F453189

General Info

Members Datasets Scaffolds Average Seq Length
485 342 372 289

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2744054900|2746090038
Length 347
Sequence HPNPGKPTPLTDFDEANLMPGNVTVAIDYSMVNYKNAMTPRFGAVPLSMSTPDGHTQEKTMNSSDPGNESGTSYIHAPNLSINAGGTAFAYRDLGPRTDMPLIMLNHWGAVLDNFDPRIVDGLARRHRIIAVDYRGIGSSGGTAPVTVDEMARDTIALIRALGFDQVNLLGFSLGGFVAQDVALKAPSLVHKLIVTGSGPAGGQGIDRVGAVSWPLMLKGLLTLRDPKAYMFFTSTTNGRKAASAFLKRLKERKTGRDKGPTPRGLLRQLEAIKAWGRQAPQDLARLQMPVLIANGDNDIMVPTALSRDMARRIHQVQLVIYEDAGHGGIFQYHADFVSRALVFLAE

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
4 2511231016 Pseudomonas sp. GM50 Isolate Nodule
5 2511231018 Pseudomonas sp. GM60 Isolate Nodule
6 2511231022 Pseudomonas sp. GM79 Isolate Nodule
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
10 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
11 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
12 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
13 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
14 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
15 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
16 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
17 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
18 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
19 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
20 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
21 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
22 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
23 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
26 2643221583 Caulobacter sp. Root655 Isolate Unclassified
27 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
28 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
29 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
30 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
31 2718218423 Rhizobium sp. N941 Isolate Nodule
32 2721755809 Rhizobium sp. N541 Isolate Nodule
33 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
34 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
35 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
36 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
37 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
38 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
39 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
40 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
41 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
42 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
43 2773857670 Pseudomonas sp. 478 Isolate Unclassified
44 2773857673 Pseudomonas sp. 443 Isolate Unclassified
45 2784132072 Pseudomonas sp. 460 Isolate Unclassified
46 2791355256 Rhizobium sp. M10 Isolate Nodule
47 2791355262 Rhizobium sp. M1 Isolate Nodule
48 2791355263 Rhizobium chutanense C5 Isolate Nodule
49 2791355266 Rhizobium sp. L43 Isolate Nodule
50 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
51 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
52 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
53 2818991435 Caulobacter henricii 536 Isolate Unclassified
54 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
55 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
56 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
57 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
58 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
59 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
60 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
61 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
62 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
63 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
64 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
65 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
66 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
67 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
68 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
69 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
70 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
71 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
72 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
73 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
74 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
75 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
76 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
77 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
78 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
79 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
80 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
81 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
82 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
83 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
84 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
85 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
86 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
87 2928163908 Burkholderia sp. 567 Isolate Unclassified
88 2928170801 Burkholderia sp. 572 Isolate Unclassified
89 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
90 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
91 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
92 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
93 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
94 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
95 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
96 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
97 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
98 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
99 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
100 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
101 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
102 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
103 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
104 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
105 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
106 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
107 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
108 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
109 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
110 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
111 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
112 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
115 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
118 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
119 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
120 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
208 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
209 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
216 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
217 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
218 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
219 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
