F453226

General Info

Members Datasets Scaffolds Average Seq Length
486 211 486 178

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100752906|Ga0070679_1007529061
Length 204
Sequence MTGRAGLRTGNIPGPCYTDVAIRYGQSMRGYFGVGVDGISKPMNLGNLVRIAHAFDASFFFSVAPRLKLSDAQSDTSRAEGALPFYSFPRFEDLRLPKGCRLVGVEITDDAVELPRFRHPHRAAYVFGAERFSLSPRMLAACEFVVKIPTRFSINVGMAGAIVLYDRMLSLGGYGQRPVKAGGQGAEMPPPHTWGAPLARPRDS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 0
Rhizoplane 1.03
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10237805 3300003320 Unclassified 2307
2 Ga0070658_10065347 3300005327 Bacteria 2969
3 Ga0070658_10372169 3300005327 Bacteria 1225
4 Ga0070658_11009203 3300005327 Bacteria 724
5 Ga0070680_100025011 3300005336 Bacteria 4773
6 Ga0068868_101003356 3300005338 Bacteria 764
7 Ga0070689_100497489 3300005340 Bacteria 1044
8 Ga0070691_10000635 3300005341 Bacteria 13554
9 Ga0070691_10169579 3300005341 Bacteria 1130
10 Ga0070661_100004939 3300005344 Bacteria 9181
11 Ga0070674_100503502 3300005356 Unclassified 1009
12 Ga0070674_100608463 3300005356 Unclassified 924
13 Ga0070659_100061884 3300005366 Bacteria 2958
14 Ga0070659_100502717 3300005366 Unclassified 1033
15 Ga0070709_10081006 3300005434 Bacteria 2118
16 Ga0070709_10404122 3300005434 Bacteria 1020
17 Ga0070713_100000012 3300005436 Bacteria 137708
18 Ga0070713_100592590 3300005436 Bacteria 1052
19 Ga0070711_100011267 3300005439 Bacteria 5545
20 Ga0070708_100344552 3300005445 Bacteria 1404
21 Ga0070663_100240577 3300005455 Bacteria 1428
22 Ga0070681_10000010 3300005458 Bacteria 140126
23 Ga0070681_10873528 3300005458 Unclassified 817
24 Ga0070679_100001260 3300005530 Bacteria 22333
25 Ga0070679_100039633 3300005530 Bacteria 4682
26 Ga0070679_100752906 3300005530 Bacteria 917
27 Ga0070684_100341188 3300005535 Bacteria 1377
28 Ga0068853_100036031 3300005539 Bacteria 4205
29 Ga0068853_100085707 3300005539 Bacteria 2762
30 Ga0070695_100022242 3300005545 Bacteria 3888
31 Ga0070696_100292972 3300005546 Bacteria 1244
32 Ga0070696_100830689 3300005546 Unclassified 762
33 Ga0070665_100230184 3300005548 Bacteria 1853
34 Ga0070665_100368066 3300005548 Bacteria 1444
35 Ga0070665_100509989 3300005548 Bacteria 1214
36 Ga0070665_101249309 3300005548 Bacteria 753
37 Ga0068855_100000034 3300005563 Bacteria 166436
38 Ga0068855_100009112 3300005563 Bacteria 11989
39 Ga0068855_100024065 3300005563 Bacteria 7291
40 Ga0068855_100248025 3300005563 Unclassified 1987
41 Ga0070664_100532955 3300005564 Bacteria 1085
42 Ga0068857_100005177 3300005577 Bacteria 11091
43 Ga0068857_100033310 3300005577 Bacteria 4557
44 Ga0068854_100136796 3300005578 Bacteria 1876
45 Ga0068856_100006353 3300005614 Bacteria 11594
46 Ga0068856_100340867 3300005614 Bacteria 1517
47 Ga0068856_100544998 3300005614 Bacteria 1181
48 Ga0068856_101392936 3300005614 Unclassified 716
49 Ga0068852_100007898 3300005616 Bacteria 7793
50 Ga0068864_100813365 3300005618 Bacteria 919
51 Ga0068863_101338196 3300005841 Unclassified 723
52 Ga0068858_100027112 3300005842 Bacteria 5322
53 Ga0068858_100372920 3300005842 Bacteria 1369
54 Ga0068858_100651186 3300005842 Bacteria 1024
55 Ga0068860_101018558 3300005843 Bacteria 846
56 Ga0068862_100067130 3300005844 Bacteria 3092
57 Ga0081455_10002955 3300005937 Bacteria 19873
58 Ga0081455_10035550 3300005937 Bacteria 4450
59 Ga0081540_1277921 3300005983 Bacteria 578
60 Ga0070717_10265005 3300006028 Bacteria 1521
61 Ga0075365_10237722 3300006038 Bacteria 1279
62 Ga0070716_100393900 3300006173 Bacteria 994
63 Ga0070712_100000455 3300006175 Bacteria 23483
64 Ga0075362_10097576 3300006177 Bacteria 1370
65 Ga0075362_10326921 3300006177 Bacteria 764
66 Ga0075367_10104220 3300006178 Bacteria 1736
67 Ga0075367_10121460 3300006178 Bacteria 1610
68 Ga0097621_100272227 3300006237 Bacteria 1488
69 Ga0097621_101099900 3300006237 Unclassified 746
70 Ga0068871_100151703 3300006358 Bacteria 1976
71 Ga0068871_100164948 3300006358 Bacteria 1896
72 Ga0068871_100177143 3300006358 Bacteria 1831
73 Ga0068871_100319348 3300006358 Bacteria 1367
74 Ga0075434_100137821 3300006871 Bacteria 2460
75 Ga0075434_100168221 3300006871 Bacteria 2212
76 Ga0068865_100072135 3300006881 Bacteria 2452
77 Ga0075436_100000284 3300006914 Bacteria 32139
78 Ga0075435_100048594 3300007076 Bacteria 3409
79 Ga0105240_10000382 3300009093 Bacteria 83108
80 Ga0105240_10002556 3300009093 Bacteria 29183
81 Ga0105240_10016248 3300009093 Bacteria 10087
82 Ga0105240_10028328 3300009093 Bacteria 7318
83 Ga0105240_10386011 3300009093 Bacteria 1580
84 Ga0105240_10597195 3300009093 Archaea 1216
85 Ga0105240_10605425 3300009093 Bacteria 1206
86 Ga0105240_10691324 3300009093 Bacteria 1114
87 Ga0105240_10782728 3300009093 Bacteria 1035
88 Ga0111539_10184963 3300009094 Unclassified 2433
89 Ga0105245_10077567 3300009098 Bacteria 3029
90 Ga0105241_10018259 3300009174 Bacteria 5158
91 Ga0105241_10408241 3300009174 Bacteria 1193
92 Ga0105241_11196782 3300009174 Unclassified 719
93 Ga0105242_10013346 3300009176 Bacteria 6347
94 Ga0105242_10408495 3300009176 Bacteria 1269
95 Ga0105242_11564558 3300009176 Bacteria 692
96 Ga0105248_10000013 3300009177 Bacteria 328864
97 Ga0105248_10122172 3300009177 Bacteria 2937
98 Ga0105248_10125066 3300009177 Bacteria 2901
99 Ga0105248_11528772 3300009177 Bacteria 756
100 Ga0105237_10146366 3300009545 Unclassified 2357
101 Ga0105237_10158346 3300009545 Bacteria 2262
102 Ga0105237_10485016 3300009545 Bacteria 1242
103 Ga0105237_10684796 3300009545 Bacteria 1032
104 Ga0105237_10751801 3300009545 Unclassified 981
105 Ga0105238_10000461 3300009551 Bacteria 42710
106 Ga0105238_10018323 3300009551 Bacteria 7125
107 Ga0105238_10020353 3300009551 Bacteria 6754
108 Ga0105238_10042994 3300009551 Bacteria 4573
109 Ga0105238_10494126 3300009551 Bacteria 1224
110 Ga0105238_10498356 3300009551 Bacteria 1218
111 Ga0105238_11051488 3300009551 Bacteria 836
112 Ga0105239_10003417 3300010375 Bacteria 19473
113 Ga0105239_10043308 3300010375 Bacteria 4933
114 Ga0105239_10113193 3300010375 Bacteria 3009
115 Ga0105239_10120521 3300010375 Bacteria 2913
116 Ga0105239_10494869 3300010375 Bacteria 1390
117 Ga0157373_10004144 3300013100 Bacteria 10932
118 Ga0157370_10000832 3300013104 Bacteria 39082
119 Ga0157370_10049625 3300013104 Bacteria 4016
120 Ga0157370_10105318 3300013104 Bacteria 2640
121 Ga0157369_10054585 3300013105 Bacteria 4315
122 Ga0157369_10175627 3300013105 Bacteria 2255
123 Ga0157369_10428186 3300013105 Bacteria 1372
124 Ga0157374_10712446 3300013296 Bacteria 1017
125 Ga0157378_10100931 3300013297 Bacteria 2635
126 Ga0157378_10138977 3300013297 Bacteria 2254
127 Ga0163162_10377575 3300013306 Bacteria 1551
128 Ga0157372_10204051 3300013307 Bacteria 2290
129 Ga0163163_10173677 3300014325 Bacteria 2201
130 Ga0163163_11230108 3300014325 Unclassified 811
131 Ga0157379_10003686 3300014968 Bacteria 13022
132 Ga0157379_10019142 3300014968 Bacteria 6044
133 Ga0157379_10057664 3300014968 Bacteria 3470
