F453283

General Info

Members Datasets Scaffolds Average Seq Length
486 258 972 70

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10627313|Ga0207428_106273132
Length 83
Sequence VVEGVESPPRMFWRIVIGAVVVLFLVMWVRAVIDVFVRRPDLSGVGKAAWAIGMLVVPFVGLLIYTMLRPADSQIASHRRKRS

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
91 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
161 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
162 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
163 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
164 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
165 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
166 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 7
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 22.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10627313 3300027907 Unclassified 773
2 JGI25407J50210_10001534 3300003373 Bacteria 5257
3 JGI25407J50210_10011697 3300003373 Bacteria 2246
4 Ga0070683_100301035 3300005329 Bacteria 1526
5 Ga0070690_100196278 3300005330 Unclassified 1402
6 Ga0070677_10175673 3300005333 Bacteria 1016
7 Ga0068869_101453265 3300005334 Bacteria 608
8 Ga0070666_11479648 3300005335 Bacteria 508
9 Ga0070680_100207727 3300005336 Bacteria 1651
10 Ga0070680_100918740 3300005336 Bacteria 755
11 Ga0070682_100006897 3300005337 Bacteria 6387
12 Ga0068868_100199320 3300005338 Bacteria 1668
13 Ga0068868_100242480 3300005338 Bacteria 1515
14 Ga0068868_100654016 3300005338 Unclassified 936
15 Ga0068868_101598182 3300005338 Bacteria 612
16 Ga0070660_100027595 3300005339 Bacteria 4239
17 Ga0070660_101273809 3300005339 Unclassified 624
18 Ga0070689_100005858 3300005340 Bacteria 8440
19 Ga0070689_100293802 3300005340 Bacteria 1351
20 Ga0070687_100506239 3300005343 Bacteria 814
21 Ga0070661_100373414 3300005344 Bacteria 1123
22 Ga0070661_100423030 3300005344 Bacteria 1056
23 Ga0070692_10163331 3300005345 Unclassified 1278
24 Ga0070668_100692991 3300005347 Bacteria 898
25 Ga0070669_101224546 3300005353 Bacteria 649
26 Ga0070675_101741538 3300005354 Bacteria 575
27 Ga0070671_100087766 3300005355 Unclassified 2603
28 Ga0070671_101730539 3300005355 Bacteria 555
29 Ga0070674_100047130 3300005356 Bacteria 2951
30 Ga0070674_100263508 3300005356 Bacteria 1359
31 Ga0070674_101274854 3300005356 Bacteria 654
32 Ga0070673_100226875 3300005364 Bacteria 1619
33 Ga0070688_100230806 3300005365 Unclassified 1309
34 Ga0070659_101454259 3300005366 Bacteria 610
35 Ga0070667_100312479 3300005367 Bacteria 1417
36 Ga0070714_101901077 3300005435 Unclassified 581
37 Ga0070713_100126215 3300005436 Bacteria 2251
38 Ga0070710_10028485 3300005437 Plasmid 2989
39 Ga0070711_100430773 3300005439 Unclassified 1076
40 Ga0070705_100019402 3300005440 Bacteria 3578
41 Ga0070700_100006153 3300005441 Bacteria 6396
42 Ga0070694_100117379 3300005444 Unclassified 1905
43 Ga0070694_101342804 3300005444 Bacteria 602
44 Ga0070663_100676616 3300005455 Bacteria 875
45 Ga0070678_100034167 3300005456 Bacteria 3539
46 Ga0070678_100039873 3300005456 Bacteria 3318
47 Ga0070678_100326137 3300005456 Unclassified 1312
48 Ga0070662_100318189 3300005457 Unclassified 1268
49 Ga0070681_10138769 3300005458 Unclassified 2361
50 Ga0068867_100088438 3300005459 Unclassified 2347
51 Ga0068867_100536371 3300005459 Bacteria 1011
52 Ga0068867_101283796 3300005459 Bacteria 675
53 Ga0070685_10451554 3300005466 Unclassified 900
54 Ga0070685_10462497 3300005466 Bacteria 891
55 Ga0070685_11080206 3300005466 Bacteria 605
56 Ga0070684_100047170 3300005535 Bacteria 3733
57 Ga0070684_100168800 3300005535 Bacteria 1987
58 Ga0068853_100021549 3300005539 Bacteria 5375
59 Ga0070672_100443179 3300005543 Unclassified 1118
60 Ga0070672_101638051 3300005543 Bacteria 578
61 Ga0070686_100012151 3300005544 Bacteria 4898
62 Ga0070686_100511238 3300005544 Bacteria 934
63 Ga0070695_100424787 3300005545 Bacteria 1013
64 Ga0070695_100426700 3300005545 Unclassified 1011
65 Ga0070696_100597371 3300005546 Bacteria 889
66 Ga0070696_100766672 3300005546 Unclassified 792
67 Ga0070665_100711414 3300005548 Unclassified 1017
68 Ga0070665_101590221 3300005548 Bacteria 662
69 Ga0070704_100162187 3300005549 Bacteria 1769
70 Ga0070704_100421853 3300005549 Bacteria 1143
71 Ga0070704_100904962 3300005549 Bacteria 794
72 Ga0068855_100586592 3300005563 Unclassified 1203
73 Ga0070664_100675276 3300005564 Bacteria 961
74 Ga0068857_100008383 3300005577 Bacteria 8932
75 Ga0068857_100199674 3300005577 Bacteria 1823
76 Ga0068857_102415660 3300005577 Unclassified 516
77 Ga0068856_101169487 3300005614 Unclassified 786
78 Ga0070702_100057120 3300005615 Unclassified 2256
79 Ga0070702_100103578 3300005615 Bacteria 1750
