ga0495607_0051804 3300046501 Bacteria 2381
194 Ga0495583_0004015 3300046506 Bacteria 10842
195 Ga0495583_0004049 3300046506 Bacteria 10775
196 Ga0495583_0005844 3300046506 Bacteria 8206
197 Ga0495583_0007733 3300046506 Bacteria 6692
198 Ga0495606_0000684 3300046507 Bacteria 52863
199 Ga0495606_0001798 3300046507 Bacteria 27293
200 Ga0495606_0001941 3300046507 Bacteria 25568
201 Ga0495606_0006079 3300046507 Bacteria 11273
202 Ga0495606_0013293 3300046507 Bacteria 6522
203 Ga0495606_0018456 3300046507 Bacteria 5228
204 Ga0495606_0032772 3300046507 Bacteria 3594
205 Ga0495606_0128265 3300046507 Bacteria 1510
206 Ga0495610_0001434 3300046512 Bacteria 21064
207 Ga0495610_0003809 3300046512 Bacteria 11500
208 Ga0495610_0050670 3300046512 Bacteria 2025
209 Ga0495616_0000582 3300046513 Bacteria 27486
210 Ga0495616_0000681 3300046513 Bacteria 25134
211 Ga0495616_0007574 3300046513 Bacteria 6496
212 Ga0495616_0027495 3300046513 Bacteria 3017
213 Ga0495620_0000312 3300046515 Bacteria 34533
214 Ga0495620_0004648 3300046515 Bacteria 7713
215 Ga0495620_0006112 3300046515 Bacteria 6649
216 Ga0495620_0008898 3300046515 Bacteria 5366
217 Ga0495620_0009692 3300046515 Bacteria 5112
218 Ga0495620_0013358 3300046515 Bacteria 4206
219 Ga0495620_0020038 3300046515 Bacteria 3274
220 Ga0495631_0000491 3300046518 Bacteria 26308
221 Ga0495631_0002142 3300046518 Bacteria 11408
222 Ga0495631_0005255 3300046518 Bacteria 6808
223 Ga0495631_0011610 3300046518 Bacteria 4327
224 Ga0495632_0000849 3300046519 Bacteria 26973
225 Ga0495632_0001058 3300046519 Bacteria 23614
226 Ga0495632_0003536 3300046519 Bacteria 11050
227 Ga0495632_0004446 3300046519 Bacteria 9521
228 Ga0495632_0007346 3300046519 Bacteria 6936
229 Ga0495632_0007670 3300046519 Bacteria 6737
230 Ga0495632_0019692 3300046519 Bacteria 3671
231 Ga0495632_0023391 3300046519 Bacteria 3300
232 Ga0495632_0027101 3300046519 Bacteria 3005
233 Ga0495632_0027947 3300046519 Bacteria 2948
234 Ga0495637_0000378 3300046520 Bacteria 33426
235 Ga0495637_0000414 3300046520 Bacteria 31478
236 Ga0495637_0000555 3300046520 Bacteria 26787
237 Ga0495637_0000859 3300046520 Bacteria 19872
238 Ga0495637_0003593 3300046520 Bacteria 8218
239 Ga0495637_0017052 3300046520 Bacteria 3391
240 Ga0495643_0000116 3300046522 Bacteria 130165
241 Ga0495643_0001426 3300046522 Bacteria 22138
242 Ga0495643_0001858 3300046522 Bacteria 17926
243 Ga0495643_0007653 3300046522 Bacteria 6929
244 Ga0495643_0012929 3300046522 Bacteria 5018
245 Ga0495644_0000603 3300046523 Bacteria 15093
246 Ga0495648_0001036 3300046524 Bacteria 28197
247 Ga0495648_0001189 3300046524 Bacteria 26124
248 Ga0495648_0001355 3300046524 Bacteria 24204
249 Ga0495648_0001831 3300046524 Bacteria 20467
250 Ga0495648_0003755 3300046524 Bacteria 13220
251 Ga0495648_0005089 3300046524 Bacteria 11032
252 Ga0495648_0010193 3300046524 Bacteria 7180
253 Ga0495648_0025476 3300046524 Bacteria 4003
254 Ga0495654_0000422 3300046530 Bacteria 35886
255 Ga0495654_0000691 3300046530 Bacteria 26434
256 Ga0495654_0003353 3300046530 Bacteria 9872
257 Ga0495654_0014141 3300046530 Bacteria 4254
258 Ga0495654_0027212 3300046530 Bacteria 2933
259 Ga0495654_0029612 3300046530 Bacteria 2790
260 Ga0495654_0041008 3300046530 Bacteria 2304
261 Ga0495609_0000050 3300046538 Bacteria 154752
262 Ga0495609_0000400 3300046538 Bacteria 36477
263 Ga0495609_0000710 3300046538 Bacteria 25510
264 Ga0495609_0011576 3300046538 Bacteria 4199
265 Ga0495609_0026660 3300046538 Bacteria 2645
266 Ga0495597_0000716 3300046542 Bacteria 26633
267 Ga0495597_0008216 3300046542 Bacteria 5247
268 Ga0495597_0014258 3300046542 Bacteria 3787
269 Ga0495622_0001641 3300046557 Bacteria 11056
270 Ga0495622_0001936 3300046557 Bacteria 10181
271 Ga0495633_0000823 3300046558 Bacteria 27456
272 Ga0495633_0012740 3300046558 Bacteria 4459
273 Ga0495656_0013608 3300046615 Bacteria 3031
274 Ga0495668_0000994 3300046616 Bacteria 30653
275 Ga0495668_0002331 3300046616 Bacteria 15814
276 Ga0495668_0017635 3300046616 Bacteria 4137
277 Ga0495668_0018101 3300046616 Bacteria 4075
278 Ga0495634_0019041 3300046642 Bacteria 4880
279 Ga0495611_0000253 3300046648 Bacteria 36971
280 Ga0495611_0009191 3300046648 Bacteria 4172
281 Ga0495611_0028022 3300046648 Bacteria 2466
282 Ga0495625_0001570 3300046660 Bacteria 27173
283 Ga0495625_0002076 3300046660 Bacteria 22440
284 Ga0495625_0007295 3300046660 Bacteria 9659
285 Ga0495625_0014765 3300046660 Bacteria 6216
286 Ga0495625_0015589 3300046660 Bacteria 6013
287 Ga0495625_0041503 3300046660 Bacteria 3349
288 Ga0495625_0054152 3300046660 Bacteria 2866
289 Ga0495659_0000409 3300046664 Bacteria 16466
290 Ga0495661_0004595 3300046665 Bacteria 9937
291 Ga0495661_0005179 3300046665 Bacteria 9289
292 Ga0495661_0009768 3300046665 Bacteria 6570
293 Ga0495661_0015616 3300046665 Bacteria 5064
294 Ga0495646_0011528 3300046680 Bacteria 5613
295 Ga0495613_0001736 3300046689 Bacteria 16578
296 Ga0495624_0000340 3300046690 Bacteria 37084
297 Ga0495670_0000244 3300046691 Bacteria 25203
298 Ga0495670_0010945 3300046691 Bacteria 4460