134 Ga0157379_10188779 3300014968 Bacteria 1862
135 Ga0213876_10000965 3300021384 Bacteria 18920
136 Ga0207710_10134108 3300025900 Bacteria 1191
137 Ga0207680_10000732 3300025903 Bacteria 15450
138 Ga0207680_10371873 3300025903 Bacteria 1006
139 Ga0207699_10000104 3300025906 Bacteria 60711
140 Ga0207699_10084720 3300025906 Bacteria 1975
141 Ga0207699_10390317 3300025906 Unclassified 990
142 Ga0207643_10217832 3300025908 Bacteria 1167
143 Ga0207654_10013584 3300025911 Bacteria 4190
144 Ga0207654_10514084 3300025911 Unclassified 847
145 Ga0207707_10000005 3300025912 Bacteria 382024
146 Ga0207707_10311643 3300025912 Unclassified 1360
147 Ga0207695_10000004 3300025913 Bacteria 1288665
148 Ga0207695_10022282 3300025913 Bacteria 7199
149 Ga0207695_10041431 3300025913 Bacteria 4929
150 Ga0207695_10076898 3300025913 Bacteria 3392
151 Ga0207695_10269824 3300025913 Bacteria 1597
152 Ga0207695_10387959 3300025913 Bacteria 1282
153 Ga0207695_10999539 3300025913 Bacteria 716
154 Ga0207671_10021900 3300025914 Bacteria 4842
155 Ga0207671_10026238 3300025914 Bacteria 4368
156 Ga0207671_10604679 3300025914 Bacteria 874
157 Ga0207671_10744018 3300025914 Bacteria 779
158 Ga0207693_10000079 3300025915 Bacteria 86388
159 Ga0207663_10007377 3300025916 Bacteria 5697
160 Ga0207663_10026083 3300025916 Bacteria 3388
161 Ga0207660_10113335 3300025917 Bacteria 2044
162 Ga0207657_10380873 3300025919 Bacteria 1111
163 Ga0207649_10000392 3300025920 Bacteria 32840
164 Ga0207652_10000068 3300025921 Bacteria 110287
165 Ga0207652_10045857 3300025921 Bacteria 3727
166 Ga0207694_10000010 3300025924 Bacteria 439722
167 Ga0207694_10075399 3300025924 Bacteria 2640
168 Ga0207694_10143129 3300025924 Bacteria 1923
169 Ga0207694_10186347 3300025924 Bacteria 1684
170 Ga0207694_10242381 3300025924 Bacteria 1473
171 Ga0207694_10434435 3300025924 Bacteria 1095
172 Ga0207694_10789705 3300025924 Bacteria 802
173 Ga0207650_10085706 3300025925 Bacteria 2397
174 Ga0207659_10137163 3300025926 Bacteria 1895
175 Ga0207687_10101204 3300025927 Bacteria 2121
176 Ga0207700_10000058 3300025928 Bacteria 70410
177 Ga0207700_10379855 3300025928 Bacteria 1235
178 Ga0207690_10269454 3300025932 Bacteria 1322
179 Ga0207690_10994320 3300025932 Unclassified 698
180 Ga0207686_10007280 3300025934 Bacteria 5955
181 Ga0207686_11119446 3300025934 Bacteria 642
182 Ga0207670_10468304 3300025936 Unclassified 1018
183 Ga0207704_10329012 3300025938 Bacteria 1182
184 Ga0207665_10111624 3300025939 Bacteria 1922
185 Ga0207691_11037992 3300025940 Unclassified 683
186 Ga0207711_10000003 3300025941 Bacteria 1042791
187 Ga0207711_10706192 3300025941 Bacteria 940
188 Ga0207711_10791178 3300025941 Bacteria 883
189 Ga0207679_10270713 3300025945 Unclassified 1452
190 Ga0207667_10000065 3300025949 Bacteria 186655
191 Ga0207667_10014734 3300025949 Bacteria 8898
192 Ga0207667_10023209 3300025949 Bacteria 6833
193 Ga0207667_10772225 3300025949 Unclassified 959
194 Ga0207651_10648433 3300025960 Bacteria 927
195 Ga0207703_10951486 3300026035 Bacteria 823
196 Ga0207639_10022690 3300026041 Bacteria 4523
197 Ga0207639_10051996 3300026041 Bacteria 3119
198 Ga0207639_10285552 3300026041 Bacteria 1453
199 Ga0207678_10593482 3300026067 Unclassified 971
200 Ga0207702_10000045 3300026078 Bacteria 144714
201 Ga0207702_10017602 3300026078 Bacteria 5912
202 Ga0207702_10213877 3300026078 Bacteria 1793
203 Ga0207702_10777582 3300026078 Unclassified 946
204 Ga0207641_10155646 3300026088 Bacteria 2073
205 Ga0207676_10760367 3300026095 Bacteria 943
206 Ga0207674_10000026 3300026116 Bacteria 151359
207 Ga0207674_10020199 3300026116 Bacteria 7203
208 Ga0207674_10236846 3300026116 Bacteria 1773
209 Ga0207683_10216977 3300026121 Bacteria 1742
210 Ga0207698_10050895 3300026142 Bacteria 3164
211 Ga0268266_10023999 3300028379 Bacteria 5189
212 Ga0268266_10058059 3300028379 Bacteria 3331
213 Ga0268266_10160360 3300028379 Bacteria 2034
214 Ga0268266_10452741 3300028379 Bacteria 1220
215 Ga0268266_10499711 3300028379 Bacteria 1161
216 Ga0265318_10000071 3300028577 Bacteria 96845
217 Ga0265318_10000512 3300028577 Bacteria 27978
218 Ga0265338_10000017 3300028800 Bacteria 344481
219 Ga0265338_10012652 3300028800 Bacteria 9606
220 Ga0265338_10405476 3300028800 Unclassified 971
221 Ga0265330_10088825 3300031235 Bacteria 1328
222 Ga0265330_10100139 3300031235 Bacteria 1241
223 Ga0265330_10119184 3300031235 Bacteria 1125
224 Ga0265330_10134270 3300031235 Bacteria 1053
225 Ga0265332_10113869 3300031238 Bacteria 1138
226 Ga0265325_10000016 3300031241 Bacteria 130316
227 Ga0265325_10002943 3300031241 Bacteria 11331
228 Ga0265325_10006016 3300031241 Bacteria 7424
229 Ga0265325_10048488 3300031241 Bacteria 2195
230 Ga0265329_10084557 3300031242 Bacteria 1005
231 Ga0265340_10000054 3300031247 Bacteria 53196
232 Ga0265340_10011520 3300031247 Bacteria 4698
233 Ga0265340_10031923 3300031247 Bacteria 2631
234 Ga0265340_10077759 3300031247 Bacteria 1565
235 Ga0265339_10001067 3300031249 Bacteria 20841
236 Ga0265339_10012503 3300031249 Bacteria 5180
237 Ga0265339_10012687 3300031249 Bacteria 5130
238 Ga0265339_10036917 3300031249 Bacteria 2732
239 Ga0265339_10129643 3300031249 Bacteria 1291
240 Ga0265339_10138468 3300031249 Bacteria 1240
241 Ga0265339_10175809 3300031249 Unclassified 1069
242 Ga0265331_10000003 3300031250 Bacteria 499358
243 Ga0265331_10000625 3300031250 Bacteria 30747
244 Ga0265331_10003377 3300031250 Bacteria 10348
245 Ga0265331_10014789 3300031250 Bacteria 4142
246 Ga0265331_10072696 3300031250 Bacteria 1607
247 Ga0265331_10082879 3300031250 Bacteria 1487
248 Ga0265327_10002842 3300031251 Bacteria 17457
249 Ga0265316_10012994 3300031344 Bacteria 7428
250 Ga0265316_10049615 3300031344 Bacteria 3305
251 Ga0265316_10166307 3300031344 Bacteria 1647
252 Ga0265316_10197437 3300031344 Bacteria 1493
253 Ga0265316_10341914 3300031344 Bacteria 1084
254 Ga0265316_10366149 3300031344 Unclassified 1042
255 Ga0265313_10001050 3300031595 Bacteria 26878
256 Ga0265313_10001778 3300031595 Bacteria 19694
257 Ga0265313_10004323 3300031595 Bacteria 10995
258 Ga0265313_10005183 3300031595 Bacteria 9678
259 Ga0265313_10020697 3300031595 Bacteria 3621
260 Ga0265313_10270403 3300031595 Bacteria 689
261 Ga0265314_10005180 3300031711 Bacteria 11839
262 Ga0265314_10009786 3300031711 Bacteria 8051
263 Ga0265314_10018701 3300031711 Bacteria 5393
264 Ga0265314_10030031 3300031711 Bacteria 4028
265 Ga0265314_10050952 3300031711 Bacteria 2886
266 Ga0265314_10074817 3300031711 Bacteria 2255
267 Ga0265314_10116958 3300031711 Bacteria 1685
268 Ga0265314_10225937 3300031711 Bacteria 1089
269 Ga0265342_10005310 3300031712 Bacteria 9872
270 Ga0265342_10032853 3300031712 Bacteria 3197
271 Ga0265342_10055332 3300031712 Bacteria 2355
272 Ga0265342_10268039 3300031712 Bacteria 907
273 Ga0265342_10396908 3300031712 Bacteria 713
274 Ga0307516_10037335 3300031730 Bacteria 4858
275 Ga0373934_0047290 3300035086 Unclassified 1702