220 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
221 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
222 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
225 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
226 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
227 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
231 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
277 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
278 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
315 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
318 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
319 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
320 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
324 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
325 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
329 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
330 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
331 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
332 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
333 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
334 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
335 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
336 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
337 8018176218 Rhizobium sp. N122 Isolate Nodule
338 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
339 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
340 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
341 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
342 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.7
Metatranscriptomes 0
Isolates 23.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.64
Nodule 11.75
Rhizoplane 4.33
Rhizosphere 49.48
Stem 0
Stem Tuber 0
Unclassified 19.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001068 3300002705 Bacteria 12636
2 JGI25151J46595_10000373 3300003187 Bacteria 46885
3 JGI25165J46597_1002883 3300003214 Bacteria 4886
4 Ga0055533_1000156 3300003756 Bacteria 66116
5 Ga0055532_1000045 3300003758 Bacteria 186314
6 Ga0055527_1000027 3300003760 Bacteria 186314
7 Ga0055535_1000033 3300003761 Bacteria 186314
8 Ga0055542_1000050 3300003762 Bacteria 186314
9 Ga0055542_1007144 3300003762 Bacteria 2305
10 Ga0055529_1000061 3300003763 Bacteria 186314
11 Ga0055531_10000965 3300003794 Bacteria 23016
12 Ga0068869_100016667 3300005334 Bacteria 4956
13 Ga0070661_100271654 3300005344 Bacteria 1313
14 Ga0070668_100060701 3300005347 Bacteria 2928
15 Ga0070668_100197663 3300005347 Bacteria 1650
16 Ga0070673_100503086 3300005364 Bacteria 1096
17 Ga0070667_100112608 3300005367 Bacteria 2360
18 Ga0070663_100015708 3300005455 Bacteria 4896
19 Ga0070678_100211662 3300005456 Bacteria 1606
20 Ga0070662_100057052 3300005457 Bacteria 2836
21 Ga0070662_100150022 3300005457 Bacteria 1814
22 Ga0070698_100684712 3300005471 Bacteria 967
23 Ga0068855_100426708 3300005563 Bacteria 1449
24 Ga0068859_100318311 3300005617 Bacteria 1650
25 Ga0068861_100061529 3300005719 Bacteria 2882
26 Ga0068863_100039775 3300005841 Bacteria 4473
27 Ga0068858_100135006 3300005842 Bacteria 2315
28 Ga0068862_100077186 3300005844 Bacteria 2884
29 Ga0075365_10042710 3300006038 Bacteria 2965
30 Ga0075363_100207814 3300006048 Bacteria 1120
31 Ga0075364_10027888 3300006051 Bacteria 3610
32 Ga0075364_10092716 3300006051 Bacteria 2005
33 Ga0075432_10005619 3300006058 Bacteria 4271
34 Ga0075362_10013685 3300006177 Bacteria 3255
35 Ga0075369_10000717 3300006186 Bacteria 10677
36 Ga0075369_10030168 3300006186 Bacteria 2282
37 Ga0075370_10095963 3300006353 Bacteria 1713
38 Ga0075370_10142057 3300006353 Bacteria 1404
39 Ga0075431_100025650 3300006847 Bacteria 6042
40 Ga0068865_100350601 3300006881 Bacteria 1196
41 Ga0097620_100318285 3300006931 Bacteria 1650
42 Ga0079104_1003726 3300006946 Bacteria 6896
43 Ga0099826_10000081 3300006948 Bacteria 48659
44 Ga0105244_10013847 3300009036 Bacteria 4690
45 Ga0105244_10044162 3300009036 Bacteria 2297
46 Ga0105250_10000207 3300009092 Bacteria 49366
47 Ga0105250_10012873 3300009092 Bacteria 3444
48 Ga0105250_10017372 3300009092 Bacteria 2926
49 Ga0105240_10000645 3300009093 Bacteria 64351
50 Ga0111539_10701023 3300009094 Bacteria 1178
51 Ga0114129_10810103 3300009147 Bacteria 1194
52 Ga0105242_10083846 3300009176 Bacteria 2670
53 Ga0105242_10345641 3300009176 Bacteria 1372
54 Ga0105237_10036302 3300009545 Bacteria 4986
55 Ga0105237_10131081 3300009545 Bacteria 2501
56 Ga0105239_10042245 3300010375 Bacteria 4996
57 Ga0105239_10324067 3300010375 Bacteria 1738
58 Ga0157371_10000209 3300013102 Bacteria 85823
59 Ga0157370_10000398 3300013104 Bacteria 54807
60 Ga0157374_10035971 3300013296 Bacteria 4534
61 Ga0157374_10387941 3300013296 Bacteria 1392
62 Ga0157378_10380457 3300013297 Bacteria 1386
63 Ga0163162_10027168 3300013306 Bacteria 5659
64 Ga0157372_10000821 3300013307 Bacteria 33625
65 Ga0157372_10097729 3300013307 Bacteria 3349
66 Ga0157375_10000466 3300013308 Bacteria 36856
67 Ga0157375_10019753 3300013308 Bacteria 6137
68 Ga0157375_10020274 3300013308 Bacteria 6069
69 Ga0182008_10000251 3300014497 Bacteria 41625
70 Ga0182008_10000429 3300014497 Bacteria 32349
71 Ga0182006_1001980 3300015261 Bacteria 11583
72 Ga0182006_1007269 3300015261 Bacteria 5082
73 Ga0163161_10004279 3300017792 Bacteria 9955
74 Ga0163161_10028069 3300017792 Bacteria 3994
75 Ga0209566_105190 3300025225 Bacteria 1670
76 Ga0209674_100074 3300025226 Bacteria 223554
77 Ga0209672_100053 3300025228 Bacteria 223599
78 Ga0209147_100070 3300025229 Bacteria 223535
79 Ga0209563_100760 3300025230 Bacteria 9838
80 Ga0207427_102893 3300025231 Bacteria 4081
81 Ga0209258_100094 3300025242 Bacteria 223535
82 Ga0209148_1000100 3300025254 Bacteria 223604
83 Ga0209148_1000633 3300025254 Bacteria 30967
84 Ga0209759_1000009 3300025256 Bacteria 446623
85 Ga0209759_1008490 3300025256 Bacteria 3194
86 Ga0209233_1000144 3300025261 Bacteria 190024
87 Ga0209455_1000090 3300025272 Bacteria 223604
88 Ga0209676_1000190 3300025292 Bacteria 140482
89 Ga0209025_1000969 3300025294 Bacteria 43045
90 Ga0209025_1001557 3300025294 Bacteria 29150
91 Ga0209758_1003930 3300025297 Bacteria 12947
92 Ga0209257_1000538 3300025304 Bacteria 65300
93 Ga0207696_1000002 3300025711 Bacteria 1098043
94 Ga0207696_1011178 3300025711 Bacteria 3247
95 Ga0207696_1042968 3300025711 Bacteria 1316
96 Ga0207655_1005481 3300025728 Bacteria 8610
97 Ga0207655_1013777 3300025728 Bacteria 4615
98 Ga0207713_1006129 3300025735 Bacteria 7392
99 Ga0207713_1007845 3300025735 Bacteria 6224
100 Ga0207688_10016451 3300025901 Bacteria 4011
101 Ga0207647_10001905 3300025904 Bacteria 15994
102 Ga0207645_10038180 3300025907 Bacteria 3080
103 Ga0207643_10023472 3300025908 Bacteria 3400
104 Ga0207695_10000547 3300025913 Bacteria 78059
105 Ga0207671_10040169 3300025914 Bacteria 3463
106 Ga0207671_10232675 3300025914 Bacteria 1446
107 Ga0207659_10217346 3300025926 Bacteria 1535
108 Ga0207664_10232164 3300025929 Bacteria 1604
109 Ga0207664_10497539 3300025929 Bacteria 1091