80 Ga0068852_100034966 3300005616 Unclassified 4185
81 Ga0068859_101293156 3300005617 Bacteria 804
82 Ga0068864_100750999 3300005618 Bacteria 956
83 Ga0068866_10068009 3300005718 Bacteria 1872
84 Ga0068866_10682226 3300005718 Bacteria 703
85 Ga0068861_100082710 3300005719 Unclassified 2517
86 Ga0068861_102633720 3300005719 Bacteria 507
87 Ga0068870_10357142 3300005840 Bacteria 939
88 Ga0068870_11044013 3300005840 Bacteria 585
89 Ga0068860_100259703 3300005843 Bacteria 1693
90 Ga0068860_100735094 3300005843 Unclassified 998
91 Ga0068862_100526025 3300005844 Unclassified 1126
92 Ga0068862_100897887 3300005844 Bacteria 871
93 Ga0068862_101467594 3300005844 Bacteria 687
94 Ga0081455_10019673 3300005937 Bacteria 6377
95 Ga0081455_10022605 3300005937 Bacteria 5874
96 Ga0081455_10059451 3300005937 Bacteria 3227
97 Ga0081455_10100939 3300005937 Unclassified 2317
98 Ga0081455_10110748 3300005937 Bacteria 2182
99 Ga0081455_10592828 3300005937 Unclassified 724
100 Ga0081538_10000184 3300005981 Bacteria 68601
101 Ga0081538_10004936 3300005981 Bacteria 12151
102 Ga0081538_10005180 3300005981 Bacteria 11799
103 Ga0081538_10091737 3300005981 Unclassified 1567
104 Ga0070717_10407824 3300006028 Bacteria 1221
105 Ga0075368_10201273 3300006042 Unclassified 843
106 Ga0075363_100471387 3300006048 Unclassified 743
107 Ga0075363_100617959 3300006048 Bacteria 650
108 Ga0075432_10067820 3300006058 Bacteria 1278
109 Ga0070715_10146708 3300006163 Unclassified 1152
110 Ga0070716_100015938 3300006173 Bacteria 3872
111 Ga0075367_10251506 3300006178 Bacteria 1108
112 Ga0075367_10795666 3300006178 Bacteria 602
113 Ga0097621_100212613 3300006237 Unclassified 1683
114 Ga0075428_102169902 3300006844 Unclassified 573
115 Ga0075431_100245114 3300006847 Bacteria 1822
116 Ga0075433_10032954 3300006852 Bacteria 4439
117 Ga0075434_100075775 3300006871 Bacteria 3358
118 Ga0075434_102205868 3300006871 Bacteria 554
119 Ga0068865_100006897 3300006881 Bacteria 6960
120 Ga0068865_100180190 3300006881 Bacteria 1626
121 Ga0068865_100581214 3300006881 Bacteria 944
122 Ga0068865_100943938 3300006881 Bacteria 752
123 Ga0075436_100025415 3300006914 Bacteria 4076
124 Ga0097620_101293160 3300006931 Bacteria 804
125 Ga0075435_100008824 3300007076 Bacteria 7262
126 Ga0105240_12180259 3300009093 Bacteria 575
127 Ga0111539_10033929 3300009094 Bacteria 6193
128 Ga0111539_10101725 3300009094 Bacteria 3374
129 Ga0111539_10802799 3300009094 Unclassified 1095
130 Ga0105245_10014659 3300009098 Bacteria 6825
131 Ga0105245_10023954 3300009098 Bacteria 5358
132 Ga0105245_10121542 3300009098 Bacteria 2440
133 Ga0105245_10129285 3300009098 Bacteria 2367
134 Ga0105247_11114741 3300009101 Unclassified 623
135 Ga0114129_10002432 3300009147 Bacteria 25835
136 Ga0114129_11748790 3300009147 Bacteria 757
137 Ga0105243_10003658 3300009148 Bacteria 12371
138 Ga0105243_10104572 3300009148 Unclassified 2357
139 Ga0105243_10332753 3300009148 Bacteria 1388
140 Ga0105243_10637006 3300009148 Bacteria 1031
141 Ga0105243_12247727 3300009148 Bacteria 582
142 Ga0105243_12268427 3300009148 Unclassified 580
143 Ga0105243_12680811 3300009148 Bacteria 538
144 Ga0105241_12307916 3300009174 Unclassified 536
145 Ga0105242_10029108 3300009176 Bacteria 4403
146 Ga0105242_10048457 3300009176 Bacteria 3453
147 Ga0105242_10201056 3300009176 Bacteria 1770
148 Ga0105242_10448307 3300009176 Bacteria 1216
149 Ga0105242_12418643 3300009176 Bacteria 573
150 Ga0105248_10132191 3300009177 Bacteria 2816
151 Ga0105248_12049184 3300009177 Bacteria 650
152 Ga0105237_10098235 3300009545 Bacteria 2919
153 Ga0105237_10340843 3300009545 Bacteria 1503
154 Ga0105249_10015651 3300009553 Bacteria 6716
155 Ga0105249_10244174 3300009553 Bacteria 1777
156 Ga0105249_10686430 3300009553 Bacteria 1083
157 Ga0105249_13268051 3300009553 Bacteria 521
158 Ga0105239_10737590 3300010375 Unclassified 1127
159 Ga0105239_10886446 3300010375 Bacteria 1024
160 Ga0105239_11315622 3300010375 Unclassified 834
161 Ga0105239_12599184 3300010375 Bacteria 590
162 Ga0105239_12756592 3300010375 Bacteria 574
163 Ga0105246_10004572 3300011119 Bacteria 8423
164 Ga0157329_1025728 3300012491 Bacteria 582
165 Ga0157315_1062792 3300012508 Bacteria 528
166 Ga0157369_12193748 3300013105 Bacteria 560
167 Ga0157374_11788475 3300013296 Unclassified 640
168 Ga0157378_10064051 3300013297 Unclassified 3287
169 Ga0163162_10106366 3300013306 Unclassified 2901
170 Ga0157372_10155531 3300013307 Bacteria 2641
171 Ga0157375_10045712 3300013308 Bacteria 4263
172 Ga0157375_10131859 3300013308 Unclassified 2619
173 Ga0157375_10211852 3300013308 Bacteria 2095
174 Ga0157375_10335935 3300013308 Unclassified 1676
175 Ga0163163_10656860 3300014325 Bacteria 1112