299 Ga0495670_0022132 3300046691 Bacteria 3138
300 Ga0495671_0000623 3300046692 Bacteria 25945
301 Ga0495671_0000653 3300046692 Bacteria 25191
302 Ga0495671_0001139 3300046692 Bacteria 18252
303 Ga0495671_0001502 3300046692 Bacteria 15615
304 Ga0495671_0003967 3300046692 Bacteria 8954
305 Ga0495671_0009402 3300046692 Bacteria 5458
306 Ga0495671_0019125 3300046692 Bacteria 3624
307 Ga0495671_0019681 3300046692 Bacteria 3563
308 Ga0495649_0000563 3300046694 Bacteria 31327
309 Ga0495649_0000698 3300046694 Bacteria 27401
310 Ga0495649_0000706 3300046694 Bacteria 27259
311 Ga0495649_0003401 3300046694 Bacteria 10755
312 Ga0495649_0005224 3300046694 Bacteria 8309
313 Ga0495649_0006363 3300046694 Bacteria 7348
314 Ga0495649_0009266 3300046694 Bacteria 5863
315 Ga0495649_0022601 3300046694 Bacteria 3518
316 Ga0495649_0058659 3300046694 Bacteria 2073
317 Ga0495589_0000315 3300046794 Bacteria 38563
318 Ga0495589_0004323 3300046794 Bacteria 7584
319 Ga0495589_0013281 3300046794 Bacteria 4250
320 Ga0495660_0000393 3300046810 Bacteria 37812
321 Ga0495660_0000662 3300046810 Bacteria 26712
322 Ga0495660_0000721 3300046810 Bacteria 25298
323 Ga0495660_0001820 3300046810 Bacteria 14001
324 Ga0495660_0001834 3300046810 Bacteria 13940
325 Ga0495660_0004311 3300046810 Bacteria 8627
326 Ga0495660_0007572 3300046810 Bacteria 6374
327 Ga0495660_0010947 3300046810 Bacteria 5272
328 Ga0495660_0024046 3300046810 Bacteria 3471
329 Ga0495660_0028363 3300046810 Bacteria 3163
330 Ga0495660_0069780 3300046810 Bacteria 1867
331 Ga0495604_0080378 3300047317 Bacteria 2442
332 Ga0495672_0007602 3300047320 Bacteria 8132
333 Ga0495672_0007719 3300047320 Bacteria 8054
334 Ga0495672_0007721 3300047320 Bacteria 8052
335 Ga0495672_0009550 3300047320 Bacteria 7014
336 Ga0495672_0011284 3300047320 Bacteria 6314
337 Ga0495672_0034268 3300047320 Bacteria 3138
338 Ga0495672_0044196 3300047320 Bacteria 2674
339 Ga0495676_0000711 3300047321 Bacteria 27711
340 Ga0495676_0015021 3300047321 Bacteria 6911
341 Ga0495683_0000664 3300047323 Bacteria 25477
342 Ga0495683_0000864 3300047323 Bacteria 21379
343 Ga0495683_0001544 3300047323 Bacteria 14906
344 Ga0495683_0005752 3300047323 Bacteria 6833
345 Ga0495683_0010443 3300047323 Bacteria 4908
346 Ga0495679_000519 3300047446 Bacteria 27239
347 Ga0495679_000653 3300047446 Bacteria 23075
348 Ga0495679_002162 3300047446 Bacteria 10318
349 Ga0495673_0000380 3300047469 Bacteria 53034
350 Ga0495673_0000510 3300047469 Bacteria 41036
351 Ga0495673_0001051 3300047469 Bacteria 24300
352 Ga0495673_0001298 3300047469 Bacteria 20342
353 Ga0495673_0002757 3300047469 Bacteria 12027
354 Ga0495673_0003837 3300047469 Bacteria 9701
355 Ga0495673_0008267 3300047469 Bacteria 5868
356 Ga0495673_0011866 3300047469 Bacteria 4656
357 Ga0495673_0023523 3300047469 Bacteria 2995
358 Ga0495681_0000355 3300047470 Bacteria 35815
359 Ga0495681_0000942 3300047470 Bacteria 22368
360 Ga0495681_0001216 3300047470 Bacteria 19587
361 Ga0495681_0007895 3300047470 Bacteria 6729
362 Ga0495681_0017633 3300047470 Bacteria 3957
363 Ga0495684_0030646 3300047471 Bacteria 4130
364 Ga0495686_0001511 3300047472 Bacteria 25037
365 Ga0495686_0015396 3300047472 Bacteria 5223
366 Ga0495686_0025159 3300047472 Bacteria 3903
367 Ga0495686_0035497 3300047472 Bacteria 3204
368 Ga0495593_0048197 3300047673 Bacteria 2264
369 Ga0495602_0017188 3300048088 Bacteria 7253
370 Ga0495626_0000811 3300048091 Bacteria 28252
371 Ga0495626_0001665 3300048091 Bacteria 17155
372 Ga0495626_0002961 3300048091 Bacteria 11273
373 Ga0495626_0006426 3300048091 Bacteria 6694
374 Ga0496110_0016948 3300048913 Bacteria 6089
375 Ga0496112_0034263 3300048915 Bacteria 4940
376 Ga0496116_0001539 3300048919 Bacteria 25544
377 Ga0496116_0001859 3300048919 Bacteria 22851
378 Ga0496116_0002310 3300048919 Bacteria 20212
379 Ga0496116_0005953 3300048919 Bacteria 11184
380 Ga0496117_0002755 3300048920 Bacteria 21530
381 Ga0496117_0012165 3300048920 Bacteria 7621
382 Ga0496117_0016460 3300048920 Bacteria 6241
383 Ga0496118_0019053 3300048921 Bacteria 6151
384 Ga0496118_0084916 3300048921 Bacteria 2206
385 Ga0496121_0003344 3300048924 Bacteria 23010
386 Ga0496121_0008485 3300048924 Bacteria 12056
387 Ga0496121_0034609 3300048924 Bacteria 4544
388 Ga0496122_0001718 3300048925 Bacteria 33984
389 Ga0496122_0017856 3300048925 Bacteria 6594
390 Ga0496122_0095967 3300048925 Bacteria 2001
391 Ga0496123_0001398 3300048926 Bacteria 33814
392 Ga0496124_0000145 3300048927 Bacteria 146878
393 Ga0496124_0008652 3300048927 Bacteria 10596
394 Ga0496124_0017121 3300048927 Bacteria 6850
395 Ga0495678_000031 3300049459 Bacteria 215528
396 Ga0495678_000806 3300049459 Bacteria 28105
397 Ga0495678_000925 3300049459 Bacteria 25690
398 Ga0495678_001058 3300049459 Bacteria 23315
399 Ga0495678_004527 3300049459 Bacteria 8011
400 Ga0495678_006056 3300049459 Bacteria 6513
401 Ga0495678_006470 3300049459 Bacteria 6231
402 Ga0495678_009842 3300049459 Bacteria 4692
403 Ga0495678_015950 3300049459 Bacteria 3447