110 Ga0207706_10059264 3300025933 Bacteria 3372
111 Ga0207689_10003059 3300025942 Bacteria 15407
112 Ga0207668_10299044 3300025972 Bacteria 1327
113 Ga0207703_10287958 3300026035 Bacteria 1494
114 Ga0207639_10139784 3300026041 Bacteria 2016
115 Ga0207678_10003610 3300026067 Bacteria 13908
116 Ga0207678_10104303 3300026067 Bacteria 2420
117 Ga0207641_10126466 3300026088 Bacteria 2289
118 Ga0207675_100071305 3300026118 Bacteria 3248
119 Ga0207683_10328680 3300026121 Bacteria 1401
120 Ga0209281_1002401 3300027111 Bacteria 7608
121 Ga0209282_1001951 3300027666 Bacteria 11648
122 Ga0209813_10015942 3300027866 Bacteria 2043
123 Ga0268266_10108104 3300028379 Bacteria 2461
124 Ga0268265_10443650 3300028380 Bacteria 1210
125 Ga0307515_10240267 3300028794 Bacteria 1584
126 Ga0307511_10017686 3300030521 Bacteria 6833
127 Ga0307509_10003502 3300031507 Bacteria 23683
128 Ga0307509_10245721 3300031507 Bacteria 1577
129 Ga0307516_10007313 3300031730 Bacteria 12710
130 Ga0307416_100702902 3300032002 Bacteria 1100
131 Ga0307510_10001244 3300033180 Bacteria 27679
132 Ga0395900_0033957 3300037418 Bacteria 5250
133 Ga0395900_0035463 3300037418 Bacteria 5138
134 Ga0395905_0023224 3300037471 Bacteria 5862
135 Ga0395905_0203172 3300037471 Bacteria 1857
136 Ga0395901_0354091 3300038443 Bacteria 1515
137 Ga0436365_0091288 3300039437 Bacteria 1821
138 Ga0439438_002520 3300041405 Bacteria 7771
139 Ga0439447_005563 3300041407 Bacteria 4172
140 Ga0439466_0005163 3300041411 Bacteria 5002
141 Ga0439465_0002423 3300041413 Bacteria 6110
142 Ga0451851_1035445 3300041507 Bacteria 1921
143 Ga0451853_2277222 3300041512 Bacteria 1860
144 Ga0451853_3003955 3300041512 Bacteria 1332
145 Ga0439448_0000193 3300042005 Bacteria 12632
146 Ga0439432_003642 3300042006 Bacteria 5694
147 Ga0439451_018068 3300042009 Bacteria 1422
148 Ga0439452_004120 3300042010 Bacteria 4939
149 Ga0439456_011670 3300042013 Bacteria 1818
150 Ga0439463_008411 3300042016 Bacteria 2544
151 Ga0450911_001667 3300042115 Bacteria 4916
152 Ga0450919_000226 3300042121 Bacteria 6294
153 Ga0450903_002701 3300042138 Bacteria 3127
154 Ga0450906_004234 3300042145 Bacteria 3019
155 Ga0439446_0000458 3300042156 Bacteria 8062
156 Ga0450908_000492 3300042184 Bacteria 7594
157 Ga0439460_0005851 3300042461 Bacteria 3032
158 Ga0439440_0021134 3300042993 Bacteria 1464
159 Ga0495617_000047 3300046452 Bacteria 115291
160 Ga0495617_004299 3300046452 Bacteria 5193
161 Ga0495617_004806 3300046452 Bacteria 4869
162 Ga0495627_000331 3300046453 Bacteria 45362
163 Ga0495603_0021354 3300046455 Bacteria 3920
164 Ga0495590_0006220 3300046457 Bacteria 4673
165 Ga0495591_000144 3300046458 Bacteria 75817
166 Ga0495638_0038220 3300046460 Bacteria 3051
167 Ga0495638_0176858 3300046460 Bacteria 1220
168 Ga0495650_0001138 3300046471 Bacteria 28825
169 Ga0495650_0001218 3300046471 Bacteria 26948
170 Ga0495605_0001055 3300046474 Bacteria 18389
171 Ga0495605_0001243 3300046474 Bacteria 16956
172 Ga0495639_0081930 3300046475 Bacteria 1504
173 Ga0495584_0000352 3300046491 Bacteria 31967
174 Ga0495584_0000978 3300046491 Bacteria 17902
175 Ga0495584_0028016 3300046491 Bacteria 2853
176 Ga0495585_0012751 3300046492 Bacteria 4945
177 Ga0495585_0028154 3300046492 Bacteria 3206
178 Ga0495594_0005760 3300046499 Bacteria 6363
179 Ga0495607_0001194 3300046501 Bacteria 23467
180 Ga0495607_0037588 3300046501 Bacteria 2906
181 Ga0495607_0057893 3300046501 Bacteria 2218
182 Ga0495607_0118849 3300046501 Bacteria 1390
183 Ga0495583_0041670 3300046506 Bacteria 2149
184 Ga0495606_0015983 3300046507 Bacteria 5748
185 Ga0495606_0047725 3300046507 Bacteria 2822
186 Ga0495610_0037474 3300046512 Bacteria 2467
187 Ga0495616_0000663 3300046513 Bacteria 25582
188 Ga0495616_0005307 3300046513 Bacteria 7943
189 Ga0495620_0000257 3300046515 Bacteria 39311
190 Ga0495620_0003915 3300046515 Bacteria 8484
191 Ga0495620_0029164 3300046515 Bacteria 2557
192 Ga0495631_0000793 3300046518 Bacteria 20196
193 Ga0495632_0000104 3300046519 Bacteria 86556
194 Ga0495632_0000615 3300046519 Bacteria 32915
195 Ga0495632_0002308 3300046519 Bacteria 14681
196 Ga0495637_0003827 3300046520 Bacteria 7905
197 Ga0495637_0003835 3300046520 Bacteria 7892
198 Ga0495637_0005812 3300046520 Bacteria 6248
199 Ga0495643_0004021 3300046522 Bacteria 10496
200 Ga0495643_0026570 3300046522 Bacteria 3264
201 Ga0495643_0059256 3300046522 Bacteria 2036
202 Ga0495643_0107815 3300046522 Bacteria 1419
203 Ga0495644_0012793 3300046523 Bacteria 3226
204 Ga0495644_0029451 3300046523 Bacteria 2074
205 Ga0495648_0000650 3300046524 Bacteria 37082
206 Ga0495648_0025913 3300046524 Bacteria 3959
207 Ga0495648_0099150 3300046524 Bacteria 1612
208 Ga0495642_0000082 3300046528 Bacteria 55424
209 Ga0495642_0006181 3300046528 Bacteria 4594
210 Ga0495654_0021813 3300046530 Bacteria 3330
211 Ga0495654_0022846 3300046530 Bacteria 3243
212 Ga0495654_0127839 3300046530 Bacteria 1143
213 Ga0495598_0061498 3300046537 Bacteria 1160
214 Ga0495609_0000316 3300046538 Bacteria 43165
215 Ga0495609_0000982 3300046538 Bacteria 20389
216 Ga0495609_0001713 3300046538 Bacteria 14212
217 Ga0495597_0006761 3300046542 Bacteria 5902
218 Ga0495622_0005762 3300046557 Bacteria 5745
219 Ga0495633_0000564 3300046558 Bacteria 36203
220 Ga0495656_0012951 3300046615 Bacteria 3091
221 Ga0495668_0055817 3300046616 Bacteria 2181
222 Ga0495668_0223482 3300046616 Bacteria 1031
223 Ga0495611_0000024 3300046648 Bacteria 118898
224 Ga0495611_0001284 3300046648 Bacteria 12844
225 Ga0495611_0036271 3300046648 Bacteria 2187
226 Ga0495625_0018045 3300046660 Bacteria 5515
227 Ga0495659_0001267 3300046664 Bacteria 8718
228 Ga0495661_0000047 3300046665 Bacteria 146326
229 Ga0495661_0041319 3300046665 Bacteria 2854
230 Ga0495669_0000895 3300046684 Bacteria 12544
231 Ga0495670_0042116 3300046691 Bacteria 2278
232 Ga0495670_0043610 3300046691 Bacteria 2238
233 Ga0495671_0000160 3300046692 Bacteria 59259
234 Ga0495671_0005892 3300046692 Bacteria 7133
235 Ga0495671_0007838 3300046692 Bacteria 6044
236 Ga0495671_0028709 3300046692 Bacteria 2862
237 Ga0495671_0111870 3300046692 Bacteria 1333
238 Ga0495649_0008718 3300046694 Bacteria 6082
239 Ga0495589_0001005 3300046794 Bacteria 17108
240 Ga0495589_0001408 3300046794 Bacteria 13946
241 Ga0495589_0003672 3300046794 Bacteria 8289
242 Ga0495660_0001349 3300046810 Bacteria 16870
243 Ga0495660_0001910 3300046810 Bacteria 13610
244 Ga0495660_0030605 3300046810 Bacteria 3031
245 Ga0495660_0036623 3300046810 Bacteria 2736
246 Ga0495636_0002693 3300047318 Bacteria 6855
247 Ga0495672_0001945 3300047320 Bacteria 19530
248 Ga0495672_0012476 3300047320 Bacteria 5927
249 Ga0495672_0013454 3300047320 Bacteria 5645
250 Ga0495672_0026420 3300047320 Bacteria 3704
251 Ga0495683_0012180 3300047323 Bacteria 4520
252 Ga0495687_000692 3300047443 Bacteria 38222
253 Ga0495675_0304679 3300047444 Bacteria 945
254 Ga0495677_0001731 3300047445 Bacteria 8746
255 Ga0495679_003259 3300047446 Bacteria 7871
256 Ga0495685_002424 3300047447 Bacteria 5842
257 Ga0495685_005415 3300047447 Bacteria 4166
258 Ga0495685_057631 3300047447 Bacteria 1312