176 Ga0163163_10999711 3300014325 Bacteria 900
177 Ga0157380_10008451 3300014326 Bacteria 7353
178 Ga0157380_10052010 3300014326 Bacteria 3242
179 Ga0157380_10552671 3300014326 Unclassified 1130
180 Ga0157380_11650218 3300014326 Bacteria 697
181 Ga0182008_10647191 3300014497 Unclassified 598
182 Ga0157377_10158949 3300014745 Bacteria 1404
183 Ga0157379_10232565 3300014968 Bacteria 1671
184 Ga0157379_10511643 3300014968 Bacteria 1114
185 Ga0157379_10942527 3300014968 Unclassified 821
186 Ga0157376_10022961 3300014969 Unclassified 4873
187 Ga0157376_10024071 3300014969 Bacteria 4775
188 Ga0207642_10561105 3300025899 Unclassified 706
189 Ga0207647_10633867 3300025904 Unclassified 587
190 Ga0207685_10094986 3300025905 Bacteria 1264
191 Ga0207699_10242899 3300025906 Unclassified 1238
192 Ga0207654_10093607 3300025911 Unclassified 1837
193 Ga0207693_10051231 3300025915 Bacteria 3240
194 Ga0207663_10034790 3300025916 Plasmid 3016
195 Ga0207660_11018274 3300025917 Bacteria 675
196 Ga0207662_10227547 3300025918 Bacteria 1217
197 Ga0207662_10230424 3300025918 Unclassified 1210
198 Ga0207657_10063900 3300025919 Unclassified 3144
199 Ga0207657_11401788 3300025919 Unclassified 525
200 Ga0207649_10655124 3300025920 Bacteria 812
201 Ga0207681_10975925 3300025923 Bacteria 711
202 Ga0207681_11345778 3300025923 Bacteria 600
203 Ga0207659_10549520 3300025926 Bacteria 981
204 Ga0207687_10489821 3300025927 Bacteria 1025
205 Ga0207687_10824819 3300025927 Bacteria 792
206 Ga0207687_11713756 3300025927 Unclassified 539
207 Ga0207644_11812235 3300025931 Unclassified 511
208 Ga0207706_10498900 3300025933 Unclassified 1051
209 Ga0207706_10617282 3300025933 Bacteria 930
210 Ga0207686_10141323 3300025934 Unclassified 1664
211 Ga0207686_10255026 3300025934 Bacteria 1283
212 Ga0207686_10422190 3300025934 Unclassified 1020
213 Ga0207709_10011195 3300025935 Bacteria 4947
214 Ga0207670_10327952 3300025936 Unclassified 1206
215 Ga0207669_10116066 3300025937 Bacteria 1806
216 Ga0207669_10297217 3300025937 Bacteria 1225
217 Ga0207669_11083599 3300025937 Bacteria 676
218 Ga0207669_11247480 3300025937 Unclassified 630
219 Ga0207704_10009330 3300025938 Bacteria 4729
220 Ga0207704_10291124 3300025938 Bacteria 1246
221 Ga0207704_10543297 3300025938 Bacteria 943
222 Ga0207704_10969431 3300025938 Bacteria 718
223 Ga0207665_10044501 3300025939 Bacteria 2971
224 Ga0207691_10066248 3300025940 Bacteria 3268
225 Ga0207691_10077749 3300025940 Unclassified 2988
226 Ga0207661_10013956 3300025944 Bacteria 5874
227 Ga0207661_10356424 3300025944 Bacteria 1321
228 Ga0207661_10930356 3300025944 Bacteria 801
229 Ga0207661_11478089 3300025944 Bacteria 623
230 Ga0207679_11386916 3300025945 Bacteria 645
231 Ga0207667_10667207 3300025949 Unclassified 1044
232 Ga0207651_10084275 3300025960 Bacteria 2302
233 Ga0207712_10203361 3300025961 Unclassified 1572
234 Ga0207712_10805909 3300025961 Bacteria 826
235 Ga0207668_10208356 3300025972 Unclassified 1562
236 Ga0207658_10224927 3300025986 Bacteria 1581
237 Ga0207658_11005567 3300025986 Bacteria 761
238 Ga0207677_10176680 3300026023 Bacteria 1676
239 Ga0207677_10546819 3300026023 Bacteria 1008
240 Ga0207677_11117559 3300026023 Bacteria 719
241 Ga0207639_10042220 3300026041 Bacteria 3416
242 Ga0207678_10147474 3300026067 Unclassified 2008
243 Ga0207708_10035755 3300026075 Bacteria 3780
244 Ga0207708_10094033 3300026075 Bacteria 2314
245 Ga0207702_11503193 3300026078 Unclassified 667
246 Ga0207702_11653491 3300026078 Bacteria 633
247 Ga0207648_10010961 3300026089 Bacteria 8563
248 Ga0207648_10180117 3300026089 Bacteria 1870
249 Ga0207648_10953820 3300026089 Bacteria 802
250 Ga0207676_10568581 3300026095 Bacteria 1085
251 Ga0207676_10975910 3300026095 Bacteria 834
252 Ga0207674_10001721 3300026116 Bacteria 27983
253 Ga0207674_10195720 3300026116 Bacteria 1971
254 Ga0207674_11572258 3300026116 Bacteria 626
255 Ga0207675_101086253 3300026118 Unclassified 820
256 Ga0207675_101610996 3300026118 Unclassified 670
257 Ga0207683_10003118 3300026121 Bacteria 14482
258 Ga0207683_10030154 3300026121 Bacteria 4698
259 Ga0207683_11376676 3300026121 Bacteria 652
260 Ga0207698_10113040 3300026142 Unclassified 2281
261 Ga0207428_10332660 3300027907 Bacteria 1120
262 Ga0268266_10497414 3300028379 Bacteria 1164
263 Ga0268266_12121789 3300028379 Bacteria 535
264 Ga0268264_10334420 3300028381 Unclassified 1436
265 Ga0268264_11313106 3300028381 Bacteria 734
266 Ga0307408_102006766 3300031548 Bacteria 556
267 Ga0307416_100135286 3300032002 Bacteria 2228
268 Ga0307416_101024133 3300032002 Bacteria 929
269 Ga0307415_100530281 3300032126 Bacteria 1035
270 Ga0307415_100544187 3300032126 Bacteria 1023