404 Ga0495678_016945 3300049459 Bacteria 3314
405 Ga0495678_019365 3300049459 Bacteria 3038
406 Ga0495682_0000528 3300049460 Bacteria 26340
407 Ga0495682_0037686 3300049460 Bacteria 1778
408 Ga0501032_0084707 3300049569 Bacteria 2107
409 Ga0501034_0046477 3300049571 Bacteria 4386
410 Ga0501037_0021562 3300049573 Bacteria 4763
411 Ga0501241_000059 3300049758 Bacteria 27538
412 Ga0500572_000136 3300053111 Bacteria 24976
413 Ga0500586_009105 3300053145 Bacteria 2738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0019681 Ga0495671_0019681_1446_2627 391
2 3300042142 Ga0450905_006024 Ga0450905_006024_299_1624 409
3 3300047320 Ga0495672_0044196 Ga0495672_0044196_23_1348 419
4 3300046499 Ga0495594_0031835 Ga0495594_0031835_22_1467 431
5 3300046460 Ga0495638_0039738 Ga0495638_0039738_1504_2946 432
6 3300046660 Ga0495625_0054152 Ga0495625_0054152_1406_2851 435
7 3300046507 Ga0495606_0128265 Ga0495606_0128265_102_1499 440
8 3300046453 Ga0495627_040226 Ga0495627_040226_20_1429 444
9 3300009011 Ga0105251_10000004 Ga0105251_10000004189 445
10 3300009092 Ga0105250_10000179 Ga0105250_1000017924 445
11 3300046452 Ga0495617_017388 Ga0495617_017388_18_1445 445
12 3300009036 Ga0105244_10007953 Ga0105244_100079535 447
13 3300015265 Ga0182005_1001659 Ga0182005_10016596 447
14 3300046460 Ga0495638_0064036 Ga0495638_0064036_241_1731 447
15 3300042016 Ga0439463_010090 Ga0439463_010090_860_2299 454
16 3300013104 Ga0157370_10057591 Ga0157370_100575913 456
17 3300046519 Ga0495632_0019692 Ga0495632_0019692_1422_2945 459
18 iso_pu_bacteria 2728369097 2729145970 463
19 3300046515 Ga0495620_0020038 Ga0495620_0020038_175_1650 464
20 3300047446 Ga0495679_002162 Ga0495679_002162_4447_5922 464
21 3300005288 Ga0065714_10005407 Ga0065714_100054073 465
22 3300014497 Ga0182008_10009835 Ga0182008_100098353 465
23 3300015261 Ga0182006_1003060 Ga0182006_10030604 465
24 3300015262 Ga0182007_10007015 Ga0182007_100070153 465
25 3300025728 Ga0207655_1002950 Ga0207655_10029504 465
26 3300027907 Ga0207428_10017175 Ga0207428_100171752 465
27 3300046475 Ga0495639_0000301 Ga0495639_0000301_16526_18070 465
28 3300046506 Ga0495583_0007733 Ga0495583_0007733_3465_5009 465
29 3300046557 Ga0495622_0001641 Ga0495622_0001641_3519_5063 465
30 3300046664 Ga0495659_0000409 Ga0495659_0000409_8935_10479 465
31 3300046794 Ga0495589_0013281 Ga0495589_0013281_1557_3101 465
32 3300047320 Ga0495672_0009550 Ga0495672_0009550_2152_3696 465
33 3300047323 Ga0495683_0010443 Ga0495683_0010443_1219_2763 465
34 3300048091 Ga0495626_0002961 Ga0495626_0002961_3720_5264 465
35 3300048919 Ga0496116_0002310 Ga0496116_0002310_12699_14243 465
36 3300048921 Ga0496118_0019053 Ga0496118_0019053_3094_4638 465
37 3300048925 Ga0496122_0017856 Ga0496122_0017856_1528_3072 465
38 3300049460 Ga0495682_0037686 Ga0495682_0037686_14_1555 465
39 3300006058 Ga0075432_10004023 Ga0075432_100040232 466
40 3300046460 Ga0495638_0004429 Ga0495638_0004429_5457_7001 466
41 3300046660 Ga0495625_0015589 Ga0495625_0015589_1614_3158 466
42 iso_pu_bacteria 637000220 637322127 466
43 3300046515 Ga0495620_0004648 Ga0495620_0004648_4066_5595 468
44 3300046524 Ga0495648_0003755 Ga0495648_0003755_3720_5249 468
45 3300042147 Ga0450910_000154 Ga0450910_000154_4857_6395 469
46 3300046501 Ga0495607_0000945 Ga0495607_0000945_1571_3115 469
47 3300046453 Ga0495627_003313 Ga0495627_003313_3914_5461 470
48 3300046471 Ga0495650_0005980 Ga0495650_0005980_1114_2661 470
49 3300046500 Ga0495596_0000347 Ga0495596_0000347_15791_17338 470
50 3300046501 Ga0495607_0009114 Ga0495607_0009114_1287_2834 470
51 3300046507 Ga0495606_0018456 Ga0495606_0018456_597_2144 470
52 3300046515 Ga0495620_0006112 Ga0495620_0006112_1574_3121 470
53 3300046519 Ga0495632_0003536 Ga0495632_0003536_4162_5709 470
54 3300046520 Ga0495637_0000859 Ga0495637_0000859_5416_6963 470
55 3300046530 Ga0495654_0003353 Ga0495654_0003353_5048_6595 470
56 3300046616 Ga0495668_0002331 Ga0495668_0002331_5333_6880 470
57 3300046665 Ga0495661_0009768 Ga0495661_0009768_1502_3049 470
58 3300046794 Ga0495589_0004323 Ga0495589_0004323_2781_4328 470
59 3300047469 Ga0495673_0000510 Ga0495673_0000510_31081_32676 470
60 3300047470 Ga0495681_0001216 Ga0495681_0001216_5332_6879 470
61 3300048091 Ga0495626_0001665 Ga0495626_0001665_10461_12008 470
62 3300012498 Ga0157345_1000050 Ga0157345_10000506 471
63 3300013100 Ga0157373_10011239 Ga0157373_100112395 471
64 3300013105 Ga0157369_10001031 Ga0157369_1000103115 471
65 3300046501 Ga0495607_0000723 Ga0495607_0000723_24033_25625 471
66 3300046519 Ga0495632_0027947 Ga0495632_0027947_1029_2621 471
67 3300013308 Ga0157375_10011008 Ga0157375_100110085 472
68 3300046520 Ga0495637_0003593 Ga0495637_0003593_3591_5186 472
69 3300046538 Ga0495609_0011576 Ga0495609_0011576_1279_2925 472
70 3300046810 Ga0495660_0069780 Ga0495660_0069780_349_1854 472
71 3300048927 Ga0496124_0000145 Ga0496124_0000145_60618_62264 472
72 3300048925 Ga0496122_0001718 Ga0496122_0001718_21980_23530 473
73 3300048926 Ga0496123_0001398 Ga0496123_0001398_5818_7368 473
74 3300005290 Ga0065712_10067890 Ga0065712_1006789017 474