259 Ga0495673_0002142 3300047469 Bacteria 14337
260 Ga0495673_0005975 3300047469 Bacteria 7244
261 Ga0495673_0150393 3300047469 Bacteria 900
262 Ga0495681_0002242 3300047470 Bacteria 13905
263 Ga0495681_0004277 3300047470 Bacteria 9787
264 Ga0495681_0018243 3300047470 Bacteria 3870
265 Ga0495681_0023527 3300047470 Bacteria 3271
266 Ga0495681_0031486 3300047470 Bacteria 2683
267 Ga0495686_0056040 3300047472 Bacteria 2463
268 Ga0495626_0000519 3300048091 Bacteria 38597
269 Ga0496102_0064417 3300048905 Bacteria 3357
270 Ga0496102_0109912 3300048905 Bacteria 2569
271 Ga0496102_0265976 3300048905 Bacteria 1617
272 Ga0496102_0465301 3300048905 Bacteria 1185
273 Ga0496103_0316586 3300048906 Bacteria 1004
274 Ga0496104_0275847 3300048907 Bacteria 1594
275 Ga0496106_0031122 3300048909 Bacteria 3976
276 Ga0496106_0113439 3300048909 Bacteria 2112
277 Ga0496113_0038094 3300048916 Bacteria 3533
278 Ga0496113_0168625 3300048916 Bacteria 1733
279 Ga0496114_0118092 3300048917 Bacteria 2278
280 Ga0496115_0062629 3300048918 Bacteria 3001
281 Ga0496116_0037002 3300048919 Bacteria 3409
282 Ga0496117_0000597 3300048920 Bacteria 59321
283 Ga0496117_0039081 3300048920 Bacteria 3506
284 Ga0496117_0057071 3300048920 Bacteria 2715
285 Ga0496118_0027531 3300048921 Bacteria 4807
286 Ga0496118_0032844 3300048921 Bacteria 4267
287 Ga0496118_0099390 3300048921 Bacteria 1972
288 Ga0496118_0161878 3300048921 Bacteria 1382
289 Ga0496118_0163296 3300048921 Bacteria 1373
290 Ga0496119_0000047 3300048922 Bacteria 188401
291 Ga0496119_0003729 3300048922 Bacteria 15607
292 Ga0496119_0032704 3300048922 Bacteria 3462
293 Ga0496119_0088890 3300048922 Bacteria 1760
294 Ga0496120_0000041 3300048923 Bacteria 200518
295 Ga0496120_0002470 3300048923 Bacteria 18618
296 Ga0496120_0036236 3300048923 Bacteria 2938
297 Ga0496120_0055498 3300048923 Bacteria 2239
298 Ga0496120_0096110 3300048923 Bacteria 1574
299 Ga0496121_0000191 3300048924 Bacteria 136529
300 Ga0496121_0000373 3300048924 Bacteria 92338
301 Ga0496121_0019621 3300048924 Bacteria 6751
302 Ga0496121_0020118 3300048924 Bacteria 6627
303 Ga0496121_0033847 3300048924 Bacteria 4612
304 Ga0496121_0038397 3300048924 Bacteria 4242
305 Ga0496121_0052441 3300048924 Bacteria 3426
306 Ga0496122_0001605 3300048925 Bacteria 35364
307 Ga0496122_0022873 3300048925 Bacteria 5535
308 Ga0496122_0116614 3300048925 Bacteria 1736
309 Ga0496122_0139539 3300048925 Bacteria 1519
310 Ga0496123_0003847 3300048926 Bacteria 16337
311 Ga0496123_0014379 3300048926 Bacteria 6565
312 Ga0496123_0021002 3300048926 Bacteria 5089
313 Ga0496124_0000747 3300048927 Bacteria 53318
314 Ga0496124_0002311 3300048927 Bacteria 25168
315 Ga0496124_0033034 3300048927 Bacteria 4558
316 Ga0496124_0036107 3300048927 Bacteria 4315
317 Ga0496124_0050551 3300048927 Bacteria 3541
318 Ga0496124_0117464 3300048927 Bacteria 2130
319 Ga0496125_0000465 3300048928 Bacteria 72631
320 Ga0496125_0000709 3300048928 Bacteria 55274
321 Ga0496125_0014004 3300048928 Bacteria 7843
322 Ga0496125_0048096 3300048928 Bacteria 3560
323 Ga0496125_0085765 3300048928 Bacteria 2384
324 Ga0496125_0087834 3300048928 Bacteria 2346
325 Ga0496126_0000238 3300048929 Bacteria 118994
326 Ga0496126_0001120 3300048929 Bacteria 44884
327 Ga0496126_0019556 3300048929 Bacteria 6666
328 Ga0496126_0041076 3300048929 Bacteria 4284
329 Ga0496126_0058654 3300048929 Bacteria 3469
330 Ga0496126_0316246 3300048929 Bacteria 1284
331 Ga0495678_000441 3300049459 Bacteria 41428
332 Ga0495678_005486 3300049459 Bacteria 6990
333 Ga0495678_036484 3300049459 Bacteria 2005
334 Ga0495682_0006499 3300049460 Bacteria 4722
335 nmdc:mga03683_18721_c1 3300050489 Bacteria 2636
336 nmdc:mga0yw44_320814_c1 3300050492 Bacteria 1040
337 nmdc:mga06z11_115409_c1 3300050494 Bacteria 1492
338 nmdc:mga04h51_23535_c1 3300050495 Bacteria 1876
339 nmdc:mga05p37_611721_c1 3300050507 Bacteria 1228
340 nmdc:mga0qj67_1754_c1 3300050509 Bacteria 15340
341 nmdc:mga06r32_18913_c1 3300050510 Bacteria 6316
342 nmdc:mga0sz30_15011_c1 3300050516 Bacteria 3057
343 nmdc:mga0sz30_20819_c1 3300050516 Bacteria 2648
344 Ga0500610_0000239 3300053079 Bacteria 16590
345 Ga0500610_0000575 3300053079 Bacteria 11291
346 Ga0500643_000485 3300053087 Bacteria 28889
347 Ga0500643_023786 3300053087 Bacteria 1953
348 Ga0500583_0076501 3300053092 Bacteria 1610
349 Ga0500641_0009881 3300053096 Bacteria 3437
350 Ga0500650_0028691 3300053098 Bacteria 2514
351 Ga0500556_0000012 3300053104 Bacteria 250391
352 Ga0500592_007527 3300053116 Bacteria 1732
353 Ga0500593_000078 3300053117 Bacteria 36294
354 Ga0500594_0000365 3300053118 Bacteria 10095
355 Ga0500642_0000013 3300053130 Bacteria 197927
356 Ga0500642_0030464 3300053130 Bacteria 2245
357 Ga0500652_001393 3300053131 Bacteria 7534
358 Ga0500658_0000166 3300053134 Bacteria 31883
359 Ga0500568_0000676 3300053139 Bacteria 24605
360 Ga0500568_0001031 3300053139 Bacteria 19068
361 Ga0500604_0045652 3300053151 Bacteria 1337
362 Ga0500616_0000035 3300053153 Bacteria 394242
363 Ga0500616_0050648 3300053153 Bacteria 2192
364 Ga0500616_0057920 3300053153 Bacteria 2017
365 Ga0500619_034165 3300053154 Bacteria 1569
366 Ga0500622_0006199 3300053156 Bacteria 7000
367 Ga0500627_0007737 3300053158 Bacteria 3768
368 Ga0500634_0017193 3300053161 Bacteria 3871
369 Ga0500634_0073981 3300053161 Bacteria 1776
370 Ga0500634_0084114 3300053161 Bacteria 1631
371 Ga0500645_010381 3300053730 Bacteria 3083
372 Ga0500565_002013 3300053734 Bacteria 1463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0088890 Ga0496119_0088890_379_1227 264
2 3300039437 Ga0436365_0091288 Ga0436365_0091288_495_1550 265
3 3300037418 Ga0395900_0033957 Ga0395900_0033957_1917_2795 276
4 3300053087 Ga0500643_000485 Ga0500643_000485_5048_5947 277
5 iso_pu_bacteria 2969304461 2969307061 278
6 3300046452 Ga0495617_004299 Ga0495617_004299_1908_2747 279
7 3300046460 Ga0495638_0038220 Ga0495638_0038220_1240_2079 279
8 3300046507 Ga0495606_0015983 Ga0495606_0015983_1583_2422 279
9 3300046513 Ga0495616_0000663 Ga0495616_0000663_2463_3302 279
10 3300046515 Ga0495620_0000257 Ga0495620_0000257_14022_14861 279
11 3300046515 Ga0495620_0003915 Ga0495620_0003915_3742_4581 279
12 3300046520 Ga0495637_0003827 Ga0495637_0003827_3780_4619 279
13 3300046523 Ga0495644_0012793 Ga0495644_0012793_840_1679 279
14 3300046524 Ga0495648_0099150 Ga0495648_0099150_415_1254 279
15 3300046530 Ga0495654_0022846 Ga0495654_0022846_2219_3058 279
16 3300046538 Ga0495609_0000982 Ga0495609_0000982_8931_9770 279
17 3300046558 Ga0495633_0000564 Ga0495633_0000564_25465_26304 279
18 3300046648 Ga0495611_0000024 Ga0495611_0000024_35322_36161 279
19 3300046692 Ga0495671_0005892 Ga0495671_0005892_2832_3671 279
20 3300046692 Ga0495671_0111870 Ga0495671_0111870_399_1238 279
21 3300046794 Ga0495589_0001408 Ga0495589_0001408_9325_10164 279
22 3300046810 Ga0495660_0001349 Ga0495660_0001349_6598_7437 279
23 3300047469 Ga0495673_0150393 Ga0495673_0150393_20_859 279
24 3300047470 Ga0495681_0002242 Ga0495681_0002242_10250_11089 279
25 3300047470 Ga0495681_0004277 Ga0495681_0004277_4224_5063 279
26 3300047470 Ga0495681_0031486 Ga0495681_0031486_499_1338 279