271 Ga0307415_102365566 3300032126 Unclassified 522
272 Ga0373951_0115297 3300035091 Bacteria 727
273 Ga0373936_0346445 3300035113 Bacteria 676
274 Ga0373961_0145660 3300035241 Bacteria 803
275 Ga0373935_0338338 3300035692 Bacteria 1071
276 Ga0373925_0603520 3300037068 Bacteria 904
277 Ga0395899_0017298 3300037312 Bacteria 5494
278 Ga0395900_0047054 3300037418 Bacteria 4442
279 Ga0395900_0321539 3300037418 Bacteria 1527
280 Ga0395900_0656950 3300037418 Unclassified 985
281 Ga0395898_0151189 3300037466 Unclassified 2221
282 Ga0395898_0184686 3300037466 Unclassified 1992
283 Ga0395898_0326627 3300037466 Bacteria 1463
284 Ga0395898_0532457 3300037466 Bacteria 1116
285 Ga0395905_0012300 3300037471 Bacteria 8238
286 Ga0395905_1425816 3300037471 Bacteria 597
287 Ga0395901_0030613 3300038443 Bacteria 5545
288 Ga0395901_0057686 3300038443 Bacteria 4038
289 Ga0395901_0220227 3300038443 Bacteria 1984
290 Ga0395901_0373347 3300038443 Bacteria 1469
291 Ga0395901_0513321 3300038443 Bacteria 1218
292 Ga0395901_0524054 3300038443 Bacteria 1204
293 Ga0451800_0495141 3300041459 Bacteria 582
294 Ga0451849_1064379 3300041505 Unclassified 927
295 Ga0439454_005708 3300042011 Bacteria 1498
296 Ga0450920_062345 3300042122 Bacteria 754
297 Ga0450920_136007 3300042122 Bacteria 519
298 Ga0450902_055224 3300042137 Bacteria 684
299 Ga0450907_004776 3300042146 Bacteria 2320
300 Ga0450907_019297 3300042146 Bacteria 1143
301 Ga0450907_089719 3300042146 Bacteria 534
302 Ga0450918_118283 3300042531 Bacteria 528
303 Ga0439440_0195431 3300042993 Bacteria 598
304 Ga0439440_0224885 3300042993 Bacteria 564
305 Ga0451576_0266101 3300045051 Bacteria 1792
306 Ga0495592_0332295 3300046454 Bacteria 979
307 Ga0495603_0023973 3300046455 Bacteria 3691
308 Ga0495603_0039194 3300046455 Bacteria 2840
309 Ga0495603_0117639 3300046455 Unclassified 1549
310 Ga0495603_0556658 3300046455 Bacteria 657
311 Ga0495629_0353689 3300046459 Bacteria 1002
312 Ga0495582_0051676 3300046473 Unclassified 2266
313 Ga0495582_0184505 3300046473 Bacteria 1189
314 Ga0495582_0379354 3300046473 Bacteria 815
315 Ga0495639_0101707 3300046475 Bacteria 1357
316 Ga0495584_0463794 3300046491 Bacteria 645
317 Ga0495584_0739235 3300046491 Bacteria 502
318 Ga0495594_0075107 3300046499 Bacteria 1884
319 Ga0495607_0427960 3300046501 Bacteria 598
320 Ga0495618_0174592 3300046514 Bacteria 1367
321 Ga0495630_0416805 3300046517 Bacteria 1029
322 Ga0495630_0672678 3300046517 Bacteria 792
323 Ga0495644_0034682 3300046523 Bacteria 1905
324 Ga0495663_0028471 3300046525 Unclassified 1645
325 Ga0495665_0014212 3300046531 Bacteria 4295
326 Ga0495586_0547816 3300046535 Bacteria 668
327 Ga0495622_0123247 3300046557 Unclassified 1183
328 Ga0495656_0029624 3300046615 Bacteria 2205
329 Ga0495656_0270969 3300046615 Unclassified 863
330 Ga0495668_0122956 3300046616 Bacteria 1420
331 Ga0495635_0347325 3300046663 Bacteria 990
332 Ga0495588_0114249 3300046674 Bacteria 1423
333 Ga0495599_0228428 3300046678 Bacteria 1137
334 Ga0495647_0021653 3300046681 Bacteria 2316
335 Ga0495647_0107227 3300046681 Bacteria 1162
336 Ga0495658_0035094 3300046683 Bacteria 2757
337 Ga0495658_0055989 3300046683 Bacteria 2248
338 Ga0495658_0434195 3300046683 Unclassified 838
339 Ga0495613_0173792 3300046689 Bacteria 1528
340 Ga0495624_0071156 3300046690 Bacteria 2164
341 Ga0495624_0677175 3300046690 Unclassified 613
342 Ga0495670_0569181 3300046691 Bacteria 617
343 Ga0495600_0439417 3300046809 Bacteria 808
344 Ga0495581_0001437 3300047315 Bacteria 13221
345 Ga0495581_0032370 3300047315 Unclassified 3028
346 Ga0495674_0387504 3300047319 Bacteria 1130
347 Ga0495676_0016250 3300047321 Bacteria 6609
348 Ga0495676_0395712 3300047321 Unclassified 917
349 Ga0495680_0808072 3300047322 Bacteria 612
350 Ga0495684_0250535 3300047471 Bacteria 1289
351 Ga0496100_0065960 3300048903 Archaea 2400
352 Ga0496100_0841338 3300048903 Unclassified 720
353 Ga0496101_0009438 3300048904 Bacteria 6413
354 Ga0496101_1484310 3300048904 Unclassified 528
355 Ga0496102_0322771 3300048905 Unclassified 1454
356 Ga0496103_0101736 3300048906 Unclassified 1819
357 Ga0496104_0101002 3300048907 Bacteria 2762
358 Ga0496104_0477360 3300048907 Bacteria 1158
359 Ga0496104_0588683 3300048907 Bacteria 1023
360 Ga0496104_1230014 3300048907 Unclassified 652
361 Ga0496106_0033923 3300048909 Unclassified 3810
362 Ga0496106_1585230 3300048909 Bacteria 502
363 Ga0496107_0007056 3300048910 Bacteria 7739
364 Ga0496108_0084460 3300048911 Bacteria 2694
365 Ga0496108_0100803 3300048911 Bacteria 2463
366 Ga0496108_0184759 3300048911 Unclassified 1806
367 Ga0496108_0764116 3300048911 Bacteria 835
368 Ga0496109_0001057 3300048912 Bacteria 22765
369 Ga0496109_0074871 3300048912 Bacteria 3113