75 3300046474 Ga0495605_0021112 Ga0495605_0021112_1344_2954 475
76 3300046506 Ga0495583_0005844 Ga0495583_0005844_334_1947 475
77 3300046538 Ga0495609_0000050 Ga0495609_0000050_65957_67567 475
78 3300047469 Ga0495673_0011866 Ga0495673_0011866_2771_4381 475
79 iso_pu_bacteria 2600255283 2601625819 475
80 iso_pu_bacteria 2738541271 2738689656 475
81 iso_pu_bacteria 2738543016 2739265430 475
82 iso_pu_bacteria 640427133 640487113 475
83 iso_pu_bacteria 651053060 651174988 475
84 3300046522 Ga0495643_0001858 Ga0495643_0001858_11432_13021 476
85 3300046558 Ga0495633_0012740 Ga0495633_0012740_1739_3286 476
86 3300049459 Ga0495678_019365 Ga0495678_019365_980_2569 476
87 iso_pu_bacteria 2599185155 2599330022 477
88 iso_pu_bacteria 2643221571 2643873709 477
89 iso_pu_bacteria 2947233263 2947233481 477
90 iso_pu_bacteria 8056148874 8056153580 477
91 3300013100 Ga0157373_10068006 Ga0157373_100680062 478
92 3300015261 Ga0182006_1002678 Ga0182006_10026786 478
93 3300025711 Ga0207696_1000044 Ga0207696_100004429 478
94 3300025735 Ga0207713_1000013 Ga0207713_1000013233 478
95 3300046460 Ga0495638_0007455 Ga0495638_0007455_4724_6253 478
96 3300046507 Ga0495606_0013293 Ga0495606_0013293_1221_2750 478
97 3300046512 Ga0495610_0050670 Ga0495610_0050670_247_1776 478
98 3300046660 Ga0495625_0007295 Ga0495625_0007295_4410_5939 478
99 3300046810 Ga0495660_0001834 Ga0495660_0001834_9603_11132 478
100 3300047323 Ga0495683_0000864 Ga0495683_0000864_16125_17654 478
101 3300047470 Ga0495681_0007895 Ga0495681_0007895_2834_4363 478
102 3300047472 Ga0495686_0035497 Ga0495686_0035497_302_1831 478
103 iso_pu_bacteria 2826581358 2826585640 478
104 iso_pu_bacteria 2842815866 2842818510 478
105 iso_pu_bacteria 2842849001 2842853200 478
106 iso_pu_bacteria 2945928738 2945931811 478
107 iso_pu_bacteria 8056161164 8056162647 478
108 3300032004 Ga0307414_10182043 Ga0307414_101820431 479
109 3300042004 Ga0439445_0005029 Ga0439445_0005029_208_1719 479
110 3300046458 Ga0495591_002526 Ga0495591_002526_3588_5180 479
111 3300046501 Ga0495607_0018576 Ga0495607_0018576_2108_3691 479
112 3300046506 Ga0495583_0004015 Ga0495583_0004015_3956_5539 479
113 3300046518 Ga0495631_0002142 Ga0495631_0002142_4646_6229 479
114 3300046519 Ga0495632_0007670 Ga0495632_0007670_2236_3819 479
115 3300046520 Ga0495637_0000414 Ga0495637_0000414_8163_9746 479
116 3300046522 Ga0495643_0007653 Ga0495643_0007653_2438_4021 479
117 3300046524 Ga0495648_0001831 Ga0495648_0001831_11502_13085 479
118 3300046530 Ga0495654_0041008 Ga0495654_0041008_368_1951 479
119 3300046616 Ga0495668_0017635 Ga0495668_0017635_2433_4016 479
120 3300046648 Ga0495611_0028022 Ga0495611_0028022_330_1913 479
121 3300046665 Ga0495661_0005179 Ga0495661_0005179_5085_6668 479
122 3300046692 Ga0495671_0001139 Ga0495671_0001139_15910_17493 479
123 3300046810 Ga0495660_0004311 Ga0495660_0004311_4232_5815 479
124 3300047320 Ga0495672_0007602 Ga0495672_0007602_4325_5908 479
125 3300047469 Ga0495673_0002757 Ga0495673_0002757_4983_6566 479
126 3300047469 Ga0495673_0008267 Ga0495673_0008267_725_2308 479
127 3300049459 Ga0495678_000031 Ga0495678_000031_180152_181735 479
128 3300049459 Ga0495678_004527 Ga0495678_004527_2851_4434 479
129 3300003791 Ga0055530_10000047 Ga0055530_1000004713 480
130 3300003792 Ga0055540_1000083 Ga0055540_100008385 480
131 3300009011 Ga0105251_10001636 Ga0105251_1000163612 480
132 3300013100 Ga0157373_10012055 Ga0157373_100120556 480
133 3300025292 Ga0209676_1003246 Ga0209676_10032464 480
134 3300025298 Ga0209050_1000027 Ga0209050_1000027125 480
135 3300025303 Ga0209051_1000065 Ga0209051_100006539 480
136 3300025304 Ga0209257_1006497 Ga0209257_10064974 480
137 3300032005 Ga0307411_10000134 Ga0307411_100001348 480
138 3300042993 Ga0439440_0000927 Ga0439440_0000927_1640_3181 480
139 3300009036 Ga0105244_10000906 Ga0105244_1000090619 481
140 3300013100 Ga0157373_10002323 Ga0157373_100023237 481
141 3300025728 Ga0207655_1005161 Ga0207655_10051613 481
142 3300047469 Ga0495673_0000380 Ga0495673_0000380_12452_14047 481
143 3300048924 Ga0496121_0034609 Ga0496121_0034609_1401_2927 481
144 iso_pu_bacteria 2511231007 2511272154 481
145 iso_pu_bacteria 3007315729 3007319963 481
146 3300005331 Ga0070670_100005718 Ga0070670_1000057185 482
147 3300005353 Ga0070669_100000303 Ga0070669_10000030313 482
148 3300013104 Ga0157370_10000055 Ga0157370_1000005588 482
149 3300046474 Ga0495605_0000031 Ga0495605_0000031_65123_66736 482
150 3300048920 Ga0496117_0012165 Ga0496117_0012165_4443_5972 482
151 3300048920 Ga0496117_0016460 Ga0496117_0016460_4393_5922 482
152 3300013306 Ga0163162_10000258 Ga0163162_1000025824 483
153 3300017792 Ga0163161_10001744 Ga0163161_1000174411 483
154 3300031548 Ga0307408_100062994 Ga0307408_1000629942 483
155 3300046542 Ga0495597_0008216 Ga0495597_0008216_2286_3815 483
156 iso_pu_bacteria 2713897148 2715750412 483
157 iso_pu_bacteria 2842832357 2842837269 483
158 iso_pu_bacteria 2842843487 2842845066 483
159 iso_pu_bacteria 2919385768 2919388416 483
160 iso_pu_bacteria 2919487758 2919490264 483