27 3300049459 Ga0495678_005486 Ga0495678_005486_3069_3908 279
28 iso_pu_bacteria 2902682994 2902686862 279
29 3300025929 Ga0207664_10232164 Ga0207664_102321642 280
30 3300025929 Ga0207664_10497539 Ga0207664_104975391 280
31 3300031730 Ga0307516_10007313 Ga0307516_100073131 280
32 3300046692 Ga0495671_0007838 Ga0495671_0007838_4222_5070 280
33 3300048921 Ga0496118_0163296 Ga0496118_0163296_441_1328 280
34 3300053079 Ga0500610_0000239 Ga0500610_0000239_5585_6433 280
35 3300053117 Ga0500593_000078 Ga0500593_000078_6613_7461 280
36 3300053153 Ga0500616_0000035 Ga0500616_0000035_336719_337606 280
37 3300053158 Ga0500627_0007737 Ga0500627_0007737_2700_3548 280
38 3300053161 Ga0500634_0073981 Ga0500634_0073981_364_1212 280
39 3300009094 Ga0111539_10701023 Ga0111539_107010232 281
40 3300003762 Ga0055542_1007144 Ga0055542_10071442 282
41 3300025254 Ga0209148_1000633 Ga0209148_10006332 282
42 3300046665 Ga0495661_0041319 Ga0495661_0041319_284_1132 282
43 3300048924 Ga0496121_0052441 Ga0496121_0052441_1006_1854 282
44 3300048928 Ga0496125_0014004 Ga0496125_0014004_6165_7013 282
45 iso_pu_bacteria 2510461069 2510842725 282
46 iso_pu_bacteria 2675903420 2677896444 282
47 iso_pu_bacteria 2791355256 2793296888 282
48 iso_pu_bacteria 2791355262 2793336194 282
49 3300013307 Ga0157372_10097729 Ga0157372_100977293 283
50 3300025933 Ga0207706_10059264 Ga0207706_100592642 283
51 3300033180 Ga0307510_10001244 Ga0307510_1000124420 283
52 3300047444 Ga0495675_0304679 Ga0495675_0304679_21_884 283
53 3300048905 Ga0496102_0465301 Ga0496102_0465301_111_974 283
54 3300048917 Ga0496114_0118092 Ga0496114_0118092_1330_2181 283
55 3300048918 Ga0496115_0062629 Ga0496115_0062629_436_1287 283
56 3300053092 Ga0500583_0076501 Ga0500583_0076501_667_1518 283
57 3300053130 Ga0500642_0030464 Ga0500642_0030464_720_1571 283
58 iso_pu_bacteria 2510461076 2510897445 283
59 iso_pu_bacteria 2513237084 2513570341 283
60 iso_pu_bacteria 2513237093 2513633923 283
61 iso_pu_bacteria 2513237162 2514024700 283
62 iso_pu_bacteria 2515075009 2515110063 283
63 iso_pu_bacteria 2515154114 2515646908 283
64 iso_pu_bacteria 2515154116 2515661140 283
65 iso_pu_bacteria 2516653046 2516898282 283
66 iso_pu_bacteria 2529292951 2530648083 283
67 iso_pu_bacteria 2599185240 2599746015 283
68 iso_pu_bacteria 2599185355 2600208151 283
69 iso_pu_bacteria 2602042107 2603857715 283
70 iso_pu_bacteria 2675903129 2676743606 283
71 iso_pu_bacteria 2718218423 2721397629 283
72 iso_pu_bacteria 2721755809 2724036439 283
73 iso_pu_bacteria 2724679232 2725952328 283
74 iso_pu_bacteria 2738543004 2739197195 283
75 iso_pu_bacteria 2738543031 2739351630 283
76 iso_pu_bacteria 2751185897 2753763064 283
77 iso_pu_bacteria 2758568016 2758638409 283
78 iso_pu_bacteria 2791355263 2793344858 283
79 iso_pu_bacteria 2791355266 2793358234 283
80 iso_pu_bacteria 2816332286 2817456599 283
81 iso_pu_bacteria 2838680041 2838680307 283
82 iso_pu_bacteria 2838694306 2838695661 283
83 iso_pu_bacteria 2838707686 2838709036 283
84 iso_pu_bacteria 2841846520 2841850305 283
85 iso_pu_bacteria 2841864319 2841868828 283
86 iso_pu_bacteria 2842077413 2842079728 283
87 iso_pu_bacteria 2842118031 2842120346 283
88 iso_pu_bacteria 2842124991 2842128778 283
89 iso_pu_bacteria 2842237096 2842238447 283
90 iso_pu_bacteria 2842291075 2842293389 283
91 iso_pu_bacteria 2842341865 2842344359 283
92 iso_pu_bacteria 2842370503 2842370770 283
93 iso_pu_bacteria 2842377471 2842379786 283
94 iso_pu_bacteria 2842384541 2842386857 283
95 iso_pu_bacteria 2842395702 2842401785 283
96 iso_pu_bacteria 2842780639 2842784254 283
97 iso_pu_bacteria 2899803654 2899806882 283
98 iso_pu_bacteria 2916021584 2916028352 283
99 iso_pu_bacteria 2926754445 2926755205 283
100 iso_pu_bacteria 2928157003 2928160718 283
101 iso_pu_bacteria 2928163908 2928169776 283
102 iso_pu_bacteria 2928170801 2928178784 283
103 iso_pu_bacteria 2935703347 2935708190 283
104 iso_pu_bacteria 2935894831 2935896182 283
105 iso_pu_bacteria 2936002035 2936009426 283
106 iso_pu_bacteria 2964636051 2964639884 283
107 iso_pu_bacteria 2981990288 2981991645 283
108 iso_pu_bacteria 3005506211 3005512796 283
109 iso_pu_bacteria 641736154 642415055 283
110 iso_pu_bacteria 8005460587 8005460701 283
111 iso_pu_bacteria 8005695170 8005699557 283
112 iso_pu_bacteria 8016583857 8016593450 283
113 iso_pu_bacteria 8018150411 8018152960 283
114 iso_pu_bacteria 8018176218 8018181786 283
115 iso_pu_bacteria 8019565922 8019568941 283
116 iso_pu_bacteria 8057874678 8057877459 283
117 3300038443 Ga0395901_0354091 Ga0395901_0354091_83_964 284
118 3300048905 Ga0496102_0265976 Ga0496102_0265976_722_1576 284
119 3300048906 Ga0496103_0316586 Ga0496103_0316586_68_922 284
120 3300048909 Ga0496106_0031122 Ga0496106_0031122_1165_2019 284
121 3300048926 Ga0496123_0021002 Ga0496123_0021002_3433_4287 284
122 3300053734 Ga0500565_002013 Ga0500565_002013_244_1098 284
123 iso_pu_bacteria 2510917020 2511121786 284
124 iso_pu_bacteria 2582581280 2585150414 284
125 iso_pu_bacteria 2582581293 2585198712 284
126 iso_pu_bacteria 2643221583 2643924424 284
127 iso_pu_bacteria 2818991435 2819539497 284
128 iso_pu_bacteria 2818991454 2819649279 284
129 iso_pu_bacteria 2842805378 2842806549 284
130 iso_pu_bacteria 2858800743 2858804873 284
131 iso_pu_bacteria 2921201388 2921205164 284
132 iso_pu_bacteria 2937106411 2937106778 284
133 iso_pu_bacteria 2957457609 2957462269 284
134 iso_pu_bacteria 2964643177 2964644611 284
135 iso_pu_bacteria 2967664464 2967664959 284
136 iso_pu_bacteria 2970082768 2970086022 284
137 3300037471 Ga0395905_0203172 Ga0395905_0203172_674_1531 285
138 iso_pu_bacteria 2511231016 2511325520 285
139 iso_pu_bacteria 2511231018 2511341543 285
140 iso_pu_bacteria 2511231022 2511362496 285
141 iso_pu_bacteria 2597489887 2597859103 285
142 iso_pu_bacteria 2599185185 2599487466 285
143 iso_pu_bacteria 2599185257 2599806211 285
144 iso_pu_bacteria 2619619299 2621302318 285
145 iso_pu_bacteria 2643221633 2644189340 285
146 iso_pu_bacteria 2671180172 2671772725 285
147 iso_pu_bacteria 2738541265 2738674416 285
148 iso_pu_bacteria 2738541282 2738752809 285
149 iso_pu_bacteria 2738541303 2738861850 285
150 iso_pu_bacteria 2773857670 2774123728 285
151 iso_pu_bacteria 2773857673 2774134203 285
152 iso_pu_bacteria 2784132072 2784312242 285
153 iso_pu_bacteria 2816332298 2817488257 285
154 iso_pu_bacteria 2876808645 2876815589 285
155 iso_pu_bacteria 2879110137 2879116503 285
156 iso_pu_bacteria 2880230671 2880233919 285
157 iso_pu_bacteria 2904518522 2904523224 285
158 iso_pu_bacteria 8054285046 8054291323 285
159 iso_pu_bacteria 8056569372 8056574108 285
160 3300005344 Ga0070661_100271654 Ga0070661_1002716542 286
161 3300005457 Ga0070662_100057052 Ga0070662_1000570522 286
162 3300009092 Ga0105250_10012873 Ga0105250_100128733 286
163 3300009147 Ga0114129_10810103 Ga0114129_108101031 286
164 3300009176 Ga0105242_10083846 Ga0105242_100838461 286
165 3300013306 Ga0163162_10027168 Ga0163162_100271684 286
166 3300013308 Ga0157375_10019753 Ga0157375_100197533 286
167 3300017792 Ga0163161_10004279 Ga0163161_100042795 286