370 Ga0496109_0211289 3300048912 Bacteria 1825
371 Ga0496109_0369415 3300048912 Bacteria 1355
372 Ga0496109_1074826 3300048912 Bacteria 742
373 Ga0496110_0035632 3300048913 Plasmid 4318
374 Ga0496110_0162895 3300048913 Bacteria 2022
375 Ga0496110_0388687 3300048913 Bacteria 1272
376 Ga0496111_0005808 3300048914 Bacteria 7958
377 Ga0496111_0671586 3300048914 Bacteria 755
378 Ga0496111_0726469 3300048914 Unclassified 721
379 Ga0496112_0556314 3300048915 Unclassified 1081
380 Ga0496114_0017680 3300048917 Bacteria 5759
381 Ga0496114_0452861 3300048917 Bacteria 1136
382 Ga0496114_1028509 3300048917 Bacteria 707
383 Ga0496115_0284013 3300048918 Unclassified 1358
384 Ga0501031_0000382 3300049568 Bacteria 25981
385 Ga0501031_0015637 3300049568 Bacteria 4926
386 Ga0501032_0028513 3300049569 Bacteria 3837
387 Ga0501032_0263064 3300049569 Unclassified 1118
388 Ga0501033_0008594 3300049570 Bacteria 7903
389 Ga0501033_0195725 3300049570 Bacteria 1445
390 Ga0501036_0023080 3300049572 Bacteria 5236
391 Ga0501036_0124552 3300049572 Bacteria 2176
392 Ga0501037_0009467 3300049573 Bacteria 7152
393 Ga0501038_0001801 3300049574 Bacteria 19835
394 Ga0501038_0024688 3300049574 Bacteria 5359
395 Ga0501039_0007301 3300049575 Bacteria 8416
396 Ga0501039_0013582 3300049575 Bacteria 6228
397 Ga0501039_0186422 3300049575 Unclassified 1632
398 Ga0501040_0002044 3300049576 Bacteria 12995
399 Ga0501040_0003029 3300049576 Bacteria 10892
400 Ga0501040_0129211 3300049576 Bacteria 1776
401 Ga0501040_0796053 3300049576 Bacteria 684
402 Ga0501041_0005475 3300049577 Bacteria 7434
403 Ga0501041_0028753 3300049577 Bacteria 3353
404 Ga0501041_0556086 3300049577 Bacteria 731
405 Ga0501042_0016076 3300049578 Bacteria 5134
406 Ga0501042_0096532 3300049578 Bacteria 2124
407 Ga0501042_0125551 3300049578 Bacteria 1847
408 Ga0501042_0126137 3300049578 Bacteria 1843
409 Ga0501042_0292354 3300049578 Bacteria 1177
410 Ga0501043_0121850 3300049579 Bacteria 2045
411 Ga0501046_0005915 3300049580 Bacteria 10895
412 Ga0501046_0022193 3300049580 Bacteria 5231
413 Ga0501046_0483765 3300049580 Bacteria 888
414 Ga0501048_0003212 3300049582 Bacteria 12449
415 Ga0501048_0011521 3300049582 Bacteria 6592
416 Ga0501067_0415051 3300049583 Bacteria 751
417 Ga0501068_0001694 3300049584 Bacteria 11742
418 Ga0501068_0585858 3300049584 Bacteria 726
419 Ga0501069_0013715 3300049585 Bacteria 4323
420 Ga0501069_0351293 3300049585 Bacteria 869
421 Ga0501070_0001660 3300049586 Bacteria 19720
422 Ga0501070_0071369 3300049586 Bacteria 2875
423 Ga0501071_0000334 3300049587 Bacteria 22757
424 Ga0501071_0002102 3300049587 Bacteria 11953
425 Ga0501071_0067349 3300049587 Bacteria 2604
426 Ga0501071_0659177 3300049587 Bacteria 805
427 Ga0501072_0002164 3300049588 Bacteria 14677
428 Ga0501072_0478263 3300049588 Bacteria 986
429 Ga0501072_0501066 3300049588 Bacteria 960
430 Ga0501072_1354620 3300049588 Bacteria 551
431 Ga0501072_1383620 3300049588 Bacteria 544
432 Ga0501074_0000892 3300049590 Bacteria 19069
433 Ga0501074_0001075 3300049590 Bacteria 17840
434 Ga0501075_0010300 3300049591 Bacteria 6569
435 Ga0501075_0035126 3300049591 Bacteria 3737
436 Ga0501075_1094399 3300049591 Bacteria 605
437 Ga0501076_0001842 3300049592 Bacteria 14421
438 Ga0501076_0015251 3300049592 Bacteria 5805
439 Ga0501076_0153444 3300049592 Bacteria 1874
440 Ga0501077_0003072 3300049593 Bacteria 10027
441 Ga0501077_0004992 3300049593 Bacteria 8043
442 Ga0501079_0002912 3300049741 Bacteria 12497
443 Ga0501079_0035423 3300049741 Bacteria 3841
444 Ga0501079_1495407 3300049741 Bacteria 531
445 Ga0501080_0000525 3300049742 Bacteria 30085
446 Ga0501080_0016866 3300049742 Bacteria 6745
447 Ga0501080_1432150 3300049742 Bacteria 589
448 Ga0501081_0000535 3300049743 Bacteria 21478
449 Ga0501081_0004992 3300049743 Bacteria 8540
450 Ga0501081_0175576 3300049743 Bacteria 1548
451 Ga0501083_0009026 3300049744 Bacteria 7037
452 Ga0501083_0056886 3300049744 Bacteria 2620
453 Ga0501035_0026257 3300049822 Bacteria 5330
454 Ga0501035_0127839 3300049822 Bacteria 2217
455 Ga0501044_0040464 3300049823 Bacteria 4858
456 Ga0501044_0409149 3300049823 Bacteria 1268
457 Ga0501045_0000594 3300049824 Bacteria 22751
458 Ga0501045_0014620 3300049824 Bacteria 5565
459 Ga0501045_0780744 3300049824 Bacteria 704
460 Ga0501045_0975874 3300049824 Unclassified 622
461 nmdc:mga0yw44_138279_c1 3300050492 Bacteria 1581
462 nmdc:mga06z11_434801_c1 3300050494 Unclassified 792
463 nmdc:mga04h51_241526_c1 3300050495 Unclassified 721
464 nmdc:mga05p37_8517_c1 3300050507 Bacteria 12121
465 nmdc:mga06r32_1670137_c1 3300050510 Unclassified 574
466 nmdc:mga06r32_177570_c1 3300050510 Bacteria 2114