161 iso_pu_bacteria 2974289157 2974289510 483
162 iso_pu_bacteria 2998139840 2998144405 483
163 iso_pu_bacteria 8029995093 8029996476 483
164 iso_pu_bacteria 8056166840 8056166859 483
165 3300009036 Ga0105244_10027991 Ga0105244_100279912 484
166 3300025728 Ga0207655_1001861 Ga0207655_10018615 484
167 3300046458 Ga0495591_000526 Ga0495591_000526_8304_9848 484
168 3300046491 Ga0495584_0005524 Ga0495584_0005524_1668_3197 484
169 3300046492 Ga0495585_0011459 Ga0495585_0011459_1978_3525 484
170 3300046501 Ga0495607_0042587 Ga0495607_0042587_360_1889 484
171 3300046501 Ga0495607_0051804 Ga0495607_0051804_304_1848 484
172 3300046538 Ga0495609_0026660 Ga0495609_0026660_450_1997 484
173 3300046615 Ga0495656_0013608 Ga0495656_0013608_205_1749 484
174 3300046691 Ga0495670_0022132 Ga0495670_0022132_10_1539 484
175 3300047469 Ga0495673_0023523 Ga0495673_0023523_356_1900 484
176 3300053145 Ga0500586_009105 Ga0500586_009105_545_2092 484
177 iso_pu_bacteria 2554235341 2555671715 484
178 iso_pu_bacteria 2599185160 2599354129 484
179 iso_pu_bacteria 2599185161 2599360192 484
180 iso_pu_bacteria 2599185162 2599366514 484
181 iso_pu_bacteria 2599185163 2599373304 484
182 iso_pu_bacteria 2599185164 2599379237 484
183 iso_pu_bacteria 2599185165 2599385785 484
184 iso_pu_bacteria 2599185166 2599392163 484
185 iso_pu_bacteria 2599185168 2599403929 484
186 iso_pu_bacteria 2599185181 2599460963 484
187 iso_pu_bacteria 2599185182 2599469506 484
188 iso_pu_bacteria 2599185186 2599489983 484
189 iso_pu_bacteria 2599185188 2599503608 484
190 iso_pu_bacteria 2599185300 2599929943 484
191 iso_pu_bacteria 2599185309 2599983689 484
192 iso_pu_bacteria 2599185356 2600213577 484
193 iso_pu_bacteria 2600255313 2601773745 484
194 iso_pu_bacteria 2651869719 2652548344 484
195 iso_pu_bacteria 2667528171 2671096711 484
196 iso_pu_bacteria 2791355520 2794595695 484
197 iso_pu_bacteria 2818991464 2819701804 484
198 iso_pu_bacteria 2844665904 2844672236 484
199 iso_pu_bacteria 2917070673 2917075586 484
200 iso_pu_bacteria 2935353572 2935356574 484
201 iso_pu_bacteria 3007252601 3007255964 484
202 iso_pu_bacteria 3007619802 3007621820 484
203 iso_pu_bacteria 8056172158 8056172847 484
204 3300002737 JGI25162J39368_1000582 JGI25162J39368_100058214 485
205 3300002771 JGI25163J39215_1000571 JGI25163J39215_10005717 485
206 3300002772 JGI25164J39214_1000370 JGI25164J39214_100037010 485
207 3300003214 JGI25165J46597_1000699 JGI25165J46597_100069914 485
208 3300009148 Ga0105243_10001357 Ga0105243_1000135711 485
209 3300013102 Ga0157371_10002679 Ga0157371_1000267910 485
210 3300013102 Ga0157371_10035082 Ga0157371_100350821 485
211 3300014497 Ga0182008_10000861 Ga0182008_1000086111 485
212 3300025207 Ga0209760_100134 Ga0209760_10013414 485
213 3300025231 Ga0207427_100007 Ga0207427_100007307 485
214 3300025233 Ga0209437_100006 Ga0209437_100006573 485
215 3300025261 Ga0209233_1000086 Ga0209233_1000086307 485
216 3300025935 Ga0207709_10000333 Ga0207709_1000033311 485
217 3300027312 Ga0209371_1000232 Ga0209371_100023257 485
218 3300030500 Ga0268256_1000169 Ga0268256_100016976 485
219 3300042439 Ga0439464_0002069 Ga0439464_0002069_1653_3215 485
220 3300046491 Ga0495584_0017940 Ga0495584_0017940_1636_3189 485
221 3300046524 Ga0495648_0005089 Ga0495648_0005089_6144_7691 485
222 3300048919 Ga0496116_0001859 Ga0496116_0001859_9851_11401 485
223 3300048920 Ga0496117_0002755 Ga0496117_0002755_11432_12982 485
224 3300048924 Ga0496121_0003344 Ga0496121_0003344_10038_11588 485
225 iso_pu_bacteria 2511231010 2511288006 485
226 iso_pu_bacteria 2511231011 2511296574 485
227 iso_pu_bacteria 2738543020 2739286403 485
228 iso_pu_bacteria 2738543021 2739291716 485
229 iso_pu_bacteria 2784132063 2784262839 485
230 iso_pu_bacteria 2808606379 2808942955 485
231 iso_pu_bacteria 2842805378 2842808779 485
232 iso_pu_bacteria 2880230671 2880234968 485
233 iso_pu_bacteria 2990196909 2990198378 485
234 iso_pu_bacteria 3007718800 3007720123 485
235 iso_pu_bacteria 8056569372 8056572478 485
236 3300002737 JGI25162J39368_1000224 JGI25162J39368_100022414 486
237 3300002771 JGI25163J39215_1000180 JGI25163J39215_10001808 486
238 3300002772 JGI25164J39214_1000185 JGI25164J39214_100018510 486
239 3300003214 JGI25165J46597_1000315 JGI25165J46597_100031527 486
240 3300025207 Ga0209760_100175 Ga0209760_10017510 486
241 3300025231 Ga0207427_100004 Ga0207427_100004250 486
242 3300025233 Ga0209437_100028 Ga0209437_10002887 486
243 3300025261 Ga0209233_1000008 Ga0209233_1000008797 486
244 3300048915 Ga0496112_0034263 Ga0496112_0034263_88_1626 486
245 iso_pu_bacteria 2511231023 2511368385 486
246 iso_pu_bacteria 2511231031 2511412917 486
247 iso_pu_bacteria 2511231156 2511826641 486
248 iso_pu_bacteria 2718217725 2718635595 486
249 iso_pu_bacteria 2738543025 2739313471 486
250 iso_pu_bacteria 2825651385 2825656118 486
251 iso_pu_bacteria 2969304461 2969309120 486
252 iso_pu_bacteria 3007855910 3007858613 486
253 3300003781 Ga0055536_1000335 Ga0055536_100033513 487
254 3300015261 Ga0182006_1000711 Ga0182006_100071112 487