276 Ga0373934_0120616 3300035086 Bacteria 1067
277 Ga0373940_0092853 3300035088 Unclassified 906
278 Ga0373949_0120855 3300035090 Unclassified 735
279 Ga0373932_0081700 3300035112 Unclassified 1022
280 Ga0373941_0158554 3300035115 Unclassified 835
281 Ga0373931_0028540 3300035691 Bacteria 2858
282 Ga0373935_0964488 3300035692 Bacteria 633
283 Ga0373927_0339045 3300035695 Unclassified 990
284 Ga0373933_0056125 3300035724 Bacteria 2363
285 Ga0373933_0222212 3300035724 Bacteria 1212
286 Ga0373933_0435998 3300035724 Unclassified 856
287 Ga0373937_0001391 3300036401 Bacteria 20208
288 Ga0373937_0010184 3300036401 Bacteria 8201
289 Ga0373937_0045104 3300036401 Bacteria 4027
290 Ga0373937_0050305 3300036401 Bacteria 3817
291 Ga0373937_0122931 3300036401 Bacteria 2420
292 Ga0373937_0407654 3300036401 Bacteria 1290
293 Ga0373925_0031554 3300037068 Bacteria 3894
294 Ga0373925_0046800 3300037068 Bacteria 3218
295 Ga0395899_0095806 3300037312 Bacteria 2147
296 Ga0395900_0293395 3300037418 Bacteria 1614
297 Ga0395898_0273673 3300037466 Bacteria 1610
298 Ga0395901_0104339 3300038443 Bacteria 2975
299 Ga0436365_0166028 3300039437 Bacteria 30952
300 Ga0436365_0556411 3300039437 Bacteria 9654
301 Ga0436365_0910815 3300039437 Unclassified 630
302 Ga0451795_1251670 3300041456 Bacteria 880
303 Ga0451833_0105370 3300041491 Unclassified 656
304 Ga0451855_1353364 3300041511 Bacteria 573
305 Ga0466963_0145225 3300044694 Bacteria 1645
306 Ga0466964_0158350 3300044706 Bacteria 1056
307 Ga0466957_0014838 3300044842 Bacteria 4542
308 Ga0466967_0000663 3300045976 Bacteria 17352
309 Ga0495651_0159770 3300046462 Bacteria 1616
310 Ga0495580_0129221 3300046472 Bacteria 1753
311 Ga0495582_0089712 3300046473 Unclassified 1713
312 Ga0495664_0015330 3300046477 Bacteria 4356
313 Ga0495664_0091100 3300046477 Bacteria 1833
314 Ga0495628_0152435 3300046516 Bacteria 1760
315 Ga0495630_0462417 3300046517 Unclassified 972
316 Ga0495652_0075934 3300046529 Bacteria 2789
317 Ga0495652_0270056 3300046529 Bacteria 1251
318 Ga0495665_0047034 3300046531 Bacteria 2289
319 Ga0495665_0216078 3300046531 Unclassified 992
320 Ga0495645_0022850 3300046543 Bacteria 4526
321 Ga0495667_0572178 3300046559 Unclassified 705
322 Ga0495599_0453474 3300046678 Bacteria 759
323 Ga0495623_0092509 3300046679 Bacteria 1853
324 Ga0495581_0669332 3300047315 Unclassified 599
325 Ga0495674_0809910 3300047319 Unclassified 728
326 Ga0495675_0103943 3300047444 Bacteria 1776
327 Ga0495602_0327172 3300048088 Bacteria 1113
328 Ga0496102_0392207 3300048905 Bacteria 1306
329 Ga0496107_0187526 3300048910 Bacteria 1536
330 Ga0496111_0037635 3300048914 Bacteria 3463
331 Ga0496113_0857458 3300048916 Unclassified 720
332 Ga0496121_0003678 3300048924 Bacteria 21541
333 Ga0496126_0000525 3300048929 Bacteria 74677
334 Ga0496126_0162463 3300048929 Bacteria 1908
335 Ga0501032_0018138 3300049569 Bacteria 4932
336 Ga0501032_0082860 3300049569 Bacteria 2134
337 Ga0501032_0268070 3300049569 Bacteria 1107
338 Ga0501033_0024383 3300049570 Bacteria 4563
339 Ga0501033_0033563 3300049570 Bacteria 3853
340 Ga0501033_0045665 3300049570 Bacteria 3259
341 Ga0501033_0050804 3300049570 Bacteria 3074
342 Ga0501033_0123143 3300049570 Bacteria 1880
343 Ga0501033_0187503 3300049570 Bacteria 1481
344 Ga0501033_0202256 3300049570 Bacteria 1418
345 Ga0501034_0013490 3300049571 Bacteria 8412
346 Ga0501034_0015639 3300049571 Bacteria 7794
347 Ga0501034_0017909 3300049571 Bacteria 7265
348 Ga0501034_0024218 3300049571 Bacteria 6174
349 Ga0501034_0037552 3300049571 Bacteria 4905
350 Ga0501034_0118600 3300049571 Bacteria 2633
351 Ga0501034_0133745 3300049571 Bacteria 2462
352 Ga0501034_0176793 3300049571 Bacteria 2100
353 Ga0501034_0248692 3300049571 Bacteria 1723
354 Ga0501034_0343663 3300049571 Bacteria 1422
355 Ga0501036_0002560 3300049572 Bacteria 14300
356 Ga0501036_0029099 3300049572 Bacteria 4670
357 Ga0501036_0093538 3300049572 Bacteria 2540
358 Ga0501037_0005156 3300049573 Bacteria 9505
359 Ga0501037_0274499 3300049573 Bacteria 1176
360 Ga0501038_0060032 3300049574 Bacteria 3255
361 Ga0501038_0238952 3300049574 Bacteria 1443
362 Ga0501038_0333458 3300049574 Bacteria 1184
363 Ga0501039_0005610 3300049575 Bacteria 9500
364 Ga0501040_0165595 3300049576 Bacteria 1564
365 Ga0501042_0010926 3300049578 Bacteria 6113
366 Ga0501042_0743667 3300049578 Bacteria 713
367 Ga0501043_0046159 3300049579 Bacteria 3426
368 Ga0501043_0068253 3300049579 Bacteria 2791
369 Ga0501043_0103045 3300049579 Bacteria 2242
370 Ga0501043_0115711 3300049579 Bacteria 2105
371 Ga0501043_0415732 3300049579 Bacteria 1014
372 Ga0501046_0026944 3300049580 Bacteria 4693
373 Ga0501046_0032942 3300049580 Bacteria 4192
374 Ga0501046_0253944 3300049580 Bacteria 1293
375 Ga0501046_0287504 3300049580 Bacteria 1203
376 Ga0501047_0003971 3300049581 Bacteria 13912
377 Ga0501047_0005325 3300049581 Bacteria 12091
378 Ga0501047_0016627 3300049581 Bacteria 7024
379 Ga0501047_0080754 3300049581 Bacteria 3125
380 Ga0501047_0092304 3300049581 Bacteria 2906
381 Ga0501047_0118862 3300049581 Bacteria 2525
382 Ga0501047_0145688 3300049581 Unclassified 2245
383 Ga0501047_0157927 3300049581 Bacteria 2140
384 Ga0501047_0170676 3300049581 Bacteria 2044
385 Ga0501047_0292779 3300049581 Bacteria 1472
386 Ga0501047_0373852 3300049581 Bacteria 1260
387 Ga0501047_0430191 3300049581 Bacteria 1151
388 Ga0501047_0607246 3300049581 Bacteria 915
389 Ga0501048_0016943 3300049582 Bacteria 5370
390 Ga0501048_0572428 3300049582 Bacteria 811
391 Ga0501067_0001639 3300049583 Bacteria 12295
392 Ga0501067_0005297 3300049583 Bacteria 7164
393 Ga0501067_0083012 3300049583 Bacteria 1777
394 Ga0501067_0201304 3300049583 Bacteria 1109
395 Ga0501067_0444928 3300049583 Bacteria 724
396 Ga0501068_0032641 3300049584 Bacteria 3096
397 Ga0501068_0135022 3300049584 Bacteria 1544
398 Ga0501069_0005924 3300049585 Bacteria 6373
399 Ga0501069_0010857 3300049585 Bacteria 4826
400 Ga0501070_0008326 3300049586 Bacteria 8762
401 Ga0501070_0018784 3300049586 Bacteria 5799
402 Ga0501070_0078668 3300049586 Bacteria 2729
403 Ga0501070_0392480 3300049586 Bacteria 1123
404 Ga0501070_0402066 3300049586 Bacteria 1107
405 Ga0501070_0629832 3300049586 Bacteria 853
406 Ga0501072_0014006 3300049588 Bacteria 6146
407 Ga0501072_0222557 3300049588 Bacteria 1504
408 Ga0501073_0002074 3300049589 Bacteria 14995
409 Ga0501073_0005469 3300049589 Bacteria 9517
410 Ga0501073_0049783 3300049589 Bacteria 2937
411 Ga0501073_0054706 3300049589 Bacteria 2794
412 Ga0501073_0093676 3300049589 Bacteria 2087
413 Ga0501073_0110538 3300049589 Bacteria 1906
414 Ga0501073_0600030 3300049589 Unclassified 760
415 Ga0501073_0649627 3300049589 Bacteria 728
416 Ga0501074_0003987 3300049590 Bacteria 10524
417 Ga0501074_0026707 3300049590 Bacteria 4186
418 Ga0501074_0069483 3300049590 Bacteria 2533
419 Ga0501075_0085277 3300049591 Bacteria 2393
420 Ga0501076_0333262 3300049592 Bacteria 1245
421 Ga0501076_0762520 3300049592 Bacteria 798