467 nmdc:mga08y16_1022444_c1 3300050511 Unclassified 805
468 nmdc:mga08y16_11162_c1 3300050511 Bacteria 9434
469 nmdc:mga08y16_41399_c1 3300050511 Bacteria 4825
470 nmdc:mga0n895_1220990_c1 3300050512 Unclassified 725
471 nmdc:mga0n895_43470_c1 3300050512 Bacteria 4378
472 nmdc:mga0rr50_22888_c1 3300050513 Bacteria 4298
473 nmdc:mga08x19_93625_c1 3300050514 Bacteria 1986
474 nmdc:mga0a205_41861_c1 3300050515 Bacteria 4413
475 Ga0495601_0070399 3300053077 Bacteria 2233
476 Ga0495619_0351994 3300053085 Bacteria 1019
477 Ga0501084_0024139 3300054114 Bacteria 5072
478 Ga0501084_0039766 3300054114 Bacteria 3933
479 Ga0501084_0093369 3300054114 Bacteria 2526
480 Ga0501084_0133583 3300054114 Bacteria 2089
481 Ga0501082_0010480 3300060353 Bacteria 7976
482 Ga0501082_0028101 3300060353 Bacteria 4846
483 Ga0501082_0437062 3300060353 Bacteria 1143
484 Ga0530510_0008620 3300061734 Bacteria 7123
485 Ga0530510_0017440 3300061734 Bacteria 5089
486 Ga0530510_0897791 3300061734 Bacteria 677
487 Ga0207428_10627313
488 JGI25407J50210_10001534
489 JGI25407J50210_10011697
490 Ga0070683_100301035
491 Ga0070690_100196278
492 Ga0070677_10175673
493 Ga0068869_101453265
494 Ga0070666_11479648
495 Ga0070680_100207727
496 Ga0070680_100918740
497 Ga0070682_100006897
498 Ga0068868_100199320
499 Ga0068868_100242480
500 Ga0068868_100654016
501 Ga0068868_101598182
502 Ga0070660_100027595
503 Ga0070660_101273809
504 Ga0070689_100005858
505 Ga0070689_100293802
506 Ga0070687_100506239
507 Ga0070661_100373414
508 Ga0070661_100423030
509 Ga0070692_10163331
510 Ga0070668_100692991
511 Ga0070669_101224546
512 Ga0070675_101741538
513 Ga0070671_100087766
514 Ga0070671_101730539
515 Ga0070674_100047130
516 Ga0070674_100263508
517 Ga0070674_101274854
518 Ga0070673_100226875
519 Ga0070688_100230806
520 Ga0070659_101454259
521 Ga0070667_100312479
522 Ga0070714_101901077
523 Ga0070713_100126215
524 Ga0070710_10028485
525 Ga0070711_100430773
526 Ga0070705_100019402
527 Ga0070700_100006153
528 Ga0070694_100117379
529 Ga0070694_101342804
530 Ga0070663_100676616
531 Ga0070678_100034167
532 Ga0070678_100039873
533 Ga0070678_100326137
534 Ga0070662_100318189
535 Ga0070681_10138769
536 Ga0068867_100088438
537 Ga0068867_100536371
538 Ga0068867_101283796
539 Ga0070685_10451554
540 Ga0070685_10462497
541 Ga0070685_11080206
542 Ga0070684_100047170
543 Ga0070684_100168800
544 Ga0068853_100021549
545 Ga0070672_100443179
546 Ga0070672_101638051
547 Ga0070686_100012151
548 Ga0070686_100511238
549 Ga0070695_100424787
550 Ga0070695_100426700
551 Ga0070696_100597371
552 Ga0070696_100766672
553 Ga0070665_100711414
554 Ga0070665_101590221
555 Ga0070704_100162187
556 Ga0070704_100421853
557 Ga0070704_100904962
558 Ga0068855_100586592
559 Ga0070664_100675276
560 Ga0068857_100008383
561 Ga0068857_100199674
562 Ga0068857_102415660
563 Ga0068856_101169487
564 Ga0070702_100057120
565 Ga0070702_100103578
566 Ga0068852_100034966
567 Ga0068859_101293156
568 Ga0068864_100750999
569 Ga0068866_10068009
570 Ga0068866_10682226
571 Ga0068861_100082710
572 Ga0068861_102633720
573 Ga0068870_10357142
574 Ga0068870_11044013
575 Ga0068860_100259703
576 Ga0068860_100735094
577 Ga0068862_100526025
578 Ga0068862_100897887
579 Ga0068862_101467594
580 Ga0081455_10019673
581 Ga0081455_10022605
582 Ga0081455_10059451
583 Ga0081455_10100939
584 Ga0081455_10110748
585 Ga0081455_10592828
586 Ga0081538_10000184
587 Ga0081538_10004936
588 Ga0081538_10005180
589 Ga0081538_10091737
590 Ga0070717_10407824
591 Ga0075368_10201273
592 Ga0075363_100471387
593 Ga0075363_100617959
594 Ga0075432_10067820
595 Ga0070715_10146708
596 Ga0070716_100015938
597 Ga0075367_10251506
598 Ga0075367_10795666
599 Ga0097621_100212613
600 Ga0075428_102169902
601 Ga0075431_100245114
602 Ga0075433_10032954
603 Ga0075434_100075775
604 Ga0075434_102205868
605 Ga0068865_100006897
606 Ga0068865_100180190
607 Ga0068865_100581214
608 Ga0068865_100943938
609 Ga0075436_100025415
610 Ga0097620_101293160
611 Ga0075435_100008824
612 Ga0105240_12180259
613 Ga0111539_10033929
614 Ga0111539_10101725
615 Ga0111539_10802799
616 Ga0105245_10014659
617 Ga0105245_10023954
618 Ga0105245_10121542
619 Ga0105245_10129285
620 Ga0105247_11114741
621 Ga0114129_10002432
622 Ga0114129_11748790
623 Ga0105243_10003658
624 Ga0105243_10104572
625 Ga0105243_10332753
626 Ga0105243_10637006
627 Ga0105243_12247727
628 Ga0105243_12268427
629 Ga0105243_12680811
630 Ga0105241_12307916
631 Ga0105242_10029108
632 Ga0105242_10048457
633 Ga0105242_10201056
634 Ga0105242_10448307
635 Ga0105242_12418643
636 Ga0105248_10132191
637 Ga0105248_12049184
638 Ga0105237_10098235
639 Ga0105237_10340843
640 Ga0105249_10015651
641 Ga0105249_10244174
642 Ga0105249_10686430