255 3300025292 Ga0209676_1000365 Ga0209676_100036540 487
256 3300027111 Ga0209281_1001937 Ga0209281_10019378 487
257 3300030735 Ga0316178_1149586 Ga0316178_114958622 487
258 3300031548 Ga0307408_100035953 Ga0307408_1000359532 487
259 3300031548 Ga0307408_100101244 Ga0307408_1001012442 487
260 3300031911 Ga0307412_10034664 Ga0307412_100346642 487
261 3300031911 Ga0307412_10071984 Ga0307412_100719841 487
262 3300041405 Ga0439438_000220 Ga0439438_000220_1722_3260 487
263 3300041405 Ga0439438_000274 Ga0439438_000274_1722_3260 487
264 3300041411 Ga0439466_0000614 Ga0439466_0000614_10869_12440 487
265 3300042006 Ga0439432_002511 Ga0439432_002511_2026_3564 487
266 3300042009 Ga0439451_008109 Ga0439451_008109_198_1736 487
267 3300042010 Ga0439452_000099 Ga0439452_000099_66480_68018 487
268 3300042013 Ga0439456_000623 Ga0439456_000623_3046_4584 487
269 3300042115 Ga0450911_000130 Ga0450911_000130_24002_25540 487
270 3300042137 Ga0450902_002103 Ga0450902_002103_530_2068 487
271 3300042139 Ga0450904_000761 Ga0450904_000761_3805_5343 487
272 3300042145 Ga0450906_000624 Ga0450906_000624_4497_6035 487
273 3300042531 Ga0450918_002382 Ga0450918_002382_1824_3362 487
274 3300046457 Ga0495590_0002344 Ga0495590_0002344_1767_3314 487
275 3300046458 Ga0495591_006292 Ga0495591_006292_2085_3632 487
276 3300046460 Ga0495638_0004269 Ga0495638_0004269_4615_6162 487
277 3300046501 Ga0495607_0002452 Ga0495607_0002452_8827_10374 487
278 3300046519 Ga0495632_0007346 Ga0495632_0007346_2158_3705 487
279 3300046523 Ga0495644_0000603 Ga0495644_0000603_4701_6248 487
280 3300046542 Ga0495597_0014258 Ga0495597_0014258_1460_3007 487
281 3300046648 Ga0495611_0009191 Ga0495611_0009191_539_2086 487
282 3300046694 Ga0495649_0003401 Ga0495649_0003401_4509_6056 487
283 3300046810 Ga0495660_0007572 Ga0495660_0007572_3229_4776 487
284 3300047320 Ga0495672_0007719 Ga0495672_0007719_2915_4462 487
285 3300047323 Ga0495683_0001544 Ga0495683_0001544_8904_10451 487
286 3300047469 Ga0495673_0003837 Ga0495673_0003837_4615_6162 487
287 3300048913 Ga0496110_0016948 Ga0496110_0016948_2924_4471 487
288 3300048927 Ga0496124_0008652 Ga0496124_0008652_4316_5863 487
289 3300049459 Ga0495678_015950 Ga0495678_015950_1445_2992 487
290 3300006946 Ga0079104_1000909 Ga0079104_100090910 488
291 3300006948 Ga0099826_10001047 Ga0099826_1000104712 488
292 3300027111 Ga0209281_1000010 Ga0209281_1000010265 488
293 3300041997 Ga0439431_0001697 Ga0439431_0001697_2063_3601 488
294 3300042006 Ga0439432_001565 Ga0439432_001565_3111_4649 488
295 3300046452 Ga0495617_006238 Ga0495617_006238_1153_2700 488
296 3300046458 Ga0495591_000733 Ga0495591_000733_10022_11569 488
297 3300046460 Ga0495638_0003534 Ga0495638_0003534_5403_6950 488
298 3300046491 Ga0495584_0004150 Ga0495584_0004150_2763_4304 488
299 3300046513 Ga0495616_0027495 Ga0495616_0027495_1291_2838 488
300 3300046518 Ga0495631_0005255 Ga0495631_0005255_4228_5775 488
301 3300046660 Ga0495625_0014765 Ga0495625_0014765_3054_4601 488
302 3300046692 Ga0495671_0001502 Ga0495671_0001502_10552_12093 488
303 3300046692 Ga0495671_0003967 Ga0495671_0003967_4130_5677 488
304 3300046694 Ga0495649_0009266 Ga0495649_0009266_1187_2734 488
305 3300046810 Ga0495660_0010947 Ga0495660_0010947_1512_3107 488
306 3300046810 Ga0495660_0024046 Ga0495660_0024046_1025_2572 488
307 3300047320 Ga0495672_0007721 Ga0495672_0007721_2915_4462 488
308 3300047472 Ga0495686_0015396 Ga0495686_0015396_2725_4272 488
309 3300049459 Ga0495678_016945 Ga0495678_016945_1375_2922 488
310 3300049569 Ga0501032_0084707 Ga0501032_0084707_514_2094 488
311 3300049571 Ga0501034_0046477 Ga0501034_0046477_1603_3183 488
312 3300049573 Ga0501037_0021562 Ga0501037_0021562_255_1835 488
313 3300003323 rootH1_10261452 rootH1_102614522 489
314 3300005548 Ga0070665_100082500 Ga0070665_1000825003 489
315 3300009036 Ga0105244_10003461 Ga0105244_100034619 489
316 3300009092 Ga0105250_10000553 Ga0105250_1000055311 489
317 3300009148 Ga0105243_10004240 Ga0105243_100042405 489
318 3300011119 Ga0105246_10005899 Ga0105246_100058997 489
319 3300013100 Ga0157373_10075532 Ga0157373_100755322 489
320 3300013307 Ga0157372_10006820 Ga0157372_100068209 489
321 3300015261 Ga0182006_1005478 Ga0182006_10054781 489
322 3300017792 Ga0163161_10013829 Ga0163161_100138293 489
323 3300025711 Ga0207696_1002103 Ga0207696_10021035 489
324 3300025728 Ga0207655_1000895 Ga0207655_10008959 489
325 3300025728 Ga0207655_1003104 Ga0207655_10031045 489
326 3300025735 Ga0207713_1019848 Ga0207713_10198482 489
327 3300025933 Ga0207706_10040942 Ga0207706_100409423 489
328 3300025935 Ga0207709_10000013 Ga0207709_10000013283 489
329 3300028379 Ga0268266_10069444 Ga0268266_100694442 489
330 3300038705 Ga0237819_00779 Ga0237819_00779_7758_9302 489
331 3300041404 Ga0439436_0000678 Ga0439436_0000678_1036_2619 489
332 3300041405 Ga0439438_000409 Ga0439438_000409_10293_11876 489
333 3300041407 Ga0439447_000113 Ga0439447_000113_177_1760 489
334 3300041411 Ga0439466_0000764 Ga0439466_0000764_1640_3223 489