422 Ga0501079_0025746 3300049741 Bacteria 4512
423 Ga0501079_0098713 3300049741 Bacteria 2263
424 Ga0501079_0285470 3300049741 Bacteria 1290
425 Ga0501080_0059642 3300049742 Bacteria 3550
426 Ga0501080_0075438 3300049742 Bacteria 3136
427 Ga0501080_0087222 3300049742 Bacteria 2899
428 Ga0501080_0247118 3300049742 Bacteria 1627
429 Ga0501080_0404671 3300049742 Unclassified 1227
430 Ga0501080_0662795 3300049742 Bacteria 923
431 Ga0501080_1334707 3300049742 Unclassified 613
432 Ga0501081_0707636 3300049743 Bacteria 756
433 Ga0501083_0015974 3300049744 Bacteria 5257
434 Ga0501083_0055201 3300049744 Bacteria 2664
435 Ga0501083_0071261 3300049744 Unclassified 2311
436 Ga0501083_0291178 3300049744 Unclassified 1062
437 Ga0501083_0406973 3300049744 Bacteria 885
438 Ga0501035_0005562 3300049822 Bacteria 11906
439 Ga0501035_0009642 3300049822 Bacteria 8980
440 Ga0501035_0031124 3300049822 Bacteria 4860
441 Ga0501035_0055413 3300049822 Bacteria 3539
442 Ga0501035_0145687 3300049822 Bacteria 2057
443 Ga0501035_0815809 3300049822 Unclassified 744
444 Ga0501044_0019468 3300049823 Bacteria 7259
445 Ga0501044_0028811 3300049823 Bacteria 5857
446 Ga0501044_0034334 3300049823 Bacteria 5319
447 Ga0501044_0063475 3300049823 Bacteria 3773
448 Ga0501044_0065899 3300049823 Bacteria 3694
449 Ga0501044_0117731 3300049823 Bacteria 2660
450 Ga0501044_0135488 3300049823 Bacteria 2454
451 Ga0501044_0157809 3300049823 Bacteria 2247
452 Ga0501044_0245484 3300049823 Bacteria 1733
453 Ga0501044_0335230 3300049823 Unclassified 1434
454 Ga0501044_0378683 3300049823 Bacteria 1330
455 Ga0501044_0448510 3300049823 Bacteria 1197
456 Ga0501045_0049489 3300049824 Bacteria 3064
457 Ga0501045_0160862 3300049824 Bacteria 1671
458 nmdc:mga03683_337281_c1 3300050489 Bacteria 712
459 nmdc:mga0yw44_24763_c1 3300050492 Bacteria 2797
460 nmdc:mga0yw44_299037_c1 3300050492 Bacteria 1078
461 nmdc:mga06z11_21426_c1 3300050494 Bacteria 3003
462 nmdc:mga06z11_225063_c1 3300050494 Bacteria 1097
463 nmdc:mga07m45_81308_c1 3300050496 Bacteria 1850
464 nmdc:mga06r32_369594_c1 3300050510 Unclassified 1417
465 nmdc:mga0n895_136879_c1 3300050512 Bacteria 2476
466 nmdc:mga0n895_79067_c1 3300050512 Bacteria 3274
467 nmdc:mga0rr50_267870_c1 3300050513 Bacteria 1423
468 nmdc:mga08x19_100_c1 3300050514 Bacteria 76036
469 nmdc:mga0sz30_61643_c1 3300050516 Bacteria 1603
470 nmdc:mga0sz30_6468_c1 3300050516 Bacteria 4348
471 Ga0500643_000021 3300053087 Bacteria 284326
472 Ga0500643_111373 3300053087 Bacteria 739
473 Ga0500641_0176742 3300053096 Unclassified 918
474 Ga0500592_044130 3300053116 Unclassified 722
475 Ga0500594_0125584 3300053118 Unclassified 809
476 Ga0500559_0340893 3300053136 Bacteria 702
477 Ga0500616_0001675 3300053153 Bacteria 20419
478 Ga0500620_269940 3300053155 Unclassified 560
479 Ga0501084_0002480 3300054114 Bacteria 14867
480 Ga0501084_0003016 3300054114 Bacteria 13640
481 Ga0501084_0272859 3300054114 Unclassified 1428
482 Ga0501084_0860947 3300054114 Unclassified 763
483 Ga0501084_0910573 3300054114 Bacteria 740
484 Ga0501082_0018958 3300060353 Bacteria 5928
485 Ga0501082_0064560 3300060353 Bacteria 3153
486 Ga0501082_0613743 3300060353 Bacteria 952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_1353364 Ga0451855_1353364_40_558 161
2 3300053155 Ga0500620_269940 Ga0500620_269940_35_550 161
3 3300028577 Ga0265318_10000512 Ga0265318_100005124 168
4 3300031250 Ga0265331_10014789 Ga0265331_100147892 168
5 3300031595 Ga0265313_10001050 Ga0265313_100010503 168
6 3300031711 Ga0265314_10018701 Ga0265314_100187017 168
7 3300041491 Ga0451833_0105370 Ga0451833_0105370_108_641 168
8 3300009098 Ga0105245_10077567 Ga0105245_100775673 169
9 3300009176 Ga0105242_11564558 Ga0105242_115645581 169
10 3300025927 Ga0207687_10101204 Ga0207687_101012043 169
11 3300025934 Ga0207686_11119446 Ga0207686_111194461 169
12 3300049570 Ga0501033_0033563 Ga0501033_0033563_2364_2897 169
13 3300049574 Ga0501038_0333458 Ga0501038_0333458_44_577 169
14 3300049579 Ga0501043_0415732 Ga0501043_0415732_134_667 169
15 3300049581 Ga0501047_0607246 Ga0501047_0607246_67_600 169
16 3300049583 Ga0501067_0444928 Ga0501067_0444928_41_574 169
17 3300049742 Ga0501080_0662795 Ga0501080_0662795_357_890 169
18 3300049823 Ga0501044_0378683 Ga0501044_0378683_694_1227 169
19 3300053136 Ga0500559_0340893 Ga0500559_0340893_179_688 169
20 3300031235 Ga0265330_10119184 Ga0265330_101191841 174
21 3300031241 Ga0265325_10002943 Ga0265325_100029439 174
22 3300031249 Ga0265339_10036917 Ga0265339_100369172 174
23 3300031344 Ga0265316_10341914 Ga0265316_103419142 174
24 3300031595 Ga0265313_10005183 Ga0265313_1000518310 174
25 3300039437 Ga0436365_0910815 Ga0436365_0910815_34_558 174
26 3300005842 Ga0068858_100372920 Ga0068858_1003729202 175
27 3300025912 Ga0207707_10311643 Ga0207707_103116431 175
28 3300025924 Ga0207694_10186347 Ga0207694_101863471 175
29 3300025949 Ga0207667_10772225 Ga0207667_107722252 175
30 3300028800 Ga0265338_10405476 Ga0265338_104054762 175
31 3300031241 Ga0265325_10048488 Ga0265325_100484883 175
32 3300031247 Ga0265340_10011520 Ga0265340_100115203 175
33 3300031249 Ga0265339_10138468 Ga0265339_101384682 175
34 3300031249 Ga0265339_10175809 Ga0265339_101758092 175
35 3300031250 Ga0265331_10082879 Ga0265331_100828792 175
36 3300031344 Ga0265316_10049615 Ga0265316_100496152 175
37 3300031344 Ga0265316_10366149 Ga0265316_103661491 175
38 3300031595 Ga0265313_10001778 Ga0265313_100017784 175
39 3300031595 Ga0265313_10020697 Ga0265313_100206972 175
40 3300031711 Ga0265314_10074817 Ga0265314_100748172 175
41 3300031712 Ga0265342_10055332 Ga0265342_100553322 175
42 3300049570 Ga0501033_0123143 Ga0501033_0123143_217_744 175
43 3300049581 Ga0501047_0092304 Ga0501047_0092304_1232_1759 175
44 3300049822 Ga0501035_0145687 Ga0501035_0145687_432_959 175
45 3300049823 Ga0501044_0335230 Ga0501044_0335230_300_845 175
46 3300005338 Ga0068868_101003356 Ga0068868_1010033562 176
47 3300005341 Ga0070691_10000635 Ga0070691_1000063513 176
48 3300005344 Ga0070661_100004939 Ga0070661_10000493910 176
49 3300005434 Ga0070709_10081006 Ga0070709_100810062 176
50 3300005434 Ga0070709_10404122 Ga0070709_104041221 176
51 3300005436 Ga0070713_100000012 Ga0070713_10000001220 176
52 3300005436 Ga0070713_100592590 Ga0070713_1005925901 176
53 3300005439 Ga0070711_100011267 Ga0070711_1000112675 176
54 3300005445 Ga0070708_100344552 Ga0070708_1003445522 176
55 3300005458 Ga0070681_10000010 Ga0070681_1000001030 176
56 3300005530 Ga0070679_100001260 Ga0070679_1000012609 176
57 3300005535 Ga0070684_100341188 Ga0070684_1003411882 176
58 3300005539 Ga0068853_100036031 Ga0068853_1000360315 176
59 3300005539 Ga0068853_100085707 Ga0068853_1000857072 176
60 3300005545 Ga0070695_100022242 Ga0070695_1000222424 176
61 3300005546 Ga0070696_100292972 Ga0070696_1002929722 176
62 3300005546 Ga0070696_100830689 Ga0070696_1008306891 176
63 3300005548 Ga0070665_100368066 Ga0070665_1003680662 176