643 Ga0105249_13268051
644 Ga0105239_10737590
645 Ga0105239_10886446
646 Ga0105239_11315622
647 Ga0105239_12599184
648 Ga0105239_12756592
649 Ga0105246_10004572
650 Ga0157329_1025728
651 Ga0157315_1062792
652 Ga0157369_12193748
653 Ga0157374_11788475
654 Ga0157378_10064051
655 Ga0163162_10106366
656 Ga0157372_10155531
657 Ga0157375_10045712
658 Ga0157375_10131859
659 Ga0157375_10211852
660 Ga0157375_10335935
661 Ga0163163_10656860
662 Ga0163163_10999711
663 Ga0157380_10008451
664 Ga0157380_10052010
665 Ga0157380_10552671
666 Ga0157380_11650218
667 Ga0182008_10647191
668 Ga0157377_10158949
669 Ga0157379_10232565
670 Ga0157379_10511643
671 Ga0157379_10942527
672 Ga0157376_10022961
673 Ga0157376_10024071
674 Ga0207642_10561105
675 Ga0207647_10633867
676 Ga0207685_10094986
677 Ga0207699_10242899
678 Ga0207654_10093607
679 Ga0207693_10051231
680 Ga0207663_10034790
681 Ga0207660_11018274
682 Ga0207662_10227547
683 Ga0207662_10230424
684 Ga0207657_10063900
685 Ga0207657_11401788
686 Ga0207649_10655124
687 Ga0207681_10975925
688 Ga0207681_11345778
689 Ga0207659_10549520
690 Ga0207687_10489821
691 Ga0207687_10824819
692 Ga0207687_11713756
693 Ga0207644_11812235
694 Ga0207706_10498900
695 Ga0207706_10617282
696 Ga0207686_10141323
697 Ga0207686_10255026
698 Ga0207686_10422190
699 Ga0207709_10011195
700 Ga0207670_10327952
701 Ga0207669_10116066
702 Ga0207669_10297217
703 Ga0207669_11083599
704 Ga0207669_11247480
705 Ga0207704_10009330
706 Ga0207704_10291124
707 Ga0207704_10543297
708 Ga0207704_10969431
709 Ga0207665_10044501
710 Ga0207691_10066248
711 Ga0207691_10077749
712 Ga0207661_10013956
713 Ga0207661_10356424
714 Ga0207661_10930356
715 Ga0207661_11478089
716 Ga0207679_11386916
717 Ga0207667_10667207
718 Ga0207651_10084275
719 Ga0207712_10203361
720 Ga0207712_10805909
721 Ga0207668_10208356
722 Ga0207658_10224927
723 Ga0207658_11005567
724 Ga0207677_10176680
725 Ga0207677_10546819
726 Ga0207677_11117559
727 Ga0207639_10042220
728 Ga0207678_10147474
729 Ga0207708_10035755
730 Ga0207708_10094033
731 Ga0207702_11503193
732 Ga0207702_11653491
733 Ga0207648_10010961
734 Ga0207648_10180117
735 Ga0207648_10953820
736 Ga0207676_10568581
737 Ga0207676_10975910
738 Ga0207674_10001721
739 Ga0207674_10195720
740 Ga0207674_11572258
741 Ga0207675_101086253
742 Ga0207675_101610996
743 Ga0207683_10003118
744 Ga0207683_10030154
745 Ga0207683_11376676
746 Ga0207698_10113040
747 Ga0207428_10332660
748 Ga0268266_10497414
749 Ga0268266_12121789
750 Ga0268264_10334420
751 Ga0268264_11313106
752 Ga0307408_102006766
753 Ga0307416_100135286
754 Ga0307416_101024133
755 Ga0307415_100530281
756 Ga0307415_100544187
757 Ga0307415_102365566
758 Ga0373951_0115297
759 Ga0373936_0346445
760 Ga0373961_0145660
761 Ga0373935_0338338
762 Ga0373925_0603520
763 Ga0395899_0017298
764 Ga0395900_0047054
765 Ga0395900_0321539
766 Ga0395900_0656950
767 Ga0395898_0151189
768 Ga0395898_0184686
769 Ga0395898_0326627
770 Ga0395898_0532457
771 Ga0395905_0012300
772 Ga0395905_1425816
773 Ga0395901_0030613
774 Ga0395901_0057686
775 Ga0395901_0220227
776 Ga0395901_0373347
777 Ga0395901_0513321
778 Ga0395901_0524054
779 Ga0451800_0495141
780 Ga0451849_1064379
781 Ga0439454_005708
782 Ga0450920_062345
783 Ga0450920_136007
784 Ga0450902_055224
785 Ga0450907_004776
786 Ga0450907_019297
787 Ga0450907_089719
788 Ga0450918_118283
789 Ga0439440_0195431
790 Ga0439440_0224885
791 Ga0451576_0266101
792 Ga0495592_0332295
793 Ga0495603_0023973
794 Ga0495603_0039194
795 Ga0495603_0117639
796 Ga0495603_0556658
797 Ga0495629_0353689
798 Ga0495582_0051676
799 Ga0495582_0184505
800 Ga0495582_0379354
801 Ga0495639_0101707
802 Ga0495584_0463794
803 Ga0495584_0739235
804 Ga0495594_0075107
805 Ga0495607_0427960
806 Ga0495618_0174592
807 Ga0495630_0416805
808 Ga0495630_0672678
809 Ga0495644_0034682
810 Ga0495663_0028471
811 Ga0495665_0014212
812 Ga0495586_0547816
813 Ga0495622_0123247
814 Ga0495656_0029624
815 Ga0495656_0270969
816 Ga0495668_0122956
817 Ga0495635_0347325
818 Ga0495588_0114249
819 Ga0495599_0228428
820 Ga0495647_0021653
821 Ga0495647_0107227
822 Ga0495658_0035094
823 Ga0495658_0055989
824 Ga0495658_0434195
825 Ga0495613_0173792
826 Ga0495624_0071156
827 Ga0495624_0677175
828 Ga0495670_0569181
829 Ga0495600_0439417
830 Ga0495581_0001437
831 Ga0495581_0032370
832 Ga0495674_0387504
833 Ga0495676_0016250
834 Ga0495676_0395712
835 Ga0495680_0808072
836 Ga0495684_0250535
837 Ga0496100_0065960
838 Ga0496100_0841338
839 Ga0496101_0009438
840 Ga0496101_1484310
841 Ga0496102_0322771
842 Ga0496103_0101736
843 Ga0496104_0101002
844 Ga0496104_0477360
845 Ga0496104_0588683
846 Ga0496104_1230014
847 Ga0496106_0033923
848 Ga0496106_1585230
849 Ga0496107_0007056