335 3300042010 Ga0439452_004726 Ga0439452_004726_1445_3028 489
336 3300042156 Ga0439446_0000286 Ga0439446_0000286_4652_6235 489
337 3300046452 Ga0495617_016991 Ga0495617_016991_820_2367 489
338 3300046453 Ga0495627_000628 Ga0495627_000628_4175_5731 489
339 3300046453 Ga0495627_001164 Ga0495627_001164_15078_16625 489
340 3300046454 Ga0495592_0021596 Ga0495592_0021596_1417_2964 489
341 3300046458 Ga0495591_013263 Ga0495591_013263_384_1931 489
342 3300046460 Ga0495638_0003630 Ga0495638_0003630_4323_5870 489
343 3300046463 Ga0495653_0000838 Ga0495653_0000838_4432_5979 489
344 3300046471 Ga0495650_0020509 Ga0495650_0020509_1499_3046 489
345 3300046474 Ga0495605_0000606 Ga0495605_0000606_22013_23569 489
346 3300046501 Ga0495607_0009145 Ga0495607_0009145_3524_5080 489
347 3300046507 Ga0495606_0000684 Ga0495606_0000684_39123_40715 489
348 3300046507 Ga0495606_0001941 Ga0495606_0001941_20380_21927 489
349 3300046507 Ga0495606_0032772 Ga0495606_0032772_1593_3140 489
350 3300046513 Ga0495616_0000582 Ga0495616_0000582_22191_23747 489
351 3300046513 Ga0495616_0007574 Ga0495616_0007574_3727_5274 489
352 3300046515 Ga0495620_0008898 Ga0495620_0008898_1793_3340 489
353 3300046515 Ga0495620_0009692 Ga0495620_0009692_3253_4800 489
354 3300046518 Ga0495631_0000491 Ga0495631_0000491_20378_21925 489
355 3300046519 Ga0495632_0000849 Ga0495632_0000849_21903_23459 489
356 3300046520 Ga0495637_0017052 Ga0495637_0017052_690_2246 489
357 3300046522 Ga0495643_0000116 Ga0495643_0000116_103496_105085 489
358 3300046524 Ga0495648_0001036 Ga0495648_0001036_22191_23747 489
359 3300046530 Ga0495654_0000422 Ga0495654_0000422_12140_13696 489
360 3300046530 Ga0495654_0000691 Ga0495654_0000691_3519_5063 489
361 3300046538 Ga0495609_0000710 Ga0495609_0000710_22191_23747 489
362 3300046557 Ga0495622_0001936 Ga0495622_0001936_3516_5063 489
363 3300046558 Ga0495633_0000823 Ga0495633_0000823_5743_7290 489
364 3300046642 Ga0495634_0019041 Ga0495634_0019041_2030_3577 489
365 3300046660 Ga0495625_0041503 Ga0495625_0041503_272_1819 489
366 3300046680 Ga0495646_0011528 Ga0495646_0011528_3363_4910 489
367 3300046689 Ga0495613_0001736 Ga0495613_0001736_4329_5876 489
368 3300046690 Ga0495624_0000340 Ga0495624_0000340_21206_22753 489
369 3300046691 Ga0495670_0010945 Ga0495670_0010945_1900_3456 489
370 3300046692 Ga0495671_0000623 Ga0495671_0000623_3498_5045 489
371 3300046692 Ga0495671_0000653 Ga0495671_0000653_2929_4518 489
372 3300046692 Ga0495671_0019125 Ga0495671_0019125_860_2407 489
373 3300046694 Ga0495649_0000563 Ga0495649_0000563_25337_26884 489
374 3300046694 Ga0495649_0000706 Ga0495649_0000706_3513_5069 489
375 3300046694 Ga0495649_0005224 Ga0495649_0005224_2799_4391 489
376 3300046694 Ga0495649_0022601 Ga0495649_0022601_1353_2900 489
377 3300046694 Ga0495649_0058659 Ga0495649_0058659_40_1629 489
378 3300046810 Ga0495660_0000721 Ga0495660_0000721_20249_21796 489
379 3300047317 Ga0495604_0080378 Ga0495604_0080378_730_2277 489
380 3300047320 Ga0495672_0011284 Ga0495672_0011284_1342_2889 489
381 3300047320 Ga0495672_0034268 Ga0495672_0034268_1443_2990 489
382 3300047321 Ga0495676_0015021 Ga0495676_0015021_1895_3442 489
383 3300047323 Ga0495683_0000664 Ga0495683_0000664_22046_23602 489
384 3300047446 Ga0495679_000519 Ga0495679_000519_22152_23708 489
385 3300047469 Ga0495673_0001051 Ga0495673_0001051_19228_20784 489
386 3300047470 Ga0495681_0017633 Ga0495681_0017633_1594_3183 489
387 3300047471 Ga0495684_0030646 Ga0495684_0030646_747_2294 489
388 3300047673 Ga0495593_0048197 Ga0495593_0048197_599_2146 489
389 3300048088 Ga0495602_0017188 Ga0495602_0017188_1285_2832 489
390 3300048091 Ga0495626_0000811 Ga0495626_0000811_22191_23747 489
391 3300048919 Ga0496116_0005953 Ga0496116_0005953_6120_7667 489
392 3300048921 Ga0496118_0084916 Ga0496118_0084916_66_1613 489
393 3300048924 Ga0496121_0008485 Ga0496121_0008485_6101_7648 489
394 3300048925 Ga0496122_0095967 Ga0496122_0095967_336_1883 489
395 3300048927 Ga0496124_0017121 Ga0496124_0017121_4429_5976 489
396 3300049459 Ga0495678_000806 Ga0495678_000806_22191_23747 489
397 3300053111 Ga0500572_000136 Ga0500572_000136_19918_21465 489
398 2162886007 SwRhRL2b_contig_2802131 SwRhRL2b_0934.00001620 490
399 3300005288 Ga0065714_10003602 Ga0065714_100036027 490
400 3300005289 Ga0065704_10001489 Ga0065704_100014899 490
401 3300006051 Ga0075364_10035266 Ga0075364_100352662 490
402 3300013100 Ga0157373_10000390 Ga0157373_1000039012 490
403 3300017792 Ga0163161_10000759 Ga0163161_100007595 490
404 3300025728 Ga0207655_1011799 Ga0207655_10117992 490
405 3300031548 Ga0307408_100020659 Ga0307408_1000206592 490
406 3300031911 Ga0307412_10017211 Ga0307412_100172113 490
407 3300033180 Ga0307510_10000993 Ga0307510_1000099311 490
408 3300046452 Ga0495617_000398 Ga0495617_000398_3521_5068 490
409 3300046452 Ga0495617_003325 Ga0495617_003325_1698_3245 490
410 3300046453 Ga0495627_000556 Ga0495627_000556_8332_9879 490
411 3300046458 Ga0495591_000498 Ga0495591_000498_20053_21600 490
412 3300046458 Ga0495591_000582 Ga0495591_000582_22720_24276 490