168 3300025711 Ga0207696_1042968 Ga0207696_10429682 286
169 3300025728 Ga0207655_1005481 Ga0207655_10054815 286
170 3300026067 Ga0207678_10104303 Ga0207678_101043032 286
171 3300028379 Ga0268266_10108104 Ga0268266_101081042 286
172 3300042005 Ga0439448_0000193 Ga0439448_0000193_9173_10033 286
173 3300046491 Ga0495584_0000352 Ga0495584_0000352_18027_18887 286
174 3300046492 Ga0495585_0028154 Ga0495585_0028154_2322_3194 286
175 3300046522 Ga0495643_0107815 Ga0495643_0107815_37_897 286
176 3300046537 Ga0495598_0061498 Ga0495598_0061498_268_1140 286
177 3300046616 Ga0495668_0223482 Ga0495668_0223482_70_942 286
178 3300046692 Ga0495671_0000160 Ga0495671_0000160_15604_16464 286
179 3300047320 Ga0495672_0013454 Ga0495672_0013454_2998_3858 286
180 3300048905 Ga0496102_0064417 Ga0496102_0064417_192_1052 286
181 3300048916 Ga0496113_0168625 Ga0496113_0168625_50_910 286
182 3300048927 Ga0496124_0033034 Ga0496124_0033034_1953_2813 286
183 3300049460 Ga0495682_0006499 Ga0495682_0006499_2136_2996 286
184 3300050507 nmdc:mga05p37_611721_c1 nmdc:mga05p37_611721_c1_82_945 286
185 3300050509 nmdc:mga0qj67_1754_c1 nmdc:mga0qj67_1754_c1_13941_14804 286
186 3300050510 nmdc:mga06r32_18913_c1 nmdc:mga06r32_18913_c1_4838_5701 286
187 iso_pu_bacteria 2904483920 2904489856 286
188 3300003187 JGI25151J46595_10000373 JGI25151J46595_100003739 287
189 3300005334 Ga0068869_100016667 Ga0068869_1000166672 287
190 3300005347 Ga0070668_100060701 Ga0070668_1000607012 287
191 3300005347 Ga0070668_100197663 Ga0070668_1001976632 287
192 3300005367 Ga0070667_100112608 Ga0070667_1001126082 287
193 3300005455 Ga0070663_100015708 Ga0070663_1000157083 287
194 3300005456 Ga0070678_100211662 Ga0070678_1002116621 287
195 3300005457 Ga0070662_100150022 Ga0070662_1001500223 287
196 3300005471 Ga0070698_100684712 Ga0070698_1006847121 287
197 3300005563 Ga0068855_100426708 Ga0068855_1004267082 287
198 3300005617 Ga0068859_100318311 Ga0068859_1003183112 287
199 3300005719 Ga0068861_100061529 Ga0068861_1000615293 287
200 3300005841 Ga0068863_100039775 Ga0068863_1000397754 287
201 3300005842 Ga0068858_100135006 Ga0068858_1001350063 287
202 3300005844 Ga0068862_100077186 Ga0068862_1000771862 287
203 3300006038 Ga0075365_10042710 Ga0075365_100427103 287
204 3300006048 Ga0075363_100207814 Ga0075363_1002078142 287
205 3300006051 Ga0075364_10027888 Ga0075364_100278883 287
206 3300006051 Ga0075364_10092716 Ga0075364_100927162 287
207 3300006177 Ga0075362_10013685 Ga0075362_100136853 287
208 3300006186 Ga0075369_10000717 Ga0075369_100007178 287
209 3300006186 Ga0075369_10030168 Ga0075369_100301682 287
210 3300006353 Ga0075370_10095963 Ga0075370_100959632 287
211 3300006353 Ga0075370_10142057 Ga0075370_101420572 287
212 3300006881 Ga0068865_100350601 Ga0068865_1003506012 287
213 3300006931 Ga0097620_100318285 Ga0097620_1003182852 287
214 3300006946 Ga0079104_1003726 Ga0079104_10037263 287
215 3300006948 Ga0099826_10000081 Ga0099826_1000008113 287
216 3300009036 Ga0105244_10044162 Ga0105244_100441622 287
217 3300009093 Ga0105240_10000645 Ga0105240_1000064572 287
218 3300009545 Ga0105237_10036302 Ga0105237_100363024 287
219 3300009545 Ga0105237_10131081 Ga0105237_101310813 287
220 3300010375 Ga0105239_10042245 Ga0105239_100422452 287
221 3300013102 Ga0157371_10000209 Ga0157371_1000020950 287
222 3300013296 Ga0157374_10035971 Ga0157374_100359712 287
223 3300013308 Ga0157375_10000466 Ga0157375_1000046617 287
224 3300014497 Ga0182008_10000251 Ga0182008_100002517 287
225 3300015261 Ga0182006_1001980 Ga0182006_10019807 287
226 3300017792 Ga0163161_10028069 Ga0163161_100280693 287
227 3300025256 Ga0209759_1008490 Ga0209759_10084903 287
228 3300025292 Ga0209676_1000190 Ga0209676_100019041 287
229 3300025294 Ga0209025_1000969 Ga0209025_100096947 287
230 3300025294 Ga0209025_1001557 Ga0209025_100155719 287
231 3300025901 Ga0207688_10016451 Ga0207688_100164513 287
232 3300025904 Ga0207647_10001905 Ga0207647_1000190510 287
233 3300025907 Ga0207645_10038180 Ga0207645_100381804 287
234 3300025908 Ga0207643_10023472 Ga0207643_100234723 287
235 3300025913 Ga0207695_10000547 Ga0207695_100005475 287
236 3300025914 Ga0207671_10040169 Ga0207671_100401694 287
237 3300025914 Ga0207671_10232675 Ga0207671_102326752 287
238 3300025926 Ga0207659_10217346 Ga0207659_102173462 287
239 3300025942 Ga0207689_10003059 Ga0207689_100030598 287
240 3300025972 Ga0207668_10299044 Ga0207668_102990442 287
241 3300026035 Ga0207703_10287958 Ga0207703_102879582 287
242 3300026067 Ga0207678_10003610 Ga0207678_1000361010 287
243 3300026088 Ga0207641_10126466 Ga0207641_101264662 287
244 3300026118 Ga0207675_100071305 Ga0207675_1000713053 287
245 3300026121 Ga0207683_10328680 Ga0207683_103286802 287
246 3300027111 Ga0209281_1002401 Ga0209281_10024019 287
247 3300027666 Ga0209282_1001951 Ga0209282_10019512 287
248 3300027866 Ga0209813_10015942 Ga0209813_100159422 287
249 3300028380 Ga0268265_10443650 Ga0268265_104436502 287
250 3300028794 Ga0307515_10240267 Ga0307515_102402671 287
251 3300031507 Ga0307509_10003502 Ga0307509_1000350216 287
252 3300032002 Ga0307416_100702902 Ga0307416_1007029021 287
253 3300037471 Ga0395905_0023224 Ga0395905_0023224_2630_3493 287
254 3300041507 Ga0451851_1035445 Ga0451851_1035445_131_994 287
255 3300041512 Ga0451853_2277222 Ga0451853_2277222_212_1075 287
256 3300041512 Ga0451853_3003955 Ga0451853_3003955_424_1287 287
257 3300046452 Ga0495617_000047 Ga0495617_000047_25829_26725 287
258 3300046471 Ga0495650_0001138 Ga0495650_0001138_3038_3934 287
259 3300046474 Ga0495605_0001243 Ga0495605_0001243_3134_4030 287
260 3300046491 Ga0495584_0000978 Ga0495584_0000978_2978_3874 287
261 3300046501 Ga0495607_0001194 Ga0495607_0001194_1913_2809 287
262 3300046506 Ga0495583_0041670 Ga0495583_0041670_905_1801 287
263 3300046507 Ga0495606_0047725 Ga0495606_0047725_1565_2440 287
264 3300046512 Ga0495610_0037474 Ga0495610_0037474_231_1106 287
265 3300046513 Ga0495616_0005307 Ga0495616_0005307_3936_4832 287
266 3300046515 Ga0495620_0029164 Ga0495620_0029164_1040_1915 287
267 3300046518 Ga0495631_0000793 Ga0495631_0000793_3738_4607 287
268 3300046519 Ga0495632_0000104 Ga0495632_0000104_48264_49160 287
269 3300046520 Ga0495637_0003835 Ga0495637_0003835_4775_5644 287
270 3300046520 Ga0495637_0005812 Ga0495637_0005812_2389_3285 287
271 3300046522 Ga0495643_0004021 Ga0495643_0004021_6782_7678 287
272 3300046522 Ga0495643_0059256 Ga0495643_0059256_450_1388 287
273 3300046524 Ga0495648_0000650 Ga0495648_0000650_12470_13366 287
274 3300046524 Ga0495648_0025913 Ga0495648_0025913_714_1610 287
275 3300046528 Ga0495642_0006181 Ga0495642_0006181_370_1266 287
276 3300046530 Ga0495654_0021813 Ga0495654_0021813_1980_2867 287
277 3300046530 Ga0495654_0127839 Ga0495654_0127839_26_922 287
278 3300046538 Ga0495609_0001713 Ga0495609_0001713_2754_3650 287
279 3300046542 Ga0495597_0006761 Ga0495597_0006761_3731_4627 287
280 3300046648 Ga0495611_0001284 Ga0495611_0001284_212_1108 287
281 3300046660 Ga0495625_0018045 Ga0495625_0018045_1128_2003 287
282 3300046691 Ga0495670_0043610 Ga0495670_0043610_929_1816 287
283 3300046692 Ga0495671_0028709 Ga0495671_0028709_178_1065 287