64 3300005563 Ga0068855_100024065 Ga0068855_1000240658 176
65 3300005564 Ga0070664_100532955 Ga0070664_1005329551 176
66 3300005577 Ga0068857_100005177 Ga0068857_10000517713 176
67 3300005578 Ga0068854_100136796 Ga0068854_1001367963 176
68 3300005614 Ga0068856_100006353 Ga0068856_1000063534 176
69 3300005614 Ga0068856_100340867 Ga0068856_1003408672 176
70 3300005614 Ga0068856_100544998 Ga0068856_1005449982 176
71 3300005616 Ga0068852_100007898 Ga0068852_1000078986 176
72 3300005841 Ga0068863_101338196 Ga0068863_1013381961 176
73 3300005842 Ga0068858_100651186 Ga0068858_1006511862 176
74 3300005843 Ga0068860_101018558 Ga0068860_1010185582 176
75 3300005937 Ga0081455_10002955 Ga0081455_1000295517 176
76 3300005937 Ga0081455_10035550 Ga0081455_100355505 176
77 3300006038 Ga0075365_10237722 Ga0075365_102377222 176
78 3300006173 Ga0070716_100393900 Ga0070716_1003939002 176
79 3300006175 Ga0070712_100000455 Ga0070712_10000045522 176
80 3300006177 Ga0075362_10097576 Ga0075362_100975762 176
81 3300006177 Ga0075362_10326921 Ga0075362_103269211 176
82 3300006178 Ga0075367_10104220 Ga0075367_101042202 176
83 3300006178 Ga0075367_10121460 Ga0075367_101214602 176
84 3300006358 Ga0068871_100164948 Ga0068871_1001649483 176
85 3300006358 Ga0068871_100319348 Ga0068871_1003193482 176
86 3300006871 Ga0075434_100137821 Ga0075434_1001378212 176
87 3300006871 Ga0075434_100168221 Ga0075434_1001682213 176
88 3300006914 Ga0075436_100000284 Ga0075436_10000028421 176
89 3300007076 Ga0075435_100048594 Ga0075435_1000485943 176
90 3300009093 Ga0105240_10002556 Ga0105240_1000255624 176
91 3300009093 Ga0105240_10597195 Ga0105240_105971952 176
92 3300009093 Ga0105240_10605425 Ga0105240_106054253 176
93 3300009174 Ga0105241_10018259 Ga0105241_100182592 176
94 3300009174 Ga0105241_11196782 Ga0105241_111967821 176
95 3300009176 Ga0105242_10013346 Ga0105242_100133463 176
96 3300009177 Ga0105248_10000013 Ga0105248_10000013109 176
97 3300009177 Ga0105248_10122172 Ga0105248_101221722 176
98 3300009545 Ga0105237_10158346 Ga0105237_101583463 176
99 3300009545 Ga0105237_10751801 Ga0105237_107518012 176
100 3300009551 Ga0105238_10000461 Ga0105238_1000046144 176
101 3300010375 Ga0105239_10043308 Ga0105239_100433086 176
102 3300013100 Ga0157373_10004144 Ga0157373_1000414410 176
103 3300013104 Ga0157370_10000832 Ga0157370_1000083237 176
104 3300013104 Ga0157370_10105318 Ga0157370_101053182 176
105 3300013105 Ga0157369_10054585 Ga0157369_100545852 176
106 3300013105 Ga0157369_10428186 Ga0157369_104281862 176
107 3300013297 Ga0157378_10138977 Ga0157378_101389773 176
108 3300013307 Ga0157372_10204051 Ga0157372_102040512 176
109 3300014325 Ga0163163_10173677 Ga0163163_101736772 176
110 3300014968 Ga0157379_10003686 Ga0157379_1000368612 176
111 3300014968 Ga0157379_10019142 Ga0157379_100191425 176
112 3300014968 Ga0157379_10057664 Ga0157379_100576642 176
113 3300014968 Ga0157379_10188779 Ga0157379_101887792 176
114 3300021384 Ga0213876_10000965 Ga0213876_1000096521 176
115 3300025903 Ga0207680_10000732 Ga0207680_1000073218 176
116 3300025906 Ga0207699_10000104 Ga0207699_1000010458 176
117 3300025906 Ga0207699_10084720 Ga0207699_100847202 176
118 3300025911 Ga0207654_10013584 Ga0207654_100135842 176
119 3300025912 Ga0207707_10000005 Ga0207707_1000000530 176
120 3300025913 Ga0207695_10076898 Ga0207695_100768985 176
121 3300025914 Ga0207671_10021900 Ga0207671_100219002 176
122 3300025915 Ga0207693_10000079 Ga0207693_1000007953 176
123 3300025916 Ga0207663_10007377 Ga0207663_100073773 176
124 3300025916 Ga0207663_10026083 Ga0207663_100260832 176
125 3300025920 Ga0207649_10000392 Ga0207649_1000039215 176
126 3300025921 Ga0207652_10000068 Ga0207652_100000689 176
127 3300025924 Ga0207694_10242381 Ga0207694_102423812 176
128 3300025928 Ga0207700_10000058 Ga0207700_1000005867 176
129 3300025928 Ga0207700_10379855 Ga0207700_103798552 176
130 3300025934 Ga0207686_10007280 Ga0207686_100072808 176
131 3300025939 Ga0207665_10111624 Ga0207665_101116242 176
132 3300025941 Ga0207711_10000003 Ga0207711_10000003109 176
133 3300025941 Ga0207711_10791178 Ga0207711_107911782 176
134 3300025945 Ga0207679_10270713 Ga0207679_102707132 176
135 3300025949 Ga0207667_10023209 Ga0207667_100232092 176
136 3300025960 Ga0207651_10648433 Ga0207651_106484331 176
137 3300026041 Ga0207639_10022690 Ga0207639_100226903 176
138 3300026041 Ga0207639_10051996 Ga0207639_100519962 176
139 3300026078 Ga0207702_10000045 Ga0207702_1000004562 176
140 3300026078 Ga0207702_10017602 Ga0207702_100176024 176
141 3300026078 Ga0207702_10213877 Ga0207702_102138773 176
142 3300026116 Ga0207674_10000026 Ga0207674_10000026148 176
143 3300026142 Ga0207698_10050895 Ga0207698_100508952 176
144 3300028577 Ga0265318_10000071 Ga0265318_100000716 176
145 3300028800 Ga0265338_10000017 Ga0265338_10000017137 176
146 3300028800 Ga0265338_10012652 Ga0265338_100126529 176
147 3300031235 Ga0265330_10100139 Ga0265330_101001391 176
148 3300031238 Ga0265332_10113869 Ga0265332_101138691 176
149 3300031241 Ga0265325_10000016 Ga0265325_10000016115 176
150 3300031241 Ga0265325_10006016 Ga0265325_100060164 176
151 3300031242 Ga0265329_10084557 Ga0265329_100845572 176
152 3300031247 Ga0265340_10000054 Ga0265340_1000005443 176
153 3300031247 Ga0265340_10077759 Ga0265340_100777591 176
154 3300031249 Ga0265339_10001067 Ga0265339_100010676 176
155 3300031249 Ga0265339_10012503 Ga0265339_100125033 176
156 3300031249 Ga0265339_10012687 Ga0265339_100126872 176
157 3300031250 Ga0265331_10000003 Ga0265331_10000003284 176
158 3300031250 Ga0265331_10003377 Ga0265331_100033779 176
159 3300031344 Ga0265316_10012994 Ga0265316_100129949 176
160 3300031344 Ga0265316_10166307 Ga0265316_101663071 176
161 3300031595 Ga0265313_10004323 Ga0265313_1000432311 176
162 3300031595 Ga0265313_10270403 Ga0265313_102704031 176
163 3300031711 Ga0265314_10005180 Ga0265314_1000518013 176
164 3300031711 Ga0265314_10009786 Ga0265314_100097863 176
165 3300031711 Ga0265314_10030031 Ga0265314_100300311 176
166 3300031711 Ga0265314_10225937 Ga0265314_102259371 176
167 3300031712 Ga0265342_10005310 Ga0265342_100053102 176
168 3300031712 Ga0265342_10032853 Ga0265342_100328534 176
169 3300031712 Ga0265342_10268039 Ga0265342_102680392 176
170 3300031712 Ga0265342_10396908 Ga0265342_103969081 176
171 3300035086 Ga0373934_0120616 Ga0373934_0120616_45_575 176
172 3300035088 Ga0373940_0092853 Ga0373940_0092853_296_826 176
173 3300035692 Ga0373935_0964488 Ga0373935_0964488_74_604 176
174 3300035695 Ga0373927_0339045 Ga0373927_0339045_156_686 176
175 3300035724 Ga0373933_0056125 Ga0373933_0056125_668_1198 176
176 3300036401 Ga0373937_0001391 Ga0373937_0001391_16928_17458 176
177 3300036401 Ga0373937_0045104 Ga0373937_0045104_1339_1869 176
178 3300037068 Ga0373925_0031554 Ga0373925_0031554_2324_2854 176
179 3300039437 Ga0436365_0166028 Ga0436365_0166028_26950_27480 176
180 3300041456 Ga0451795_1251670 Ga0451795_1251670_301_861 176