850 Ga0496108_0084460
851 Ga0496108_0100803
852 Ga0496108_0184759
853 Ga0496108_0764116
854 Ga0496109_0001057
855 Ga0496109_0074871
856 Ga0496109_0211289
857 Ga0496109_0369415
858 Ga0496109_1074826
859 Ga0496110_0035632
860 Ga0496110_0162895
861 Ga0496110_0388687
862 Ga0496111_0005808
863 Ga0496111_0671586
864 Ga0496111_0726469
865 Ga0496112_0556314
866 Ga0496114_0017680
867 Ga0496114_0452861
868 Ga0496114_1028509
869 Ga0496115_0284013
870 Ga0501031_0000382
871 Ga0501031_0015637
872 Ga0501032_0028513
873 Ga0501032_0263064
874 Ga0501033_0008594
875 Ga0501033_0195725
876 Ga0501036_0023080
877 Ga0501036_0124552
878 Ga0501037_0009467
879 Ga0501038_0001801
880 Ga0501038_0024688
881 Ga0501039_0007301
882 Ga0501039_0013582
883 Ga0501039_0186422
884 Ga0501040_0002044
885 Ga0501040_0003029
886 Ga0501040_0129211
887 Ga0501040_0796053
888 Ga0501041_0005475
889 Ga0501041_0028753
890 Ga0501041_0556086
891 Ga0501042_0016076
892 Ga0501042_0096532
893 Ga0501042_0125551
894 Ga0501042_0126137
895 Ga0501042_0292354
896 Ga0501043_0121850
897 Ga0501046_0005915
898 Ga0501046_0022193
899 Ga0501046_0483765
900 Ga0501048_0003212
901 Ga0501048_0011521
902 Ga0501067_0415051
903 Ga0501068_0001694
904 Ga0501068_0585858
905 Ga0501069_0013715
906 Ga0501069_0351293
907 Ga0501070_0001660
908 Ga0501070_0071369
909 Ga0501071_0000334
910 Ga0501071_0002102
911 Ga0501071_0067349
912 Ga0501071_0659177
913 Ga0501072_0002164
914 Ga0501072_0478263
915 Ga0501072_0501066
916 Ga0501072_1354620
917 Ga0501072_1383620
918 Ga0501074_0000892
919 Ga0501074_0001075
920 Ga0501075_0010300
921 Ga0501075_0035126
922 Ga0501075_1094399
923 Ga0501076_0001842
924 Ga0501076_0015251
925 Ga0501076_0153444
926 Ga0501077_0003072
927 Ga0501077_0004992
928 Ga0501079_0002912
929 Ga0501079_0035423
930 Ga0501079_1495407
931 Ga0501080_0000525
932 Ga0501080_0016866
933 Ga0501080_1432150
934 Ga0501081_0000535
935 Ga0501081_0004992
936 Ga0501081_0175576
937 Ga0501083_0009026
938 Ga0501083_0056886
939 Ga0501035_0026257
940 Ga0501035_0127839
941 Ga0501044_0040464
942 Ga0501044_0409149
943 Ga0501045_0000594
944 Ga0501045_0014620
945 Ga0501045_0780744
946 Ga0501045_0975874
947 nmdc:mga0yw44_138279_c1
948 nmdc:mga06z11_434801_c1
949 nmdc:mga04h51_241526_c1
950 nmdc:mga05p37_8517_c1
951 nmdc:mga06r32_1670137_c1
952 nmdc:mga06r32_177570_c1
953 nmdc:mga08y16_1022444_c1
954 nmdc:mga08y16_11162_c1
955 nmdc:mga08y16_41399_c1
956 nmdc:mga0n895_1220990_c1
957 nmdc:mga0n895_43470_c1
958 nmdc:mga0rr50_22888_c1
959 nmdc:mga08x19_93625_c1
960 nmdc:mga0a205_41861_c1
961 Ga0495601_0070399
962 Ga0495619_0351994
963 Ga0501084_0024139
964 Ga0501084_0039766
965 Ga0501084_0093369
966 Ga0501084_0133583
967 Ga0501082_0010480
968 Ga0501082_0028101
969 Ga0501082_0437062
970 Ga0530510_0008620
971 Ga0530510_0017440
972 Ga0530510_0897791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13396

PLDc_N

Phospholipase_D-nuclease N-terminal

16

70

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lur-assembly1.cif.gz_C stable effector functionless 2 (sefl2) igg1 fc scaffold bound to a minimized version of the b-domain (mini-z) from protein a called z34c 0.7437 16 43
1zdc-assembly1.cif.gz_A disulfide-stabilized mini protein a domain, z34c, nmr, 24 structures 0.7276 18 43
7ta3-assembly2.cif.gz_C trimer-to-monomer disruption of tumor necrosis factor-alpha (tnf-alpha) by alpha-peptide-3 0.7056 22 44
5kko-assembly1.cif.gz_E-2 a 1.55a x-ray structure from vibrio cholerae o1 biovar el tor of a hypothetical protein 0.6831 17 61
7lur-assembly1.cif.gz_C stable effector functionless 2 (sefl2) igg1 fc scaffold bound to a minimized version of the b-domain (mini-z) from protein a called z34c 0.6524 16 43
ID Description Score Start End Superfamily
af_Q2G1S4_2_164_1.10.860.10 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.8934 14 45 1.10.860.10
af_Q8IG67_436_543_6.10.140.1450 Special;Helix non-globular;Helix Hairpins; 0.8176 18 50 6.10.140.1450
af_I6X8R2_50_439_1.10.1380.10 Mainly Alpha;Orthogonal Bundle;Neutral endopeptidase; domain 2;Neutral endopeptidase , domain2 0.743 8 43 1.10.1380.10
3n5lB03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.655 18 43 1.20.58.90
2hydA01 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.6501 13 49 1.20.1560.10
ID Description Score Start End GO Terms
AF-A0A6A6W5K2-F1-model_v4 SnoaL-like domain-containing protein 0.8637 6 50
AF-A0A538DJI8-F1-model_v4 Cardiolipin synthase N-terminal domain-containing protein 0.8538 4 61 GO:0005886
AF-A0A1G9R4I5-F1-model_v4 Phospholipase_D-nuclease N-terminal 0.8262 4 57 GO:0005886
AF-A0A2E9GBL6-F1-model_v4 deleted 0.8225 7 61
AF-A0A3M8FP53-F1-model_v4 Peptidase M56 domain-containing protein 0.8164 3 61 GO:0016020

Map