284 3300046694 Ga0495649_0008718 Ga0495649_0008718_3720_4616 287
285 3300046794 Ga0495589_0001005 Ga0495589_0001005_13471_14367 287
286 3300046810 Ga0495660_0036623 Ga0495660_0036623_855_1751 287
287 3300047318 Ga0495636_0002693 Ga0495636_0002693_3487_4383 287
288 3300047320 Ga0495672_0001945 Ga0495672_0001945_4376_5272 287
289 3300047320 Ga0495672_0026420 Ga0495672_0026420_1634_2530 287
290 3300047443 Ga0495687_000692 Ga0495687_000692_17057_17953 287
291 3300047447 Ga0495685_005415 Ga0495685_005415_3068_3964 287
292 3300047447 Ga0495685_057631 Ga0495685_057631_358_1233 287
293 3300047469 Ga0495673_0002142 Ga0495673_0002142_6645_7541 287
294 3300047472 Ga0495686_0056040 Ga0495686_0056040_283_1170 287
295 3300048091 Ga0495626_0000519 Ga0495626_0000519_34598_35494 287
296 3300048905 Ga0496102_0109912 Ga0496102_0109912_49_930 287
297 3300048907 Ga0496104_0275847 Ga0496104_0275847_414_1277 287
298 3300048909 Ga0496106_0113439 Ga0496106_0113439_69_932 287
299 3300048916 Ga0496113_0038094 Ga0496113_0038094_2213_3076 287
300 3300048919 Ga0496116_0037002 Ga0496116_0037002_1491_2354 287
301 3300048920 Ga0496117_0057071 Ga0496117_0057071_1059_1922 287
302 3300048921 Ga0496118_0027531 Ga0496118_0027531_378_1244 287
303 3300048921 Ga0496118_0032844 Ga0496118_0032844_1025_1888 287
304 3300048921 Ga0496118_0099390 Ga0496118_0099390_391_1254 287
305 3300048922 Ga0496119_0000047 Ga0496119_0000047_91046_91909 287
306 3300048923 Ga0496120_0000041 Ga0496120_0000041_3706_4569 287
307 3300048923 Ga0496120_0036236 Ga0496120_0036236_1679_2554 287
308 3300048923 Ga0496120_0096110 Ga0496120_0096110_419_1285 287
309 3300048924 Ga0496121_0000191 Ga0496121_0000191_23669_24532 287
310 3300048924 Ga0496121_0000373 Ga0496121_0000373_42402_43265 287
311 3300048924 Ga0496121_0019621 Ga0496121_0019621_4032_4907 287
312 3300048924 Ga0496121_0020118 Ga0496121_0020118_314_1201 287
313 3300048924 Ga0496121_0033847 Ga0496121_0033847_1203_2066 287
314 3300048924 Ga0496121_0038397 Ga0496121_0038397_1851_2720 287
315 3300048925 Ga0496122_0001605 Ga0496122_0001605_27240_28103 287
316 3300048925 Ga0496122_0116614 Ga0496122_0116614_172_1047 287
317 3300048926 Ga0496123_0003847 Ga0496123_0003847_13292_14155 287
318 3300048927 Ga0496124_0002311 Ga0496124_0002311_6051_6914 287
319 3300048927 Ga0496124_0050551 Ga0496124_0050551_1017_1880 287
320 3300048928 Ga0496125_0000709 Ga0496125_0000709_42173_43036 287
321 3300048928 Ga0496125_0085765 Ga0496125_0085765_194_1081 287
322 3300048928 Ga0496125_0087834 Ga0496125_0087834_499_1362 287
323 3300048929 Ga0496126_0000238 Ga0496126_0000238_22874_23737 287
324 3300048929 Ga0496126_0019556 Ga0496126_0019556_3276_4142 287
325 3300048929 Ga0496126_0041076 Ga0496126_0041076_2428_3291 287
326 3300048929 Ga0496126_0058654 Ga0496126_0058654_2118_2981 287
327 3300049459 Ga0495678_000441 Ga0495678_000441_2766_3662 287
328 3300050489 nmdc:mga03683_18721_c1 nmdc:mga03683_18721_c1_661_1524 287
329 3300050492 nmdc:mga0yw44_320814_c1 nmdc:mga0yw44_320814_c1_34_909 287
330 3300050494 nmdc:mga06z11_115409_c1 nmdc:mga06z11_115409_c1_22_885 287
331 3300050495 nmdc:mga04h51_23535_c1 nmdc:mga04h51_23535_c1_85_948 287
332 3300050516 nmdc:mga0sz30_15011_c1 nmdc:mga0sz30_15011_c1_211_1074 287
333 3300050516 nmdc:mga0sz30_20819_c1 nmdc:mga0sz30_20819_c1_1593_2480 287
334 3300053079 Ga0500610_0000575 Ga0500610_0000575_5568_6437 287
335 3300053087 Ga0500643_023786 Ga0500643_023786_879_1754 287
336 3300053096 Ga0500641_0009881 Ga0500641_0009881_2463_3338 287
337 3300053098 Ga0500650_0028691 Ga0500650_0028691_250_1125 287
338 3300053104 Ga0500556_0000012 Ga0500556_0000012_56849_57724 287
339 3300053116 Ga0500592_007527 Ga0500592_007527_210_1079 287
340 3300053118 Ga0500594_0000365 Ga0500594_0000365_8828_9697 287
341 3300053130 Ga0500642_0000013 Ga0500642_0000013_131498_132373 287
342 3300053131 Ga0500652_001393 Ga0500652_001393_3076_3963 287
343 3300053134 Ga0500658_0000166 Ga0500658_0000166_15933_16808 287
344 3300053139 Ga0500568_0000676 Ga0500568_0000676_857_1732 287
345 3300053139 Ga0500568_0001031 Ga0500568_0001031_10318_11187 287
346 3300053151 Ga0500604_0045652 Ga0500604_0045652_248_1135 287
347 3300053153 Ga0500616_0050648 Ga0500616_0050648_704_1642 287
348 3300053153 Ga0500616_0057920 Ga0500616_0057920_1060_1935 287
349 3300053154 Ga0500619_034165 Ga0500619_034165_482_1369 287
350 3300053156 Ga0500622_0006199 Ga0500622_0006199_2102_2989 287
351 3300053161 Ga0500634_0017193 Ga0500634_0017193_250_1137 287
352 3300053161 Ga0500634_0084114 Ga0500634_0084114_670_1533 287
353 3300053730 Ga0500645_010381 Ga0500645_010381_1041_1928 287
354 iso_pu_bacteria 2600255279 2601612345 287
355 iso_pu_bacteria 2600255308 2601749257 287
356 iso_pu_bacteria 2744054900 2746090038 287
357 iso_pu_bacteria 2744054901 2746099061 287
358 iso_pu_bacteria 2808606379 2808943598 287
359 iso_pu_bacteria 2857524615 2857527088 287
360 iso_pu_bacteria 2912963787 2912965826 287
361 iso_pu_bacteria 2919073203 2919078202 287
362 iso_pu_bacteria 2933594066 2933598583 287
363 iso_pu_bacteria 8006984368 8006987204 287
364 iso_pu_bacteria 8019555841 8019556371 287
365 3300003794 Ga0055531_10000965 Ga0055531_1000096511 288
366 3300005364 Ga0070673_100503086 Ga0070673_1005030861 288
367 3300006847 Ga0075431_100025650 Ga0075431_1000256507 288
368 3300010375 Ga0105239_10324067 Ga0105239_103240672 288
369 3300013104 Ga0157370_10000398 Ga0157370_1000039826 288
370 3300013296 Ga0157374_10387941 Ga0157374_103879411 288
371 3300013297 Ga0157378_10380457 Ga0157378_103804572 288
372 3300025297 Ga0209758_1003930 Ga0209758_100393010 288
373 3300025304 Ga0209257_1000538 Ga0209257_100053857 288
374 3300026041 Ga0207639_10139784 Ga0207639_101397842 288
375 3300046453 Ga0495627_000331 Ga0495627_000331_26251_27117 288
376 3300046519 Ga0495632_0000615 Ga0495632_0000615_29376_30242 288
377 3300046810 Ga0495660_0030605 Ga0495660_0030605_558_1424 288
378 3300047470 Ga0495681_0018243 Ga0495681_0018243_2235_3107 288
379 3300006058 Ga0075432_10005619 Ga0075432_100056193 289
380 3300009036 Ga0105244_10013847 Ga0105244_100138472 289
381 3300009092 Ga0105250_10000207 Ga0105250_100002072 289
382 3300009092 Ga0105250_10017372 Ga0105250_100173722 289
383 3300009176 Ga0105242_10345641 Ga0105242_103456412 289
384 3300013307 Ga0157372_10000821 Ga0157372_1000082111 289
385 3300013308 Ga0157375_10020274 Ga0157375_100202747 289
386 3300014497 Ga0182008_10000429 Ga0182008_100004293 289
387 3300015261 Ga0182006_1007269 Ga0182006_10072693 289
388 3300025711 Ga0207696_1000002 Ga0207696_1000002340 289
389 3300025711 Ga0207696_1011178 Ga0207696_10111782 289
390 3300025728 Ga0207655_1013777 Ga0207655_10137772 289
391 3300025735 Ga0207713_1006129 Ga0207713_10061293 289
392 3300025735 Ga0207713_1007845 Ga0207713_10078455 289
393 3300030521 Ga0307511_10017686 Ga0307511_100176862 289
394 3300031507 Ga0307509_10245721 Ga0307509_102457211 289
395 3300041405 Ga0439438_002520 Ga0439438_002520_3163_4032 289
396 3300041407 Ga0439447_005563 Ga0439447_005563_2775_3644 289
397 3300041411 Ga0439466_0005163 Ga0439466_0005163_2775_3644 289