181 3300044694 Ga0466963_0145225 Ga0466963_0145225_746_1321 176
182 3300044706 Ga0466964_0158350 Ga0466964_0158350_72_647 176
183 3300044842 Ga0466957_0014838 Ga0466957_0014838_2240_2815 176
184 3300045976 Ga0466967_0000663 Ga0466967_0000663_11515_12090 176
185 3300046462 Ga0495651_0159770 Ga0495651_0159770_959_1489 176
186 3300046472 Ga0495580_0129221 Ga0495580_0129221_478_1056 176
187 3300046477 Ga0495664_0015330 Ga0495664_0015330_2205_2735 176
188 3300046516 Ga0495628_0152435 Ga0495628_0152435_1126_1656 176
189 3300046529 Ga0495652_0270056 Ga0495652_0270056_602_1135 176
190 3300046543 Ga0495645_0022850 Ga0495645_0022850_1893_2423 176
191 3300046559 Ga0495667_0572178 Ga0495667_0572178_120_650 176
192 3300046679 Ga0495623_0092509 Ga0495623_0092509_907_1437 176
193 3300048905 Ga0496102_0392207 Ga0496102_0392207_166_696 176
194 3300048910 Ga0496107_0187526 Ga0496107_0187526_183_713 176
195 3300048914 Ga0496111_0037635 Ga0496111_0037635_2514_3044 176
196 3300048916 Ga0496113_0857458 Ga0496113_0857458_135_665 176
197 3300048929 Ga0496126_0000525 Ga0496126_0000525_66715_67245 176
198 3300049569 Ga0501032_0082860 Ga0501032_0082860_740_1270 176
199 3300049571 Ga0501034_0013490 Ga0501034_0013490_4468_4998 176
200 3300049571 Ga0501034_0015639 Ga0501034_0015639_4021_4584 176
201 3300049571 Ga0501034_0037552 Ga0501034_0037552_1197_1727 176
202 3300049571 Ga0501034_0118600 Ga0501034_0118600_1831_2361 176
203 3300049571 Ga0501034_0133745 Ga0501034_0133745_1895_2425 176
204 3300049571 Ga0501034_0176793 Ga0501034_0176793_1012_1596 176
205 3300049573 Ga0501037_0274499 Ga0501037_0274499_635_1165 176
206 3300049578 Ga0501042_0743667 Ga0501042_0743667_77_607 176
207 3300049579 Ga0501043_0068253 Ga0501043_0068253_43_573 176
208 3300049580 Ga0501046_0032942 Ga0501046_0032942_3274_3804 176
209 3300049580 Ga0501046_0253944 Ga0501046_0253944_687_1223 176
210 3300049581 Ga0501047_0005325 Ga0501047_0005325_3384_3914 176
211 3300049581 Ga0501047_0016627 Ga0501047_0016627_4562_5092 176
212 3300049581 Ga0501047_0118862 Ga0501047_0118862_723_1253 176
213 3300049581 Ga0501047_0292779 Ga0501047_0292779_39_569 176
214 3300049583 Ga0501067_0005297 Ga0501067_0005297_4562_5092 176
215 3300049583 Ga0501067_0201304 Ga0501067_0201304_211_741 176
216 3300049584 Ga0501068_0135022 Ga0501068_0135022_41_604 176
217 3300049586 Ga0501070_0402066 Ga0501070_0402066_52_582 176
218 3300049586 Ga0501070_0629832 Ga0501070_0629832_135_698 176
219 3300049588 Ga0501072_0014006 Ga0501072_0014006_5506_6036 176
220 3300049589 Ga0501073_0002074 Ga0501073_0002074_9058_9588 176
221 3300049589 Ga0501073_0049783 Ga0501073_0049783_761_1321 176
222 3300049589 Ga0501073_0054706 Ga0501073_0054706_1378_1908 176
223 3300049589 Ga0501073_0093676 Ga0501073_0093676_1347_1910 176
224 3300049589 Ga0501073_0649627 Ga0501073_0649627_21_551 176
225 3300049590 Ga0501074_0069483 Ga0501074_0069483_762_1292 176
226 3300049742 Ga0501080_0059642 Ga0501080_0059642_2073_2603 176
227 3300049742 Ga0501080_0087222 Ga0501080_0087222_1265_1795 176
228 3300049742 Ga0501080_1334707 Ga0501080_1334707_19_552 176
229 3300049744 Ga0501083_0291178 Ga0501083_0291178_422_952 176
230 3300049744 Ga0501083_0406973 Ga0501083_0406973_192_722 176
231 3300049822 Ga0501035_0009642 Ga0501035_0009642_1181_1711 176
232 3300049822 Ga0501035_0815809 Ga0501035_0815809_160_690 176
233 3300049823 Ga0501044_0019468 Ga0501044_0019468_1426_1956 176
234 3300049823 Ga0501044_0063475 Ga0501044_0063475_1137_1667 176
235 3300049823 Ga0501044_0135488 Ga0501044_0135488_1154_1684 176
236 3300049823 Ga0501044_0157809 Ga0501044_0157809_1177_1740 176
237 3300050489 nmdc:mga03683_337281_c1 nmdc:mga03683_337281_c1_43_603 176
238 3300050492 nmdc:mga0yw44_24763_c1 nmdc:mga0yw44_24763_c1_1937_2497 176
239 3300050492 nmdc:mga0yw44_299037_c1 nmdc:mga0yw44_299037_c1_111_671 176
240 3300050494 nmdc:mga06z11_21426_c1 nmdc:mga06z11_21426_c1_2024_2584 176
241 3300050494 nmdc:mga06z11_225063_c1 nmdc:mga06z11_225063_c1_80_640 176
242 3300050496 nmdc:mga07m45_81308_c1 nmdc:mga07m45_81308_c1_946_1506 176
243 3300050512 nmdc:mga0n895_136879_c1 nmdc:mga0n895_136879_c1_687_1217 176
244 3300050512 nmdc:mga0n895_79067_c1 nmdc:mga0n895_79067_c1_1473_2003 176
245 3300050513 nmdc:mga0rr50_267870_c1 nmdc:mga0rr50_267870_c1_586_1116 176
246 3300050514 nmdc:mga08x19_100_c1 nmdc:mga08x19_100_c1_15116_15646 176
247 3300050516 nmdc:mga0sz30_61643_c1 nmdc:mga0sz30_61643_c1_272_832 176
248 3300050516 nmdc:mga0sz30_6468_c1 nmdc:mga0sz30_6468_c1_1906_2466 176
249 3300053153 Ga0500616_0001675 Ga0500616_0001675_2940_3500 176
250 3300054114 Ga0501084_0910573 Ga0501084_0910573_63_593 176
251 3300060353 Ga0501082_0613743 Ga0501082_0613743_101_631 176
252 3300003320 rootH2_10237805 rootH2_102378052 177
253 3300005327 Ga0070658_10065347 Ga0070658_100653474 177
254 3300005327 Ga0070658_10372169 Ga0070658_103721692 177
255 3300005327 Ga0070658_11009203 Ga0070658_110092031 177
256 3300005336 Ga0070680_100025011 Ga0070680_1000250113 177
257 3300005340 Ga0070689_100497489 Ga0070689_1004974892 177
258 3300005341 Ga0070691_10169579 Ga0070691_101695792 177
259 3300005356 Ga0070674_100503502 Ga0070674_1005035022 177
260 3300005356 Ga0070674_100608463 Ga0070674_1006084631 177
261 3300005366 Ga0070659_100061884 Ga0070659_1000618842 177
262 3300005366 Ga0070659_100502717 Ga0070659_1005027172 177
263 3300005455 Ga0070663_100240577 Ga0070663_1002405772 177
264 3300005458 Ga0070681_10873528 Ga0070681_108735282 177
265 3300005530 Ga0070679_100039633 Ga0070679_1000396334 177
266 3300005530 Ga0070679_100752906 Ga0070679_1007529061 177
267 3300005548 Ga0070665_100230184 Ga0070665_1002301842 177
268 3300005548 Ga0070665_100509989 Ga0070665_1005099891 177
269 3300005548 Ga0070665_101249309 Ga0070665_1012493091 177
270 3300005563 Ga0068855_100000034 Ga0068855_100000034174 177
271 3300005563 Ga0068855_100009112 Ga0068855_10000911210 177
272 3300005563 Ga0068855_100248025 Ga0068855_1002480251 177
273 3300005577 Ga0068857_100033310 Ga0068857_1000333104 177
274 3300005614 Ga0068856_101392936 Ga0068856_1013929361 177
275 3300005618 Ga0068864_100813365 Ga0068864_1008133652 177
276 3300005842 Ga0068858_100027112 Ga0068858_1000271125 177
277 3300005844 Ga0068862_100067130 Ga0068862_1000671305 177
278 3300005983 Ga0081540_1277921 Ga0081540_12779211 177
279 3300006028 Ga0070717_10265005 Ga0070717_102650052 177
280 3300006237 Ga0097621_100272227 Ga0097621_1002722272 177
281 3300006237 Ga0097621_101099900 Ga0097621_1010999002 177
282 3300006358 Ga0068871_100151703 Ga0068871_1001517033 177
283 3300006358 Ga0068871_100177143 Ga0068871_1001771432 177
284 3300006881 Ga0068865_100072135 Ga0068865_1000721352 177
285 3300009093 Ga0105240_10000382 Ga0105240_1000038253 177
286 3300009093 Ga0105240_10016248 Ga0105240_100162487 177
287 3300009093 Ga0105240_10028328 Ga0105240_100283288 177
288 3300009093 Ga0105240_10386011 Ga0105240_103860112 177
289 3300009093 Ga0105240_10691324 Ga0105240_106913241 177