413 3300046458 Ga0495591_000671 Ga0495591_000671_3503_5050 490
414 3300046458 Ga0495591_002288 Ga0495591_002288_6212_7759 490
415 3300046458 Ga0495591_006542 Ga0495591_006542_1770_3317 490
416 3300046458 Ga0495591_006733 Ga0495591_006733_1618_3165 490
417 3300046491 Ga0495584_0001956 Ga0495584_0001956_4488_6035 490
418 3300046491 Ga0495584_0018800 Ga0495584_0018800_59_1606 490
419 3300046491 Ga0495584_0028787 Ga0495584_0028787_523_2070 490
420 3300046492 Ga0495585_0000885 Ga0495585_0000885_20240_21787 490
421 3300046492 Ga0495585_0002880 Ga0495585_0002880_6213_7760 490
422 3300046492 Ga0495585_0006397 Ga0495585_0006397_4167_5714 490
423 3300046492 Ga0495585_0008139 Ga0495585_0008139_1919_3475 490
424 3300046500 Ga0495596_0009900 Ga0495596_0009900_1865_3412 490
425 3300046500 Ga0495596_0017013 Ga0495596_0017013_1320_2867 490
426 3300046501 Ga0495607_0001058 Ga0495607_0001058_3434_4981 490
427 3300046501 Ga0495607_0006423 Ga0495607_0006423_1689_3236 490
428 3300046506 Ga0495583_0004049 Ga0495583_0004049_4683_6230 490
429 3300046507 Ga0495606_0001798 Ga0495606_0001798_4234_5781 490
430 3300046507 Ga0495606_0006079 Ga0495606_0006079_6213_7760 490
431 3300046512 Ga0495610_0001434 Ga0495610_0001434_475_2022 490
432 3300046512 Ga0495610_0003809 Ga0495610_0003809_3513_5060 490
433 3300046513 Ga0495616_0000681 Ga0495616_0000681_3504_5051 490
434 3300046515 Ga0495620_0000312 Ga0495620_0000312_22473_24020 490
435 3300046515 Ga0495620_0013358 Ga0495620_0013358_1008_2555 490
436 3300046518 Ga0495631_0011610 Ga0495631_0011610_1648_3195 490
437 3300046519 Ga0495632_0001058 Ga0495632_0001058_20337_21884 490
438 3300046519 Ga0495632_0004446 Ga0495632_0004446_7163_8719 490
439 3300046519 Ga0495632_0023391 Ga0495632_0023391_1447_2994 490
440 3300046519 Ga0495632_0027101 Ga0495632_0027101_1290_2837 490
441 3300046520 Ga0495637_0000378 Ga0495637_0000378_19157_20704 490
442 3300046520 Ga0495637_0000555 Ga0495637_0000555_21739_23286 490
443 3300046522 Ga0495643_0001426 Ga0495643_0001426_447_1994 490
444 3300046522 Ga0495643_0012929 Ga0495643_0012929_1692_3239 490
445 3300046524 Ga0495648_0001189 Ga0495648_0001189_4453_6000 490
446 3300046524 Ga0495648_0001355 Ga0495648_0001355_19154_20701 490
447 3300046524 Ga0495648_0010193 Ga0495648_0010193_1161_2708 490
448 3300046524 Ga0495648_0025476 Ga0495648_0025476_1161_2708 490
449 3300046530 Ga0495654_0014141 Ga0495654_0014141_1610_3157 490
450 3300046530 Ga0495654_0027212 Ga0495654_0027212_899_2446 490
451 3300046530 Ga0495654_0029612 Ga0495654_0029612_49_1596 490
452 3300046538 Ga0495609_0000400 Ga0495609_0000400_24528_26075 490
453 3300046542 Ga0495597_0000716 Ga0495597_0000716_20429_21976 490
454 3300046616 Ga0495668_0000994 Ga0495668_0000994_25382_26929 490
455 3300046616 Ga0495668_0018101 Ga0495668_0018101_1406_2953 490
456 3300046648 Ga0495611_0000253 Ga0495611_0000253_14527_16074 490
457 3300046660 Ga0495625_0001570 Ga0495625_0001570_22101_23657 490
458 3300046660 Ga0495625_0002076 Ga0495625_0002076_17377_18924 490
459 3300046665 Ga0495661_0004595 Ga0495661_0004595_6712_8259 490
460 3300046665 Ga0495661_0015616 Ga0495661_0015616_1655_3202 490
461 3300046691 Ga0495670_0000244 Ga0495670_0000244_20141_21688 490
462 3300046692 Ga0495671_0009402 Ga0495671_0009402_1240_2787 490
463 3300046694 Ga0495649_0000698 Ga0495649_0000698_4325_5872 490
464 3300046694 Ga0495649_0006363 Ga0495649_0006363_818_2365 490
465 3300046794 Ga0495589_0000315 Ga0495589_0000315_22416_23963 490
466 3300046810 Ga0495660_0000393 Ga0495660_0000393_13896_15452 490
467 3300046810 Ga0495660_0000662 Ga0495660_0000662_20963_22519 490
468 3300046810 Ga0495660_0001820 Ga0495660_0001820_8121_9668 490
469 3300046810 Ga0495660_0028363 Ga0495660_0028363_1600_3147 490
470 3300047321 Ga0495676_0000711 Ga0495676_0000711_4450_5997 490
471 3300047323 Ga0495683_0005752 Ga0495683_0005752_2688_4235 490
472 3300047446 Ga0495679_000653 Ga0495679_000653_1820_3367 490
473 3300047469 Ga0495673_0001298 Ga0495673_0001298_15280_16827 490
474 3300047470 Ga0495681_0000355 Ga0495681_0000355_12744_14291 490
475 3300047470 Ga0495681_0000942 Ga0495681_0000942_3521_5068 490
476 3300047472 Ga0495686_0001511 Ga0495686_0001511_19966_21513 490
477 3300047472 Ga0495686_0025159 Ga0495686_0025159_761_2308 490
478 3300048091 Ga0495626_0006426 Ga0495626_0006426_1926_3473 490
479 3300048919 Ga0496116_0001539 Ga0496116_0001539_3519_5066 490
480 3300049459 Ga0495678_000925 Ga0495678_000925_3753_5300 490
481 3300049459 Ga0495678_001058 Ga0495678_001058_1853_3400 490
482 3300049459 Ga0495678_006056 Ga0495678_006056_3492_5048 490
483 3300049459 Ga0495678_006470 Ga0495678_006470_1265_2812 490
484 3300049459 Ga0495678_009842 Ga0495678_009842_1323_2882 490
485 3300049460 Ga0495682_0000528 Ga0495682_0000528_4426_5973 490
486 3300049758 Ga0501241_000059 Ga0501241_000059_3550_5097 490

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13559

DUF4129

Domain of unknown function (DUF4129)

457

528

0.96

Feature Viewer

pLDDT pTM Quality
67.89 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map