398 3300041413 Ga0439465_0002423 Ga0439465_0002423_1541_2410 289
399 3300042006 Ga0439432_003642 Ga0439432_003642_3740_4609 289
400 3300042009 Ga0439451_018068 Ga0439451_018068_249_1118 289
401 3300042010 Ga0439452_004120 Ga0439452_004120_2816_3685 289
402 3300042013 Ga0439456_011670 Ga0439456_011670_623_1492 289
403 3300042016 Ga0439463_008411 Ga0439463_008411_1383_2252 289
404 3300042115 Ga0450911_001667 Ga0450911_001667_3382_4251 289
405 3300042121 Ga0450919_000226 Ga0450919_000226_4161_5030 289
406 3300042138 Ga0450903_002701 Ga0450903_002701_1440_2309 289
407 3300042145 Ga0450906_004234 Ga0450906_004234_479_1348 289
408 3300042156 Ga0439446_0000458 Ga0439446_0000458_3376_4245 289
409 3300042184 Ga0450908_000492 Ga0450908_000492_3312_4181 289
410 3300042461 Ga0439460_0005851 Ga0439460_0005851_1366_2235 289
411 3300042993 Ga0439440_0021134 Ga0439440_0021134_205_1074 289
412 3300046452 Ga0495617_004806 Ga0495617_004806_2587_3456 289
413 3300046455 Ga0495603_0021354 Ga0495603_0021354_962_1831 289
414 3300046457 Ga0495590_0006220 Ga0495590_0006220_2179_3048 289
415 3300046458 Ga0495591_000144 Ga0495591_000144_14946_15815 289
416 3300046460 Ga0495638_0176858 Ga0495638_0176858_172_1041 289
417 3300046471 Ga0495650_0001218 Ga0495650_0001218_8656_9525 289
418 3300046474 Ga0495605_0001055 Ga0495605_0001055_9942_10811 289
419 3300046475 Ga0495639_0081930 Ga0495639_0081930_344_1213 289
420 3300046491 Ga0495584_0028016 Ga0495584_0028016_1236_2105 289
421 3300046492 Ga0495585_0012751 Ga0495585_0012751_2802_3671 289
422 3300046499 Ga0495594_0005760 Ga0495594_0005760_1904_2773 289
423 3300046501 Ga0495607_0037588 Ga0495607_0037588_598_1467 289
424 3300046501 Ga0495607_0057893 Ga0495607_0057893_869_1738 289
425 3300046501 Ga0495607_0118849 Ga0495607_0118849_316_1185 289
426 3300046519 Ga0495632_0002308 Ga0495632_0002308_5824_6693 289
427 3300046522 Ga0495643_0026570 Ga0495643_0026570_1802_2671 289
428 3300046523 Ga0495644_0029451 Ga0495644_0029451_177_1046 289
429 3300046528 Ga0495642_0000082 Ga0495642_0000082_29782_30651 289
430 3300046538 Ga0495609_0000316 Ga0495609_0000316_22881_23750 289
431 3300046557 Ga0495622_0005762 Ga0495622_0005762_1563_2432 289
432 3300046615 Ga0495656_0012951 Ga0495656_0012951_1629_2498 289
433 3300046616 Ga0495668_0055817 Ga0495668_0055817_381_1250 289
434 3300046648 Ga0495611_0036271 Ga0495611_0036271_276_1145 289
435 3300046664 Ga0495659_0001267 Ga0495659_0001267_410_1279 289
436 3300046665 Ga0495661_0000047 Ga0495661_0000047_66631_67500 289
437 3300046684 Ga0495669_0000895 Ga0495669_0000895_3754_4623 289
438 3300046691 Ga0495670_0042116 Ga0495670_0042116_264_1133 289
439 3300046794 Ga0495589_0003672 Ga0495589_0003672_2510_3379 289
440 3300046810 Ga0495660_0001910 Ga0495660_0001910_1797_2666 289
441 3300047320 Ga0495672_0012476 Ga0495672_0012476_560_1429 289
442 3300047323 Ga0495683_0012180 Ga0495683_0012180_36_905 289
443 3300047445 Ga0495677_0001731 Ga0495677_0001731_761_1630 289
444 3300047446 Ga0495679_003259 Ga0495679_003259_5766_6635 289
445 3300047447 Ga0495685_002424 Ga0495685_002424_4071_4940 289
446 3300047469 Ga0495673_0005975 Ga0495673_0005975_2530_3399 289
447 3300047470 Ga0495681_0023527 Ga0495681_0023527_169_1038 289
448 3300048920 Ga0496117_0000597 Ga0496117_0000597_20287_21156 289
449 3300048920 Ga0496117_0039081 Ga0496117_0039081_138_1007 289
450 3300048921 Ga0496118_0161878 Ga0496118_0161878_223_1092 289
451 3300048922 Ga0496119_0003729 Ga0496119_0003729_6472_7341 289
452 3300048922 Ga0496119_0032704 Ga0496119_0032704_1532_2401 289
453 3300048923 Ga0496120_0002470 Ga0496120_0002470_3534_4403 289
454 3300048923 Ga0496120_0055498 Ga0496120_0055498_358_1227 289
455 3300048925 Ga0496122_0022873 Ga0496122_0022873_3814_4683 289
456 3300048926 Ga0496123_0014379 Ga0496123_0014379_1029_1898 289
457 3300048927 Ga0496124_0000747 Ga0496124_0000747_7257_8126 289
458 3300048927 Ga0496124_0036107 Ga0496124_0036107_1638_2507 289
459 3300048927 Ga0496124_0117464 Ga0496124_0117464_1239_2108 289
460 3300048928 Ga0496125_0000465 Ga0496125_0000465_7084_7953 289
461 3300048928 Ga0496125_0048096 Ga0496125_0048096_369_1238 289
462 3300048929 Ga0496126_0001120 Ga0496126_0001120_35047_35916 289
463 3300048929 Ga0496126_0316246 Ga0496126_0316246_206_1075 289
464 3300049459 Ga0495678_036484 Ga0495678_036484_926_1795 289
465 3300037418 Ga0395900_0035463 Ga0395900_0035463_2729_3619 296
466 3300048925 Ga0496122_0139539 Ga0496122_0139539_164_1072 300
467 3300002705 JGI25156J39149_1001068 JGI25156J39149_10010688 301
468 3300003214 JGI25165J46597_1002883 JGI25165J46597_10028836 301
469 3300003756 Ga0055533_1000156 Ga0055533_100015659 301
470 3300003758 Ga0055532_1000045 Ga0055532_1000045162 301
471 3300003760 Ga0055527_1000027 Ga0055527_1000027162 301
472 3300003761 Ga0055535_1000033 Ga0055535_1000033162 301
473 3300003762 Ga0055542_1000050 Ga0055542_1000050162 301
474 3300003763 Ga0055529_1000061 Ga0055529_1000061162 301
475 3300025225 Ga0209566_105190 Ga0209566_1051902 301
476 3300025226 Ga0209674_100074 Ga0209674_100074160 301
477 3300025228 Ga0209672_100053 Ga0209672_100053161 301
478 3300025229 Ga0209147_100070 Ga0209147_100070161 301
479 3300025230 Ga0209563_100760 Ga0209563_10076011 301
480 3300025231 Ga0207427_102893 Ga0207427_1028934 301
481 3300025242 Ga0209258_100094 Ga0209258_100094161 301
482 3300025254 Ga0209148_1000100 Ga0209148_1000100161 301
483 3300025256 Ga0209759_1000009 Ga0209759_1000009164 301
484 3300025261 Ga0209233_1000144 Ga0209233_1000144166 301
485 3300025272 Ga0209455_1000090 Ga0209455_1000090161 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

100

332

0.88

PF12146

Hydrolase_4

Serine aminopeptidase, S33

116

332

0.87

PF08386

Abhydrolase_4

TAP-like protein

272

346

0.84

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

105

341

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.9485 26 299
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.935 26 299
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8918 31 152
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8863 29 152
6u2m-assembly2.cif.gz_C crystal structure of a halotag-based calcium indicator, halocamp v2, bound to jf635 0.8754 31 152
ID Description Score Start End Superfamily
af_O53327_8_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9924 26 299 3.40.50.1820
af_O53327_8_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9747 26 299 3.40.50.1820
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.962 26 299 3.40.50.1820
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.948 26 299 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8479 31 147 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2A6LNL0-F1-model_v4 Alpha/beta hydrolase 0.9962 59 301 GO:0016787
AF-A0A1N7MK62-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9942 26 301
AF-A0A2V8N4B6-F1-model_v4 Alpha/beta hydrolase 0.9934 25 301 GO:0016787
AF-A0A2N5JFN7-F1-model_v4 deleted 0.9901 26 301
AF-A0A2A6LNL0-F1-model_v4 Alpha/beta hydrolase 0.9881 59 301 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map