290 3300009093 Ga0105240_10782728 Ga0105240_107827282 177
291 3300009094 Ga0111539_10184963 Ga0111539_101849632 177
292 3300009174 Ga0105241_10408241 Ga0105241_104082412 177
293 3300009176 Ga0105242_10408495 Ga0105242_104084952 177
294 3300009177 Ga0105248_10125066 Ga0105248_101250663 177
295 3300009177 Ga0105248_11528772 Ga0105248_115287722 177
296 3300009545 Ga0105237_10146366 Ga0105237_101463663 177
297 3300009545 Ga0105237_10485016 Ga0105237_104850161 177
298 3300009545 Ga0105237_10684796 Ga0105237_106847962 177
299 3300009551 Ga0105238_10018323 Ga0105238_100183237 177
300 3300009551 Ga0105238_10020353 Ga0105238_100203533 177
301 3300009551 Ga0105238_10042994 Ga0105238_100429946 177
302 3300009551 Ga0105238_10494126 Ga0105238_104941262 177
303 3300009551 Ga0105238_10498356 Ga0105238_104983562 177
304 3300009551 Ga0105238_11051488 Ga0105238_110514882 177
305 3300010375 Ga0105239_10003417 Ga0105239_100034179 177
306 3300010375 Ga0105239_10113193 Ga0105239_101131932 177
307 3300010375 Ga0105239_10120521 Ga0105239_101205213 177
308 3300010375 Ga0105239_10494869 Ga0105239_104948692 177
309 3300013104 Ga0157370_10049625 Ga0157370_100496253 177
310 3300013105 Ga0157369_10175627 Ga0157369_101756273 177
311 3300013296 Ga0157374_10712446 Ga0157374_107124462 177
312 3300013297 Ga0157378_10100931 Ga0157378_101009313 177
313 3300013306 Ga0163162_10377575 Ga0163162_103775752 177
314 3300014325 Ga0163163_11230108 Ga0163163_112301082 177
315 3300025900 Ga0207710_10134108 Ga0207710_101341082 177
316 3300025903 Ga0207680_10371873 Ga0207680_103718731 177
317 3300025906 Ga0207699_10390317 Ga0207699_103903171 177
318 3300025908 Ga0207643_10217832 Ga0207643_102178322 177
319 3300025911 Ga0207654_10514084 Ga0207654_105140841 177
320 3300025913 Ga0207695_10000004 Ga0207695_100000041151 177
321 3300025913 Ga0207695_10022282 Ga0207695_100222823 177
322 3300025913 Ga0207695_10041431 Ga0207695_100414312 177
323 3300025913 Ga0207695_10269824 Ga0207695_102698242 177
324 3300025913 Ga0207695_10387959 Ga0207695_103879592 177
325 3300025913 Ga0207695_10999539 Ga0207695_109995392 177
326 3300025914 Ga0207671_10026238 Ga0207671_100262385 177
327 3300025914 Ga0207671_10604679 Ga0207671_106046791 177
328 3300025914 Ga0207671_10744018 Ga0207671_107440181 177
329 3300025917 Ga0207660_10113335 Ga0207660_101133351 177
330 3300025919 Ga0207657_10380873 Ga0207657_103808732 177
331 3300025921 Ga0207652_10045857 Ga0207652_100458572 177
332 3300025924 Ga0207694_10000010 Ga0207694_10000010191 177
333 3300025924 Ga0207694_10075399 Ga0207694_100753994 177
334 3300025924 Ga0207694_10143129 Ga0207694_101431291 177
335 3300025924 Ga0207694_10434435 Ga0207694_104344352 177
336 3300025924 Ga0207694_10789705 Ga0207694_107897051 177
337 3300025925 Ga0207650_10085706 Ga0207650_100857063 177
338 3300025926 Ga0207659_10137163 Ga0207659_101371633 177
339 3300025932 Ga0207690_10269454 Ga0207690_102694541 177
340 3300025932 Ga0207690_10994320 Ga0207690_109943201 177
341 3300025936 Ga0207670_10468304 Ga0207670_104683041 177
342 3300025938 Ga0207704_10329012 Ga0207704_103290122 177
343 3300025940 Ga0207691_11037992 Ga0207691_110379921 177
344 3300025941 Ga0207711_10706192 Ga0207711_107061922 177
345 3300025949 Ga0207667_10000065 Ga0207667_1000006536 177
346 3300025949 Ga0207667_10014734 Ga0207667_100147343 177
347 3300026035 Ga0207703_10951486 Ga0207703_109514862 177
348 3300026041 Ga0207639_10285552 Ga0207639_102855521 177
349 3300026067 Ga0207678_10593482 Ga0207678_105934822 177
350 3300026078 Ga0207702_10777582 Ga0207702_107775822 177
351 3300026088 Ga0207641_10155646 Ga0207641_101556462 177
352 3300026095 Ga0207676_10760367 Ga0207676_107603672 177
353 3300026116 Ga0207674_10020199 Ga0207674_100201994 177
354 3300026116 Ga0207674_10236846 Ga0207674_102368462 177
355 3300026121 Ga0207683_10216977 Ga0207683_102169773 177
356 3300028379 Ga0268266_10023999 Ga0268266_100239995 177
357 3300028379 Ga0268266_10058059 Ga0268266_100580593 177
358 3300028379 Ga0268266_10160360 Ga0268266_101603602 177
359 3300028379 Ga0268266_10452741 Ga0268266_104527411 177
360 3300028379 Ga0268266_10499711 Ga0268266_104997112 177
361 3300031235 Ga0265330_10088825 Ga0265330_100888252 177
362 3300031235 Ga0265330_10134270 Ga0265330_101342702 177
363 3300031247 Ga0265340_10031923 Ga0265340_100319232 177
364 3300031249 Ga0265339_10129643 Ga0265339_101296431 177
365 3300031250 Ga0265331_10000625 Ga0265331_100006259 177
366 3300031250 Ga0265331_10072696 Ga0265331_100726964 177
367 3300031251 Ga0265327_10002842 Ga0265327_100028428 177
368 3300031344 Ga0265316_10197437 Ga0265316_101974374 177
369 3300031711 Ga0265314_10050952 Ga0265314_100509524 177
370 3300031711 Ga0265314_10116958 Ga0265314_101169582 177
371 3300031730 Ga0307516_10037335 Ga0307516_100373355 177
372 3300035086 Ga0373934_0047290 Ga0373934_0047290_688_1245 177
373 3300035090 Ga0373949_0120855 Ga0373949_0120855_76_621 177
374 3300035112 Ga0373932_0081700 Ga0373932_0081700_84_629 177
375 3300035115 Ga0373941_0158554 Ga0373941_0158554_106_651 177
376 3300035691 Ga0373931_0028540 Ga0373931_0028540_736_1281 177
377 3300035724 Ga0373933_0222212 Ga0373933_0222212_53_610 177
378 3300035724 Ga0373933_0435998 Ga0373933_0435998_37_594 177
379 3300036401 Ga0373937_0010184 Ga0373937_0010184_73_630 177
380 3300036401 Ga0373937_0050305 Ga0373937_0050305_692_1249 177
381 3300036401 Ga0373937_0122931 Ga0373937_0122931_332_889 177
382 3300036401 Ga0373937_0407654 Ga0373937_0407654_155_688 177
383 3300037068 Ga0373925_0046800 Ga0373925_0046800_880_1425 177
384 3300037312 Ga0395899_0095806 Ga0395899_0095806_1009_1542 177
385 3300037418 Ga0395900_0293395 Ga0395900_0293395_203_748 177
386 3300037466 Ga0395898_0273673 Ga0395898_0273673_854_1399 177
387 3300038443 Ga0395901_0104339 Ga0395901_0104339_2199_2732 177
388 3300039437 Ga0436365_0556411 Ga0436365_0556411_6823_7401 177
389 3300046473 Ga0495582_0089712 Ga0495582_0089712_397_942 177
390 3300046477 Ga0495664_0091100 Ga0495664_0091100_428_964 177
391 3300046517 Ga0495630_0462417 Ga0495630_0462417_316_861 177
392 3300046529 Ga0495652_0075934 Ga0495652_0075934_1377_1913 177
393 3300046531 Ga0495665_0047034 Ga0495665_0047034_1628_2173 177
394 3300046531 Ga0495665_0216078 Ga0495665_0216078_368_910 177
395 3300046678 Ga0495599_0453474 Ga0495599_0453474_180_716 177
396 3300047315 Ga0495581_0669332 Ga0495581_0669332_16_561 177
397 3300047319 Ga0495674_0809910 Ga0495674_0809910_160_705 177
398 3300047444 Ga0495675_0103943 Ga0495675_0103943_1015_1572 177
399 3300048088 Ga0495602_0327172 Ga0495602_0327172_485_1018 177
400 3300048924 Ga0496121_0003678 Ga0496121_0003678_3241_3774 177
401 3300048929 Ga0496126_0162463 Ga0496126_0162463_1232_1765 177
402 3300049569 Ga0501032_0018138 Ga0501032_0018138_3288_3821 177
403 3300049569 Ga0501032_0268070 Ga0501032_0268070_507_1040 177
404 3300049570 Ga0501033_0024383 Ga0501033_0024383_3325_3861 177
405 3300049570 Ga0501033_0045665 Ga0501033_0045665_1059_1592 177
406 3300049570 Ga0501033_0050804 Ga0501033_0050804_794_1327 177
407 3300049570 Ga0501033_0187503 Ga0501033_0187503_165_698 177
408 3300049570 Ga0501033_0202256 Ga0501033_0202256_643_1176 177
409 3300049571 Ga0501034_0017909 Ga0501034_0017909_6364_6903 177
410 3300049571 Ga0501034_0024218 Ga0501034_0024218_2754_3287 177
411 3300049571 Ga0501034_0248692 Ga0501034_0248692_778_1311 177
412 3300049571 Ga0501034_0343663 Ga0501034_0343663_188_721 177
413 3300049572 Ga0501036_0002560 Ga0501036_0002560_11893_12426 177
414 3300049572 Ga0501036_0029099 Ga0501036_0029099_471_1010 177
415 3300049572 Ga0501036_0093538 Ga0501036_0093538_1317_1853 177
416 3300049573 Ga0501037_0005156 Ga0501037_0005156_7225_7758 177
417 3300049574 Ga0501038_0060032 Ga0501038_0060032_111_644 177
418 3300049574 Ga0501038_0238952 Ga0501038_0238952_688_1224 177
419 3300049575 Ga0501039_0005610 Ga0501039_0005610_6287_6820 177
420 3300049576 Ga0501040_0165595 Ga0501040_0165595_585_1118 177
421 3300049578 Ga0501042_0010926 Ga0501042_0010926_2986_3519 177
422 3300049579 Ga0501043_0046159 Ga0501043_0046159_133_672 177
423 3300049579 Ga0501043_0103045 Ga0501043_0103045_794_1327 177
424 3300049579 Ga0501043_0115711 Ga0501043_0115711_644_1180 177
425 3300049580 Ga0501046_0026944 Ga0501046_0026944_3433_3966 177
426 3300049580 Ga0501046_0287504 Ga0501046_0287504_211_753 177
427 3300049581 Ga0501047_0003971 Ga0501047_0003971_7406_7939 177
428 3300049581 Ga0501047_0080754 Ga0501047_0080754_1748_2281 177
429 3300049581 Ga0501047_0145688 Ga0501047_0145688_378_917 177
430 3300049581 Ga0501047_0157927 Ga0501047_0157927_498_1034 177
431 3300049581 Ga0501047_0170676 Ga0501047_0170676_929_1462 177
432 3300049581 Ga0501047_0373852 Ga0501047_0373852_683_1216 177
433 3300049581 Ga0501047_0430191 Ga0501047_0430191_57_593 177
434 3300049582 Ga0501048_0016943 Ga0501048_0016943_3222_3755 177
435 3300049582 Ga0501048_0572428 Ga0501048_0572428_54_587 177
436 3300049583 Ga0501067_0001639 Ga0501067_0001639_11201_11734 177
437 3300049583 Ga0501067_0083012 Ga0501067_0083012_847_1386 177
438 3300049584 Ga0501068_0032641 Ga0501068_0032641_473_1006 177
439 3300049585 Ga0501069_0005924 Ga0501069_0005924_992_1531 177
440 3300049585 Ga0501069_0010857 Ga0501069_0010857_1150_1683 177
441 3300049586 Ga0501070_0008326 Ga0501070_0008326_4958_5491 177
442 3300049586 Ga0501070_0018784 Ga0501070_0018784_1097_1636 177
443 3300049586 Ga0501070_0078668 Ga0501070_0078668_896_1429 177
444 3300049586 Ga0501070_0392480 Ga0501070_0392480_126_659 177
445 3300049588 Ga0501072_0222557 Ga0501072_0222557_579_1121 177
446 3300049589 Ga0501073_0005469 Ga0501073_0005469_2916_3449 177
447 3300049589 Ga0501073_0110538 Ga0501073_0110538_795_1334 177
448 3300049589 Ga0501073_0600030 Ga0501073_0600030_129_665 177
449 3300049590 Ga0501074_0003987 Ga0501074_0003987_3715_4248 177
450 3300049590 Ga0501074_0026707 Ga0501074_0026707_2559_3098 177
451 3300049591 Ga0501075_0085277 Ga0501075_0085277_111_653 177
452 3300049592 Ga0501076_0333262 Ga0501076_0333262_697_1230 177
453 3300049592 Ga0501076_0762520 Ga0501076_0762520_151_693 177
454 3300049741 Ga0501079_0025746 Ga0501079_0025746_1168_1707 177
455 3300049741 Ga0501079_0098713 Ga0501079_0098713_577_1110 177
456 3300049741 Ga0501079_0285470 Ga0501079_0285470_136_678 177
457 3300049742 Ga0501080_0075438 Ga0501080_0075438_1057_1590 177
458 3300049742 Ga0501080_0247118 Ga0501080_0247118_946_1482 177
459 3300049742 Ga0501080_0404671 Ga0501080_0404671_411_950 177
460 3300049743 Ga0501081_0707636 Ga0501081_0707636_106_648 177
461 3300049744 Ga0501083_0015974 Ga0501083_0015974_1257_1790 177
462 3300049744 Ga0501083_0055201 Ga0501083_0055201_1686_2219 177
463 3300049744 Ga0501083_0071261 Ga0501083_0071261_37_576 177
464 3300049822 Ga0501035_0005562 Ga0501035_0005562_7976_8509 177
465 3300049822 Ga0501035_0031124 Ga0501035_0031124_3240_3779 177
466 3300049822 Ga0501035_0055413 Ga0501035_0055413_1391_1924 177
467 3300049823 Ga0501044_0028811 Ga0501044_0028811_5167_5706 177
468 3300049823 Ga0501044_0034334 Ga0501044_0034334_2439_2972 177
469 3300049823 Ga0501044_0065899 Ga0501044_0065899_211_744 177
470 3300049823 Ga0501044_0117731 Ga0501044_0117731_2030_2563 177
471 3300049823 Ga0501044_0245484 Ga0501044_0245484_627_1163 177
472 3300049823 Ga0501044_0448510 Ga0501044_0448510_69_602 177
473 3300049824 Ga0501045_0049489 Ga0501045_0049489_2062_2595 177
474 3300049824 Ga0501045_0160862 Ga0501045_0160862_1061_1603 177
475 3300050510 nmdc:mga06r32_369594_c1 nmdc:mga06r32_369594_c1_456_1001 177
476 3300053087 Ga0500643_000021 Ga0500643_000021_65937_66470 177
477 3300053087 Ga0500643_111373 Ga0500643_111373_196_729 177
478 3300053096 Ga0500641_0176742 Ga0500641_0176742_181_714 177
479 3300053116 Ga0500592_044130 Ga0500592_044130_126_659 177
480 3300053118 Ga0500594_0125584 Ga0500594_0125584_213_746 177
481 3300054114 Ga0501084_0002480 Ga0501084_0002480_1036_1575 177
482 3300054114 Ga0501084_0003016 Ga0501084_0003016_617_1150 177
483 3300054114 Ga0501084_0272859 Ga0501084_0272859_163_705 177
484 3300054114 Ga0501084_0860947 Ga0501084_0860947_48_587 177
485 3300060353 Ga0501082_0018958 Ga0501082_0018958_3559_4092 177
486 3300060353 Ga0501082_0064560 Ga0501082_0064560_1419_1952 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

32

165

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kzk-assembly1.cif.gz_B crystal structure of rrna methyltransferase from sinorhizobium meliloti 0.8108 2 144
1x7p-assembly1.cif.gz_A crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.8041 1 146
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.8014 1 144
1x7p-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.7983 1 142
1gz0-assembly4.cif.gz_D 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.7968 2 143
ID Description Score Start End Superfamily
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8291 2 145 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8175 5 145 3.40.1280.10
af_O53715_16_181_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8145 2 145 3.40.1280.10
1gz0F02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8134 1 143 3.40.1280.10
4cngB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.7967 4 140 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A352CBW3-F1-model_v4 RNA methyltransferase 0.9151 1 147 GO:0002128
GO:0003723
GO:0005829
GO:0008173
AF-A0A7V9SAR2-F1-model_v4 TrmH family RNA methyltransferase 0.9114 1 79 GO:0008168
GO:0032259
AF-A0A2S6UW64-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9101 1 145 GO:0002128
GO:0003723
GO:0005829
GO:0008173
AF-A0A355H914-F1-model_v4 rRNA methyltransferase 0.9087 1 140 GO:0002128
GO:0003723
GO:0005829
GO:0008173
AF-A0A7Z9LHG9-F1-model_v4 TrmH family RNA methyltransferase 0.9055 1 146 GO:0002128
GO:0003723
GO:0005829
GO:0008173

Feature Viewer

pLDDT pTM Quality
75.48 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map